SQLite format 3@  E-! >>b!tablepuddlepuddle DCREATE TABLE puddle(code text primary key unique, language text, namespace text, subspace text, qqq text, name text, icon text, position int DEFAULT 100, user text, created_at text, view_pass int, add_pass int, edit_pass int, register_level int, upload_level int),?indexsqlite_autoindex_puddle_1puddle E9Oindexterm_idtermCREATE INDEX term_id on TERM (id)QtabletermtermCREATE TABLE term(id int, prime int, term text, lower text)0?tableentryentryCREATE TABLE entry(id int primary key unique, user text, created_at text, updated_at text, sign text, signtext text, text text, source text, detail text))=indexsqlite_autoindex_entry_1entry ('Lm;<7p`1A*x{V‚/~rfZNB6* 1 0X10}|G#"onIa`fRR~FDD^66l((qqwork: we had trouble starting the car.
  • [with object] to cause or enable (someone or something) to begin doing or pursuing something: his father started him in business | what he said started me thinking.
    • noun
    1. the point in time or space at which something has its origin; the beginning: he takes over as chief executive at the start of next year | the event was a shambles from start to finish | his bicycle was found close to the start of a forest trail.
    2. an act of beginning to do or deal with something: an early start enabled us to avoid the traffic.
    3. used to indicate that a useful initial contribution has been made but that more remains to be done: if he would tell her who had put him up to it, it would be a start.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8fc\udc61\ud8c7\udcca\ud8fc\udc61\ud8d9\udf87\ud8d9\udf21\ud8ea\udd21.mov"}4S2ea06488x476M511x542S1f720490x459S10120495x478S10e20495x512 S38a00464x490 M534x515S1f720467x500S1dc20491x485S26506519x501 M515x520S10650488x494S2035a500x486S20500485x481 S38904464x493 M521x524S1f740501x476S1f748479x485S20e00503x494S22a04502x509 M528x529S10030509x499S10038477x499S2a200505x472S2a218473x472 S38a04464x490 M536x518S2ff00482x483S16d10507x482S22a07523x470 M513x524S10000491x494S2ea06488x476 M521x518S16d10483x498S15a1a479x484S22a00508x483 M517x508S14a20483x493S26506502x494 S38800464x496 S38a00464x490 S38b00470x493 M513x524S10008493x494S2ea1e488x476 S38b04470x493
    adverb
    1. at all times; on all occasions: the sun always rises in the east.
    PHONOLOGICAL VARIANTS
    always left-handed
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8fc\udc61\u00d8\ud8ed\udfc7.mov"} ` 33][%!frost2021/01/04 23:46:312026/08/23 21:49:12AS10000S2fe00S10006M508x515S10000493x485M516x531S15a38484x498S1ce50493x501S20e00496x486S26a00489x470 M535x531S18510497x496S18514473x488S20600485x478S2c300509x469S2c314465x507  PP-33)}!Afrost2008/06/11 00:02:242026/08/22 21:43:49AS10000S30004S10006S20500S2b701M525x542S2ff00482x483S10000486x512S2b701506x519S38b00470x493 M518x542S2ff00482x483S10008498x512S2b710474x519 S38b04470x493 S38a00464x490 M518x542S2ff00482x483S10000486x512S2b704504x518
    verb
    1. [to front locus] to communicate information, facts, or news to someone: I told you she was coming.
    2. to narrate or relate (a tale or story): they like telling jokes.
    PHONOLOGICAL VARIANTS
    tell left-handed
    INFLECTED FORMS
    tell [front to center loci]
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8f0\udc05\u00d8\ud8d8\udde1\ud8e9\udca2.mov"} )!33ik!{frost2008/06/11 00:03:302026/08/22 18:54:45AS10000S30004S10006S20e00S22f04S21800M533x553S2ff00482x483S10000487x511S20e00514x514S22f04508x528S21800511x545M527x553S2ff00482x483S10000487x511S20e00514x514S22a04514x528S21600516x545
    adjective, noun [in isolation]
    1. the color red.
    Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc01\ud8f0\udc05\u00d8\ud8d9\udd41\ud8dc\udda5\ud8da\udd01.mov"} ||33ku!Kfrost2020/05/12 20:32:502026/08/23 21:49:35AS10000S2fe00S10006S21d00M512x521S10000489x491S21d00494x480M509x521S10000491x491S21b00501x480 S38a00464x490 S38b00470x493 M512x521S10008497x491S21d00489x480 S38b04470x493
    number [in isolation]
    1. eleven.
    PHONOLOGICAL VARIANTS
    eleven left-handed
    Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc01\ud8fc\udc61\u00d8\ud8da\udee1.mov"} AA< 33[ A!}frost2008/06/11 00:07:092026/08/22 21:43:11AS10004S2fe00S10008S2fe00S37f00S2e706S2e742M513x545S10004495x472S10008489x497S2e706487x455S2e742488x529
    verb
    1. to change the position of one's body so that one is facing in a different direction: the dancer turned around and exited the stage.
    noun
    1. a mobile, destructive vortex of violently rotating winds having the appearance of a funnel-shaped cloud and advancing beneath a large storm system.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc05\ud8fc\udc61\ud8c0\udc09\ud8fc\udc61\ud8fb\udfa1\ud8ed\udea7\ud8ed\udee3.mov"} KKt'33uY!)frost2008/06/11 00:09:012026/08/22 21:42:26AS10000S2fe00S10006S2ea06M513x524S10000491x49D 33[ Q!}frost2008/06/11 00:08:112026/08/22 21:42:52AS10004S2fe00S1000cS2fe00S38006S22f04S22f14M529x525S10004510x476S1000c475x476S22f04504x511S22f14472x511
    adverb
    1. in, at, or to this exact place or position: they have worked right here most of their lives.
    2. (in printed text) mentioned later or further down on the same page: the most common methods are shown below.
    Adam Frost{"video":"dominance: equal;\\n\ud8c0\udc05\ud8fc\udc61\ud8c0\udc0d\ud8fc\udc61\ud8fc\udc07\ud8dc\udda5\ud8dc\uddb5.mov"}eposition
    1. with the addition of: two plus four is six | he was awarded the full amount plus interest.
    2. together with: all apartments have a small kitchen plus private bathroom.
    adjective
    1. (after a number or amount) at least: companies put losses at $500,000 plus.
    2. (after a grade) better than: B plus.
    3. having a positive electric charge.
    noun
    1. a mathematical operation of addition: a minus and a plus make another minus.
    2. an advantage: knowing the language is a decided plus.
    conjunction
    1. furthermore; also: it's packed full of medical advice, plus it keeps you informed about the latest research.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1.mov"} RD 33[ Q!}frost2008/06/11 00:10:012026/08/22 21:42:00AS10011S2fe00S10019S2fe00S38006S2e704S2e748M525x535S10011501x466S10019476x475S2e704510x500S2e748483x510
    noun
    1. a gesture used in a system of sign language: what is the sign for dog?.
    verb
    1. to communicate or express (something) in sign language: we are learning to sign.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8fc\udc61\ud8c0\udc1a\ud8fc\udc61\ud8fc\udc07\ud8ed\udea5\ud8ed\udee9.mov"} !!\ 33) o!A frost2008/06/11 00:15:362026/10/03 19:01:44AS10011S30005S10006S21100S2c400M561x538S2ff00482x483S10011516x508S2c400521x490
    noun
    1. a sweet food made with sugar or other sweeteners, typically formed in small, shaped pieces and flavored with chocolate, fruit, or nuts: people sat eating popcorn and candy.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f0\udc06\u00d8\ud8d9\ude61\ud8ea\udd81.mov"} SS 33 Y!e frost2008/06/11 00:27:112026/08/22 21:40:00AS10012S2fe00S10018S2fe00S21414S20500M515x515S10018489x485S10012485x491
    pr  33A u!q frost2008/06/11 00:23:472026/08/22 21:48:58AS10011S30006S10006S20500S22a03S30005S20500M539x529S2ff00482x483S10011518x499S20500502x518
    adjective
    1. deficient in the sense of hearing: I am deaf, so write what you say.
    2. (usually capitalized) relating to people who identify with the Deaf community and the use of sign language, especially American Sign Language: this play is about the lives of Deaf people.
    noun
    1. (usually capitalized) members of the Deaf community: they work with the Deaf.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f0\udc07\u00d8\ud8d8\udde1\ud8db\udfc4\ud8f0\udc06\ud8d8\udde1.mov"}[with object] to begin to attend (an educational establishment) or engage in (an occupation, especially a profession): she will start school today | he started work at a travel agency.
  • to cost at least a specified amount: fees start at around $300 | it's quite expensive, starting from $800 for the most basic model.
  • (of event or process) to happen or come into being: the fire started in the building's upper floor | Townsend's troubles started before the incident.
  • [with object] to cause (an event or process) to happen: two men started the blaze that caused the explosion | those women started all the trouble | I'm starting a campaign to get the law changed.
  • (of a machine or device) to begin operating or being used: what should I do if the engine won't start again? | there was a moment of silence before the organ started.
  • [with object] to cause (a machine) to begin to t (verb).
    • noun
    1. a mathematical operation of subtraction.
    2. a disadvantage: for every plus with this equipment there can be a minus.
    3. a photographic image made on film or specially prepared glass that shows the light and shade or color values reversed from the original, and from which positive prints can be made: photographs and negatives should be supplied for enlargement purposes.
    4. a result of a test or experiment indicating that a certain substance is not present or a certain condition does not exist: the percentage of false negatives generated by a cancer test was of great concern.
    5. the part of an electric circuit that is at a lower electrical potential than another part designated as having zero electrical potential.
    6. a number less than zero.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8fc\udc61\ud8c8\udde9\ud8fc\udc61\ud8d9\udf91\ud8d8\udde1.mov"}sults of a test or experiment) indicating that a certain substance or condition is not present or does not exist: a negative test result.
  • (of a person) not having a specified condition or showing traces of a specified substance in their body: so far all the patients have tested negative for TB | [in combination] : HPV-negative.
  • (of a person, attitude, or situation) not desirable or optimistic: not all the news is negative | I don't want to be negative, but I don't see how we could do it.
  • (before a number) below zero: minus 10° Fahrenheit | negative five.
  • (after a grade) slightly worse than: my lowest grade was a B minus.
  • having a negative electric charge.
  • (of a photographic image) showing light and shade or colors reversed from those of the original.
    • verb
    1. to subtrac !!P 33[ i!} frost2008/06/11 00:28:112026/08/22 21:38:04AS10012S2fe00S14c49S2fe00S21406S21300S2c300M526x527S14c49474x500S10012489x503S21300475x480S2c300500x473
      verb [no object]
      1. to be reckoned from a particular point in time or space: the season starts in September | we ate before the show started.
      2. to embark on a continuing action or a new venture: I started to chat to him | we plan to start building in the fall.
      3. to use a particular point, action, or circumstance as an opening for a course of action: the teacher can start by capitalizing on children's curiosity | I shall start with the case you mention first.
      4. e helped put matters right.
      adverb
      1. correctly: he had guessed right.
        • in the required or necessary way; properly; satisfactorily: nothing's going right for me this season.
      noun
      1. that which is morally correct, just, or honorable: she doesn't understand the difference between right and wrong | the rights and wrongs of the matter
      exclamation informal
      1. used to indicate one's agreement or to acknowledge a statement or order: “Barry's here.” “Oh, right” | right you are, sir.
        • used at the end of a statement to invite agreement, approval, or confirmation: you went to see Angie on Monday, right?.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc42\ud8fc\udc61\ud8c0\udc0b\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1.mov"}e presence or company of (someone) by chance or arrangement: a week later I met him on the street | [no object] : we met for lunch.
    2. to make the acquaintance of (someone) for the first time: she took Paul to meet her parents | [no object] : we met at an office party.
    3. [nonstandard] to fulfill or satisfy (a need, requirement, or condition): this policy is doing nothing to meet the needs of women | they failed to meet the noon deadline.
    INFLECTED FORMS
    meet [from center and front loci]
    meet [center to front loci]
    meet [front to center loci]
    Adam Frost{"video":"dominance: equal;\\n\ud8c0\udc11\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1.mov"} .z 33!e frost2008/06/11 00:29:522026/08/23 21:58:38AS10012S2fe00S15a28S2fe00S21410S20500M519x517S10012489x502S15a28482x483M516x545S15a49484x455S14e20491x464S20e00498x497S22a04498x512S20350498x530
    preposition
    1. with the subtraction of: what's ninety-three minus seven?.
    adjective
    1. consisting in or characterized by the absence rather than the presence of distinguishing features.
      • (of the re bb 33C S!Afrost2008/06/11 00:30:412026/08/22 21:46:17AS10012S30000S10006S20e00S26506M568x518S2ff00482x483S10012505x488S20e00538x489S26506553x487
        adjective
        1. of the very darkest color owing to the absence of or complete absorption of light; the opposite of white: black smoke | her long black hair.
        noun
        1. black color or pigment: a tray decorated in black and green | a series of paintings done only in grays and blacks.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8f0\udc01\u00d8\ud8d9\udd41\ud8e1\udde7.mov"} zz 33C #!Afrost2008/06/11 00:33:392026/08/22 21:48:17AS10012S30004S10006S20e00S2ea00M532x560S2ff00482x483S10012502x512S20e00494x520S2ea00494x535
        noun
        1. one with the able to hear well; not deaf: Peter and Nita have endured years of being treated with condescension and disrespect by hearing people.
        2. one not associated with deaf people or Deaf culture: hearing people make the laws that affect deaf people.
        adjective
        1. able to hear well; not deaf: an award-winning show aimed at young children, both deaf and hearing.
        2. not associated with deaf people or Deaf culture: they sent their child to a public school, rather than a deaf school.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8f0\udc05\u00d8\ud8d9\udd41\ud8ed\udfc1.mov"}erent ways | the car is different from anything else on the market | this land seemed different than the rest.
      • distinct; separate: on two different occasions.
    conjunction
    1. used to introduce a phrase or clause contrasting with what has already been mentioned: he stumbled but didn't fall | this is one principle, but it is not the only one | the problem is not that they are cutting down trees, but that they are doing it in a predatory way | I am clean but you are dirty.
    2. used to introduce a response expressing a feeling such as surprise or anger: but that's an incredible saving! | but why?.
    3. used after an expression of apology for what one is about to say: I'm sorry, but I can't pay you.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc22\ud8fc\udc61\ud8c0\udc2a\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1\ud8e1\udde7\ud8e1\uddf3.mov"}  33 +!)frost2008/06/11 00:36:052026/08/22 22:25:14AS10020S2fe00S10006S2450aM518x517S10020482x487S2450a487x483
    noun
    1. the twenty-sixth letter of the fingerspelling alphabet.
      • denoting the next after Y in a set of items, categories, sizes, etc.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8de\uddeb.mov"}Y33M!efrost2008/06/11 00:34:202026/08/22 22:24:10AS10010S2fe00S10018S2fe00S21406S20500M516x515S10010501x485S10018485x485M511x519S10008490x482S10020496x489 M511x528S10008490x473S10020496x480S26500497x513 M514x528S10000493x491S10028487x498S26504500x473
    verb [from left and right loci]
    1. to come into th ,x,hA 33g '!frost2008/06/11 00:38:112026/08/22 22:34:56AS10021S2fe00S10029S2fe00S21414S20500S26506S26512M547x511S10021495x490S10029475x490S26506532x494S26512453x494
      adjective
      1. not the same as another or each other; unlike in nature, form, or quality: you can play this game in diff 33[ S!}frost2021/02/14 22:58:102026/08/26 17:49:30AS17620S2fe00S17628S2fe00S38006S26506S26512M540x508S17620505x492S17628480x492S26506525x492S26512461x492
        determiner
        1. not any: there is no excuse.
        pronoun
        1. not any: none of you want to work | don't use any more water, or there'll be none left for me.
          • no person; no one: none could match her looks.
        Adam Frost{"video":"dominance: equal;\\n\ud8cb\udc61\ud8fc\udc61\ud8cb\udc69\ud8fc\udc61\ud8fc\udc07\ud8e1\udde7\ud8e1\uddf3.mov"}ht answer         | her theories were proved right | make sure you have been given the correct information.
        • [predicative] not mistaken in one's opinion or judgment: she was right about Tom having no money | the government was correct to follow a course of defeating inflation.
        • according to what is correct for a particular situation or thing: is this the right way to the cottage? | you're not holding it the right way up.
        • the best or most suitable of a number of possible choices for a particular purpose or occasion: he was clearly the right man for the job | I was waiting for the right moment to ask him | cut the top and bottom tracks to the correct length with a hacksaw.
        • socially fashionable or important: he was seen at all the right places.
      2. [predicative] in a satisfactory, sound, or normal state or condition: that sausage doesn't smell right | if only I could hav h 33 E!)frost2008/06/11 00:57:432026/08/22 22:37:24AS10040S2fe00S10006S26500M508x523S10040493x493S26500493x477
        pronoun
        1. [at front locus] used to refer to a person or thing: I love you.
        determiner
        1. [at front locus] used to indicate to a person or thing: I want that book.
        adverb
        1. [at front locus] in, at, or to a place or position: the car was there in front of me.
        preposition
        1. [at front locus] expressing location or arrival in a place or position: I saw a woman at the house.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc41\ud8fc\udc61\u00d8\ud8e1\udde1.mov"}
      3. a man or boy: the audience consisted of adult males.
      4. an animal or plant typically associated with the ability to produce sperm or pollen: the males have brilliant sky-blue wings.
      adjective
      1. of or denoting the sex that produces small, typically motile gametes, especially spermatozoa, with which a female may be fertilized or inseminated to produce offspring: male children | the participants are mostly male.
        • relating to men or the male gender: male unemployment.
        • (of a plant or flower) bearing stamens but lacking functional pistils.
        • (of parts of machinery, fittings, etc.) designed to enter, fill, or fit inside a corresponding female part: the valve has standard half-inch threaded male ends.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udca1\ud8f0\udc08\u00d8\ud8d8\udde1\ud8db\udfc4\ud8c7\udc91\ud8fc\uddf1\ud8d8\udde1.mov"}ce of music: everyone was taking part in the dance.
      • an act of dancing: they rolled back the carpet and had a dance.
      • a particular sequence of steps and movements constituting a particular form of dancing: dances include the waltz, the quickstep, and the foxtrot.
      • dance steps and movements considered as an activity or art form: she has studied dance with Martha Graham.
      • a social gathering at which people dance: she met her husband at a dance.
      • a set of lively movements resembling a dance: he gesticulated comically and did a little dance.
      • a piece of music for dancing to: the last dance had been played.
    DERIVATIVES
    dancer noun
    Adam Frost{"video":"dominance: right;\\n\ud8c1\udd45\ud8fc\udc61\ud8c8\uddfb\ud8fc\udc61\ud8fb\udfa1\ud8e4\udf07\ud8e4\udf0f\ud8e4\udf07.mov"} OO" 33 e!efrost2008/06/11 01:09:312026/08/23 20:20:03AS10041S2fe00S1000aS2fe00S21400S20500M517x522S1000a487x507S10041483x479
    adjective
    1. morally good, justified, or acceptable: I hope we're doing the right thing | [with infinitive] : you were quite right to criticize him.
    2. free from error; in accordance with fact or truth: I'm not sure I know the rig y 33 }!frost2008/06/11 01:14:302026/08/23 21:19:11AS10041S2fe00S10049S2fe00S21400S21100S2a30bS2a313M549x524S10041497x494S10049482x494S21100494x476S2a30b517x491S2a313451x491
      verb
      1. to make (a clothing, blanket, etc.) by interlocking loops of wool or other yarn with knitting needles or on a machine: she was knitting a sweater.
      noun
      1. the craft or action of knitting.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc42\ud8fc\udc61\ud8c0\udc4a\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e7\udd2c\ud8e7\udd34.mov"} 88E 33)k5!ofrost2008/06/11 01:15:382026/08/23 21:21:54AS10650S38630S2035aS2fe00S20600M521x520S10650494x494S2035a506x486S20600479x481M515x520S10650488x494S2035a500x486S20500485x481
      noun [in isolation]
      1. time.
      Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\ude91\ud8fc\ude71\ud8d8\udd7b\ud8fc\udc61\ud8d8\ude41.mov"} o 33 S!)frost2008/06/11 01:17:582026/08/23 21:27:18AS10057S2fe00S10006S26507M520x519S10057480x489S26507507x481
      verb [center to right front loci]
      1. to move to a place or position: at the fork, go right | at the stop sign, veer right.
      preposition [at right front locus]
      1. expressing location or arrival in a place or position: I work at the store.
      adverb [at right front locus]
      1. in, at, or to a place or position: put the box there.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc58\ud8fc\udc61\u00d8\ud8e1\udde8.mov"} ZZ# 33] {!frost2008/06/11 01:18:552026/08/23 21:28:57AS10120S2fe00S10006M508x515S10120492x485
      noun
      1. the fourth letter of the fingerspelling alphabet.
        • denoting the fourth in a set of items, categories, sizes, etc.
        • the fourth highest class of academic mark.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc81\ud8fc\udc61\u00d8.mov"} 7% 33 1!-frost2008/06/11 01:20:092026/08/23 21:37:40AS10601S38507S1060aS2fe00S20500S22a03S10602S21400S20500M543x530S36d00479x473S10601520x470S22a03515x494S1060a481x515S10602502x511
      proper noun
      1. the Romance language spoken in Spain and in much of Central and South America: the interpreter repeated her commands in Spanish.
        • a person who speaks Spanish.
        • a place associated with Spanish language use.
      adjective
      1. relating to the Spanish language, its speakers, or places where it is spoken.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\ude42\ud8fc\udde8\ud8c0\ude4b\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8c0\ude43\ud8d9\udf81\ud8d8\udde1.mov"} | 33] -!frost2008/06/11 01:28:012026/08/23 21:39:43AS10620S2fe00S10006M511x513S10620490x487
      noun
      1. the twenty-fourth letter of the fingerspelling alphabet.
        • denoting the next after W in a set of items, categories, sizes, etc.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\ude61\ud8fc\udc61\u00d8.mov"}{ 33) -!Afrost2008/06/11 01:26:172026/08/23 21:38:43AS10612S30005S10006S21100S2c400M563x526S2ff00482x483S10612515x511S2c400523x483
      noun
      1. a round fruit from a tree, typically with thin red or green skin and crisp flesh.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\ude53\ud8f0\udc06\u00d8\ud8d9\ude61\ud8ea\udd81.mov"} Z 33Q?!Kfrost2008/06/11 01:33:082026/08/23 21:56:54AS10e00S2fe00S10006S21d00M509x520S10e00492x490S21d00491x480M508x520S10e00493x490S21b00497x480
      number [in isolation]
      1. twelve.
      Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c1\udd41\ud8fc\udc61\u00d8\ud8da\udee1.mov"}# 33] {!frost2008/06/11 01:31:122026/08/23 21:48:55AS10e00S2fe00S10006M508x515S10e00493x485
      counting number [as independent number]
      1. equivalent to the sum of one and one; one less than three: a romantic weekend for two in Paris | two of Amy's friends.
      Adam Frost{"video":"dominance: right;\\n\ud8c1\udd41\ud8fc\udc61\u00d8.mov"} h 33u;e!ifrost2008/06/11 01:36:322026/08/24 17:17:47AS11500S2fe00S16d0aS2fe00S21000S22702S22a04M516x536S16d0a487x465S11500487x473S22702506x483S21000485x505S22a04489x521M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M521x535S10e00481x465S16d0a479x497S11500479x505S21000501x491S22a04504x508 S38800464x496
      You might be looking for both.
      Adam Frost{"video":"dominance: right;\\nvisible: sign;"} md 33 i!e frost2008/06/11 01:37:352026/08/24 17:19:53AS10e04S2fe00S15a3aS2fe00S21400S20500M514x517S15a3a487x505S10e04495x483
      verb
      1. [at center locus] to have an upright position, supported by one's feet: Lionel stood in the doorway | she stood still, heart hammering.
      2. [with modal and usually negative] informal to be able to endure or tolerate: I can't stand the way Mom talks to him.
      Adam Frost{"video":"dominance: right;\\n\ud8c1\udd45\ud8fc\udc61\ud8c8\uddfb\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1.mov"} ! 33g E!!frost2008/06/11 01:44:352026/08/24 17:58:48AS10e04S2fe00S15a3aS2fe00S21400S20500S22f00S11004M514x541S15a3a487x529S10e04493x507S22f00488x489S11004494x459
      verb [frequentative]
      1. to push oneself off a surface and into the air by using one's legs and feet: the children jumped up and down on the trampoline.
      Adam Frost{"video":"dominance: right;\\n\ud8c1\udd45\ud8fc\udc61\ud8c8\uddfb\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8dc\udda1\ud8c1\ude05.mov"}i>stooping over all day was hard work      .
      • putting a lot of energy into an activity: he'd been a hard worker all his life.
      • difficult to bear; causing suffering: times were hard at the end of the war | he'd had a hard life.
      • difficult to understand or solve: this is a really hard question | [with infinitive] : she found it hard to believe that he could be involved.
    adverb
    1. with a great deal of effort: they work hard at school.
      • with a great deal of force; violently: it was raining hard.
    2. so as to be solid or firm: the mortar has set hard.
    INFLECTED FORMS
    very hard [intensive]
    Adam Frost{"video":"dominance: right;\\n\ud8c1\ude42\ud8fc\udc61\ud8c1\ude4b\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1.mov"} 4"33+!"frost2008/06/11 02:32:552026/08/24 18:03:51AS10e04S2fe00S15a3aS2fe00S37f00S28806S2880eS28806M531x528S15a3a470x516S10e04488x483S28806508x502S2880e508x487S28806509x472M531x556S15a3a470x489S10e04488x456S28806508x475S2880e508x460S28806509x445S15a40510x511S15a48478x511S22a04510x541S22a14477x541
    verb
    1. to move rhythmically as if to music, typically following a set sequence of steps: their cheeks were pressed together as they danced | all the men wanted her to dance with them.
      • [with object] to perform (a particular dance or a role in a ballet): they danced a tango.
    noun
    1. a series of movements that match the speed and rhythm of a pie OO}$ 33 o!)$frost2008/06/11 02:41:442026/08/24 18:23:16AS10e50S2fe00S10006S26500M508x524S10e50493x494S26500493x476
      verb [center to front loci]
      1. to direct one's gaze toward someone or something: he was looking at the time.
      Adam Frost{"video":"dominance: right;\\n\ud8c1\udd91\ud8fc\udc61\u00d8\ud8e1\udde1.mov"}.# 33] !#frost2008/06/11 02:35:322026/08/24 18:06:29AS10e20S2fe00S10006M508x515S10e20493x485
      noun
      1. the twenty-second letter of the fingerspelling alphabet.
        • denoting the next after U in a set of items, categories, sizes, etc.
      identifier number
      1. equivalent to the sum of one and one; one less than three: I live in apartment 2B.
      Adam Frost{"video":"dominance: right;\\n\ud8c1\udd61\ud8fc\udc61\u00d8.mov"} % 33q!k%frost2008/06/11 02:44:012026/08/24 18:27:52AS10e50S2fe00S10006S2880aM515x523S10e50486x478S2880a493x511M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M517x526S10e50490x474S26606487x501S22f04484x512 S38800464x496
      You might be looking for twenty-two.
      Adam Frost{"video":"dominance: right;\\nvisible: false;"} q#q/' 335 e!e'frost2008/06/11 02:47:072026/08/24 18:34:04AS10e50S2fe00S15a0aS2fe00S38004S26500M514x533S15a0a487x468S10e50495x483S26500495x518
      verb [center to front loci]
      1. to direct one's gaze toward a flat surface: she looked at the tv screen.
      Adam Frost{"video":"dominance: right;\\n\ud8c1\udd91\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8fc\udc05\ud8e1\udde1.mov"}Z& 335k;!&frost2008/06/11 02:45:392026/08/24 18:31:55AS10e50S2fe00S15a0aS2fe00S38004S22f04M514x533S15a0a486x468S10e50494x483S22f04489x519M514x533S15a0a487x468S10e50495x483S22a04495x518
      verb [frequentative]
      1. to read.
      Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c1\udd91\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8fc\udc05\ud8dc\udda5.mov"} ) 33C I!M)frost2008/06/11 02:52:582026/08/25 16:22:01AS10e50S38633S2035aS2fe00S26500M524x532S37806477x474S2035a509x468S10e50493x482S26500493x517
      verb
      1. to direct one's gaze toward one's wrist or something worn on it: he looked at his watch.
      Adam Frost{"video":"dominance: right;\\n\ud8c1\udd91\ud8fc\ude74\ud8d8\udd7b\ud8fc\udc61\ud8e1\udde1.mov"}_( 33A !!}(frost2008/06/11 02:50:462026/08/24 18:42:11AS10e50S2fe00S15a3aS2fe00S21400S22a04S20500M514x527S15a3a487x515S10e50490x491S22a04490x474
      verb
      1. to fail to win (a game or contest): [no object] : they lost by one vote | the Bears lost the final game of the series.
      Adam Frost{"video":"dominance: right;\\n\ud8c1\udd91\ud8fc\udc61\ud8c8\uddfb\ud8fc\udc61\ud8d9\udf81\ud8db\udfc5\ud8d8\udde1.mov"} `R* 33 !)*frost2008/06/11 02:55:162026/08/25 16:26:22AS11020S2fe00S10006S2e302M524x514S11020477x486S2e302497x491
      verb
      1. to go to a place and return, especially for pleasure: he loves to travel around the world and experience new cultures.
      noun
      1. an act of going to a place and returning, especially for pleasure: Sally's gone on a school trip | a trip to the North Pole.
      Adam Frost{"video":"dominance: right;\\n\ud8c1\ude21\ud8fc\udc61\u00d8\ud8ed\udd23.mov"}S11559477x494S11551497x494S20800495x481M524x528S11559477x503S11551497x503S20900489x490S22f04487x473 M524x530S11559477x483S11551497x483S20800495x470S2ea20494x505 M524x519S11559477x494S11551497x494S20900489x481
      verb
      1. to be in a position in which one's weight is supported by one's buttocks rather than one's feet and one's back is upright: I sat next to him at dinner | you can sit wherever you like.
      INFLECTED FORMS
      sit [frequentative]
      sit [durative]
      DERIVATIVES
      chair noun
      Adam Frost{"video":"dominance: right;\\n\ud8c2\udc32\ud8fc\udc61\ud8c2\udc3a\ud8fc\udc61\ud8d9\udf81\ud8d8\udf01.mov"} `+ 33k!e+frost2008/06/11 02:56:542026/08/25 16:49:42AS11041S2fe00S1104aS2fe00S21400S20500M521x523S11041480x478S1104a494x508M524x523S11041483x478S1104a497x508S20b00476x502
      adjective
      1. solid, firm, and rigid; not easily broken, bent, or pierced: a hard mattress | ground frozen hard as a rock.
      2. done with a great deal of force or strength: a hard blow to the head.
      3. needing much effort or skill to accomplish, deal with, or understand: she had a difficult decision to make | the questions are too difficult for the children.
        • characterized by or causing hardships or problems: a difficult economic climate.
        • (of a person) not easy to please or satisfy: Lily could be difficult.
      4. requiring a great deal of endurance or effort: <+ 1u- 33] !-frost2008/06/11 03:03:562026/08/25 16:58:01AS11502S2fe00S10006M515x508S11502485x493
        noun
        1. the eighth letter of the fingerspelling alphabet.
          • denoting the next after G in a set of items, categories, sizes, etc.
        Adam Frost{"video":"dominance: right;\\n\ud8c1\udfe3\ud8fc\udc61\u00d8.mov"}L, 335Q[!e,frost2008/06/11 02:57:532026/08/25 16:50:48AS11041S2fe00S1104aS2fe00S21400S20b00M524x523S11041483x478S1104a497x508S20b00476x502M521x523S11041480x478S1104a494x508
        adjective, adverb [intensive]
        1. hard.
        Adam Frost{"video":"dominance: right;\\n\ud8c1\ude42\ud8fc\udc61\ud8c1\ude4b\ud8fc\udc61\ud8d9\udf81\ud8d9\udc21.mov"} `S. 33 _!e.frost2008/06/11 03:06:402026/10/10 20:33:26AS11502S2fe00S10006S20320M515x518S11502485x483S20320500x503
        noun
        1. a school that typically comprises grades 9 through 12: he will start high school next year.
        ORIGIN
        based on the spelling of H-S.
        Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c1\udfe3\ud8fc\udc61\u00d8\ud8d8\udd41.mov"} zz/ 33[ O!}/frost2008/06/11 03:10:272026/08/25 17:03:46AS11511S2fe00S15a18S2fe00S21406S20e00S23604M522x535S15a18479x465S11511487x483S20e00484x506S23604483x518
        verb
        1. to depict (someone or something) or produce (a picture) with paint: I painted a woman sitting next to a table lamp | Marr is a self-taught artist who paints portraits.
        noun
        1. a colored substance which is spread over a surface and dries to leave a thin decorative or protective coating: a can of paint | the paint has been applied to the surface with a palette knife.
          • an act of covering something with paint: it looked in need of a good paint.
        Adam Frost{"video":"dominance: right;\\n\ud8c1\udff2\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8dd\udc45.mov"} ^^.!1 33{!k1frost2008/06/12 19:16:082026/09/07 18:21:54AS11541S2fe00S10006S2880aM520x517S11541481x483S2880a498x505M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M517x525S11541483x476S26606487x500S22f04484x511 S38800464x496
        You might be looking for hard of hearing.
        Adam Frost{"video":"dominance: right;\\nvisible: false;"}{0 33] +!0frost2008/06/11 03:19:332026/08/25 17:04:47AS11520S2fe00S10006M508x515S11520493x485
        noun
        1. the twenty-first letter of the fingerspelling alphabet.
          • denoting the next after T in a set of items, categories, sizes, etc.
        Adam Frost{"video":"dominance: right;\\n\ud8c2\udc01\ud8fc\udc61\u00d8.mov"} vv2335 !e2frost2008/06/12 19:18:192026/08/25 17:15:46AS11541S2fe00S11549S2fe00S21400S20600M522x525S11541498x491S11549479x498S20600489x476S38b00470x493 M522x517S11541498x483S11549479x490 S38b04470x493
        noun
        1. a word or set of words by which something is known, or referred to: my name is John Parsons.
        PHONOLOGICAL VARIANTS
        name with single movement
        Adam Frost{"video":"dominance: right;\\n\ud8c2\udc22\ud8fc\udc61\ud8c2\udc2a\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} 44I3 33[ /!)3frost2008/06/12 19:20:542026/10/10 20:33:11AS11551S2fe00S15a39S2fe00S21400S20e00S28800M522x531S15a39489x508S11551478x497S20e00500x493S28800510x470
        noun
        1. an educational institution designed for instruction and examination of students in many branches of advanced learning, conferring degrees in various faculties, and often embodying colleges and similar institutions: [in names] : Oxford University | the University of California | [as modifier] : the university buildings | a university professor.
        ORIGIN
        based on college with a U handshape.
        Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udc32\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e4\udf01.mov"}en in the national interest         | a national newspaper.
        • owned, controlled, or financially supported by an institution or system representing such a group: plans for a national art library.
      noun
      1. the state of being as expected or inherent: her temperature was above normal | the breathtaking beauty of nature.
      2. a group of people with a shared origin or identity: the world's leading industrialized nations | he addressed the nation.
      adverb
      1. in a way that expected or inherent: try to breathe normally | of course, I want to see you.
      2. in relations to a group of people with a shared origin or identity: a nationally recognized brand.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udc32\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf81\ud8ed\uded7\ud8d8\udde1.mov"} q5 335k !e5frost2008/06/12 19:34:362026/08/26 16:42:26AS11551S2fe00S11559S2fe00S21400S20900M524x519S11559477x494S11551497x494S20900489x481M524x519S11559477x494S11551497x494S20800495x481
      noun
      1. a piece of furniture used for sitting one person, typically with a back and four legs.
      2. the person in charge of a meeting or of an organization: a three-year term as the board’s deputy chair.
      3. a particular seat in an orchestra: [as modifier, in combination] : she was fourth-chair trumpet.
      Adam Frost{"video":"dominance: right;\\n\ud8c2\udc32\ud8fc\udc61\ud8c2\udc3a\ud8fc\udc61\ud8d9\udf81\ud8d8\udf61.mov"}&4335_!e4frost2008/06/12 19:31:172026/08/26 16:40:56AS11551S2fe00S11559S2fe00S21400S20800M524x5192 7 33A U!)7frost2008/06/12 19:56:342026/08/26 17:40:06AS11551S2fe00S2035aS2fe00S21400S2e736S20500M520x523S2035a480x502S11551493x498S2e736483x478
      adjective
      1. in accordance with what is expected or inherent: it's quite normal for puppies to bolt their food.
      2. relating to a group of people with a shared origin or identity: this policy may have be:y6 33] '!6frost2008/06/12 19:37:272026/08/26 17:20:24AS11920S2fe00S10006M511x513S11920490x487
        noun
        1. the fourteenth letter of the fingerspelling alphabet.
          • denoting the next after M in a set of items, categories, sizes, etc.
        Adam Frost{"video":"dominance: right;\\n\ud8c2\udd81\ud8fc\udc61\u00d8.mov"} be in a natural state where one's body and mind rest, not awake or aware: she slept for half an hour.
        • to be inactive or dormant: Copenhagen likes to be known as the city that never sleeps.
        • to be in a state resembling sleep: they took their pit bull terrier on a trip to France before having her put to sleep.
      adjective
      1. in a state of sleep: she had been asleep for over three hours | a man lay asleep | he soon fell asleep.
        • not attentive or alert; inactive: the competition was not asleep.
      2. (of a limb) having no feeling; numb: his legs were asleep.
      noun
      1. the state of sleeping: he needs more sleep.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udc81\ud8ef\udfa1\u00d8\ud8db\udfc5\ud8cc\udde8.mov"} y8 33] '!8frost2008/06/12 20:44:592026/08/26 17:42:45AS11a20S2fe00S10006M508x515S11a20493x485
      noun
      1. the eighteenth letter of the fingerspelling alphabet.
        • denoting the next after Q in a set of items, categories, sizes, etc.
      Adam Frost{"video":"dominance: right;\\n\ud8c2\udde1\ud8fc\udc61\u00d8.mov"} ))T9 33O !e9frost2008/06/12 20:49:102026/08/26 17:44:14AS14c10S2fe00S15a1aS38615S20500S2e108M527x533S37800493x499S15a1a474x521S14c10482x468S2e108504x484
      noun
      1. a woody perennial plant, typically having a single stem or trunk growing to a considerable height and bearing lateral branches at some distance from the ground: he points out an eagle perched in a tree.
      2. a thing that has a branching structure resembling that of a tree: our inward trees of nerves and blood vessels.
        • a diagram with a structure of branching connecting lines, representing different processes and relationships: these organisms mostly occupy spaces at the base of evolutionary trees | make a tree diagram of all possible positions that can develop from the starting position.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udc91\ud8fc\udc61\ud8c8\udddb\ud8fc\ude56\ud8d8\udde1\ud8ed\udc69.mov"} SS*: 33] !:frost2008/06/12 20:51:122026/08/26 17:46:15AS11e00S2fe00S10006M512x515S11e00489x485
      counting number
      1. [as independent number] equivalent to the sum of one and two; one more than two: her three children | a crew of three | a three-bedroom house.
      Adam Frost{"video":"dominance: right;\\n\ud8c2\udf41\ud8fc\udc61\u00d8.mov"} yy; 33[ Q!};frost2008/06/12 21:00:472026/08/26 17:48:07AS11e50S2fe00S11e58S2fe00S38006S27100S27114M541x525S11e50505x476S11e58471x476S27100501x510S27114459x510
      verb
      1. to walk for a long distance, especially across country or in the woods: we planned to hike another mile up a steep trail.
      noun
      1. a long walk, especially in the country or wilderness: a five-mile hike across rough terrain.
      Adam Frost{"video":"dominance: right;\\n\ud8c2\udf91\ud8fc\udc61\ud8c2\udf99\ud8fc\udc61\ud8fc\udc07\ud8e2\ude61\ud8e2\ude75.mov"} ]P< 33QQ!) number
      1. equivalent to the sum of eleven and twelve; three more than twenty: they found twenty-three errors in the report.
    SIGN VARIATIONS
    twenty-three starting with an L-hand
    Adam Frost{"video":"dominance: right;\\n\ud8c3\udda1\ud8fc\udc61\u00d8\ud8db\udc75.mov"} "> 33QK!K>frost2008/06/12 21:17:232026/08/26 23:43:36AS13f20S2fe00S10006S22114M516x513S13f20487x498S22114484x487M515x513S13f20486x498S22104487x488
    exclamation [in isolation]
    1. no.
    Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c5\udfc1\ud8fc\udc61\u00d8\ud8db\udc75.mov"}[= 33 +!)=frost2008/06/12 21:16:172026/08/26 23:40:40AS12d00S2fe00S10006S22114M513x519S12d00489x489S22114487x481
    number
    1. equivalent to the sum of six and seven; one more than twelve, or seven less than twenty: thirteen miles away | a rise of 13 percent | thirteen of the bishops voted against the motion.
    Adam Frost{"video":"dominance: right;\\n\ud8c4\udce1\ud8fc\udc61\u00d8\ud8db\udc75.mov"} &&W?33C!?frost2008/06/12 21:18:352026/10/10 20:32:57AS14007S30004S10006S20e00S22f04M521x545S2ff00482x483S14007497x512S20e00481x517S22f04474x531M521x548S2ff00482x483S14007497x512S20e00484x519S22a04483x533
    adjective, noun [in isolation]
    1. the color pink.
    ORIGIN
    based on red with a P handshape.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\nvisible: sign;\\n\ud8c6\udc08\ud8f0\udc05\u00d8\ud8d9\udd41\ud8dc\udda5.mov"} dA 33) !AAfrost2008/06/12 21:24:132026/08/26 23:55:25AS14037S2fe00S10006S20e00S22914M515x530S14037491x499S20e00490x484S22914486x471
    noun
    1. a domesticated carnivorous mammal that typically has a long snout, an acute sense of smell, nonretractable claws, and a barking, howling, or whining voice: The dog chased the cat.
    Adam Frost{"video":"dominance: right;\\n\ud8c6\udc38\ud8fc\udc61\u00d8\ud8d9\udd41\ud8db\udf75.mov"}w@ 33] #!@frost2008/06/12 21:21:372026/08/26 23:54:30AS14020S2fe00S10006M515x515S14020486x485
    noun
    1. the eleventh letter of the fingerspelling alphabet.
      • denoting the next after J in a set of items, categories, sizes, etc.
    Adam Frost{"video":"dominance: right;\\n\ud8c6\udc21\ud8fc\udc61\u00d8.mov"} E4B 33u !}Bfrost2008/06/12 21:25:462026/08/27 00:49:05AS14c03S38517S14c0bS38511S20e00S2c601S2c610M543x519S14c03505x483S14c0b468x483S20e00494x481S2c601524x493S2c610457x493
    noun
    1. a one-piece garment that covers the body and extends down over the thighs or legs, worn especially by women and girls: a white cotton dress | [as modifier] : a dress designer.
    verb
    1. [with object] to have on (a garment covering the torso): he was wearing a dark suit.
      • to habitually wear: although she was a widow, she didn't wear black.
    Adam Frost{"video":"dominance: equal;\\n\ud8c7\udc84\ud8fc\uddf8\ud8c7\udc8c\ud8fc\uddf2\ud8d9\udd41\ud8ea\ude42\ud8ea\ude51.mov"} nnC 33] S!Cfrost2008/06/12 21:31:432026/08/27 00:50:13AS14051S2fe00S10006M516x512S14051485x488
    noun
    1. the sixteenth letter of the fingerspelling alphabet.
      • denoting the next after O (or N if O is omitted) in a set of items, categories, sizes, etc.
    Adam Frost{"video":"dominance: right;\\n\ud8c6\udc52\ud8fc\udc61\u00d8.mov"} tD 33cK!eDfrost2008/06/12 21:44:162026/10/10 20:32:39AS14051S2fe00S10006S14720M516x525S14051485x475S14720499x503M516x512S14051485x488 M507x511S14720493x489
    noun
    1. a paste of ground roasted peanuts, usually eaten spread on bread.
    proper noun
    1. the neighborhood in western San Diego, California, bounded by La Jolla to the north, Mission Beach and Mission Bay to the south, Interstate 5 and Clairemont to the east and the Pacific Ocean to the west.
    ORIGIN
    based on the spelling of P-B.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c6\udc52\ud8fc\udc61\u00d8\ud8c6\udec1.mov"} eWE 33Q3!UEfrost2008/06/12 21:52:472026/08/27 00:58:03AS14051S2fe00S10006S2a40cM517x532S14051484x468S2a40c492x496M517x528S14051484x473S2a204494x500
    noun
    1. a color intermediate between red and blue: the painting was mostly in shades of blue and purple.
    adjective [in isolation]
    1. of the color purple.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc52\ud8fc\udc61\u00d8\ud8e7\udd8d.mov"} FF7F 33] #!Ffrost2008/06/12 22:06:352026/08/27 01:03:38AS14400S2fe00S10006M511x516S14400489x485
    counting number [as independent number]
    1. equivalent to the product of two and two; one more than three, or six less than ten: Francesca's got four brothers | a four-bedroom house.
    Adam Frost{"video":"dominance: right;\\n\ud8c6\udd81\ud8fc\udc61\u00d8.mov"} {{G 33 _!)Gfrost2008/06/12 22:17:142026/08/27 18:10:43AS14410S30004S10006S20600M537x541S2ff00482x483S14410491x510S20600515x511
    verb
    1. to communicate by spoken words: he can talk as well as you or I can.
      • to discuss personal or intimate feelings: we need to talk, Maggie.
    2. to say something in order to convey information, an opinion, or a feeling: in his agitation he was unable to speak | she refused to speak about the incident.
      • [with object] to utter (a word, message, speech, etc.): patients copy words spoken by the therapist.
      • [with object] to communicate in or be able to communicate in (a specified spoken language): my mother spoke Russian.
    Adam Frost{"video":"dominance: right;\\n\ud8c6\udd91\ud8f0\udc05\u00d8\ud8d8\ude41.mov"} -I33Cq!Ifrost2008/06/12 22:21:412026/09/13 22:13:33AS14720S30005S10006S20e00S22f04M527x555S2ff00482x483S14720507x503S20e00508x527S22f04502x541M521x558S2ff00482x483S14720507x503S21100508x527S22a04508x543
    adjective, noun [in isolation]
    1. the color brown.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\nvisible: sign;\\n\ud8c6\udec1\ud8f0\udc06\u00d8\ud8d9\udd41\ud8dc\udda5.mov"}PH 33 !)Hfrost2008/06/12 22:19:312026/08/27 18:11:53AS14700S2fe00S10006S22114M513x515S14700493x493S22114487x486
    number
    1. equivalent to the product of seven and two; one more than thirteen, or six less than twenty: they had spent fourteen days in solitary confinement | all fourteen of us were seated.
    Adam Frost{"video":"dominance: right;\\n\ud8c6\udea1\ud8fc\udc61\u00d8\ud8db\udc75.mov"} >>?J 33Q!UJfrost2008/06/12 22:24:042026/08/27 22:37:27AS14710S2fe00S10006S2e100M512x527S14710493x505S2e100489x474M511x523S14710492x501S2df08490x478
    noun
    1. the color or pigment intermediate between green and violet, as of the sky or sea on a sunny day: she was dressed in blue | the dark blue of his eyes | armchairs in pastel blues and greens.
    adjective [in isolation]
    1. of the color blue.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udeb1\ud8fc\udc61\u00d8\ud8ed\udc61.mov"} !!\K 33] m!Kfrost2008/06/12 22:33:052026/08/27 22:41:26AS14720S2fe00S10006M507x511S14720493x489
    noun
    1. the second letter of the fingerspelling alphabet.
      • the second highest class of academic mark: I got a B on my first paper.
      • he human blood type (in the ABO system) containing the B antigen and lacking the A.
    Adam Frost{"video":"dominance: right;\\n\ud8c6\udec1\ud8fc\udc61\u00d8.mov"} }sL 33 /!ULfrost2008/06/12 22:37:552026/09/30 17:28:44AS14720S2fe00S10006S22f04M513x521S14720494x480S22f04488x507
    proper noun
    1. (also Boston, Massachusetts) a city in eastern Massachusetts, the capital of the state, on Massachusetts Bay.
    2. (also Brooklyn, New York) a borough of New York City, at the southwestern corner of Long Island.
    3. (also Berkeley, California) a city in western California, on San Francisco Bay.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udec1\ud8fc\udc61\u00d8\ud8dc\udda5.mov"} ;N 33] +!Nfrost2008/06/29 04:23:162026/08/27 22:45:58AS14c00S2fe00S10006M512x516S14c00489x485
    counting number [as independent number]
    1. equivalent to the sum of two and three; one more than four, or half of ten: five of Sweden's top financial experts | a circlet of five petals.
    Adam Frost{"video":"dominance: right;\\n\ud8c7\udc81\ud8fc\udc61\u00d8.mov"}mM 33] !Mfrost2008/06/12 22:48:192026/08/27 22:44:33AS14a20S2fe00S10006M508x508S14a20493x493
    noun
    1. the fifth letter of the fingerspelling alphabet.
      • denoting the fifth in a set of items, categories, sizes, etc.
    Adam Frost{"video":"dominance: right;\\n\ud8c6\udfe1\ud8fc\udc61\u00d8.mov"} xxO 33) A!AOfrost2008/06/29 04:29:172026/08/27 22:47:37AS14c00S30004S10006S20500S22510M534x544S2ff00482x483S14c00488x513S22510512x513
    noun
    1. the property possessed by an object of producing different sensations on the eye as a result of the way the object reflects or emits light: the lights flickered and changed color.
      • one, or any mixture, of the constituents into which light can be separated in a spectrum or rainbow, sometimes including (loosely) black and white: a rich brown color | a range of bright colors.
      • the use of all colors, not only black, white, and gray, in photography or television: he has shot the whole film in color | [as modifier] : color television.
    Adam Frost{"video":"dominance: right;\\n\ud8c7\udc81\ud8f0\udc05\u00d8\ud8d8\udde1\ud8db\uddf1.mov"}i and Fifth Avenue     | [no object] : art students copied from approved old masters | she was such fun that everybody wanted to copy her.
    noun
    1. a thing made to be similar or identical to another: the problem is telling which is the original document and which the copy.
    2. a single specimen of a particular book, record, or other publication or issue: the record has sold more than a million copies.
    INFLECTED FORMS
    copy [center to front loci]
    copy [front to center loci]
    copy [center to bottom loci]
    Adam Frost{"video":"dominance: right;\\n\ud8c7\udc92\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\udde7\ud8cc\uddf1.mov"} ::;P 33C !APfrost2008/06/29 04:30:322026/08/27 23:30:07AS14c00S2ff00S10006S22a04S18507M518x571S2ff00482x483S14c00488x499S22a04494x532S18507489x544
    verb
    1. to= Q33gy9!Qfrost2008/06/29 04:31:582026/08/29 17:39:51AS14c11S2fe00S15a18S2fe00S21406S20500S26506S18510M541x514S15a18460x487S14c11467x486S26506497x499S18510516x499M517x536S14c01491x502S15a28484x509S26500495x484S18501489x465 M516x543S15a08484x458S14c21487x470S26504500x499S18527497x516 M517x539S15a1a483x462S14c31485x474S22a04498x504S1853d490x520
      verb [with object]
      1. to make a similar or identical version of: each form had to be copied and sent to a different department.
        • Computing to reproduce (data stored in one location) in another location: the command will copy a file from one disc to another.
      2. to imitate the style or behavior of: lifestyles that were copied from MiamR 11LR 33 #!Rfrost2008/06/29 04:32:592026/08/29 17:42:16AS14c02S2fe00S14c0aS2fe00S21406S21000S27100S27114M542x530S14c02499x503S14c0a471x507S21000490x488S27100502x470S27114458x470
        adjective
        1. of the color or pigment intermediate between black and white, as of ashes or lead: gray flannel trousers | his hair was gray and wispy.
        noun
        1. the color intermediate between black and white, as of ashes or lead: dirty intermediate tones of gray.
        Adam Frost{"video":"dominance: right;\\n\ud8c7\udc83\ud8fc\udc61\ud8c7\udc8b\ud8fc\udc61\ud8d9\udf87\ud8d9\ude01\ud8e2\ude61\ud8e2\ude75.mov"} ..OS33O!YSfrost2008/06/29 04:34:462026/08/29 17:54:31AS14c02S38510S10006S20500S26500S18501M517x535S14c02484x503S20500502x524S26500498x485S18501490x466M518x535S14c02483x503S20500501x524S26a00491x486S18501489x466
        adjective
        1. of the color of milk or fresh snow, due to the reflection of most wavelengths of visible light; the opposite of black: a sheet of white paper.
        noun
        1. the color or pigment of milk or fresh snow, due to the reflection of most wavelengths of visible light; the opposite of black: garnet-red flowers flecked with white | the woodwork was an immaculate white.
        INFLECTED FORMS
        white [in isolation]
        Adam Frost{"video":"dominance: right;\\n\ud8c7\udc83\ud8fc\uddf1\u00d8\ud8d8\udde1\ud8e1\udde1\ud8cc\udde2.mov"}se]         : they explained that their lives centered on the religious rituals | [with object] : he explained the situation.
      3. to give an account in words of (someone or something), including all the relevant characteristics, qualities, or events: [with object] : she described the man as tall, clean-shaven, and with short dark hair.
      4. to account for (an action or event) by giving a reason as excuse or justification: [with object] : Callie found it necessary to explain her blackened eye | [with clause] : he makes athletes explain why they made a mistake.
      5. [with object] to be the cause of or motivating factor for: her father's violence explains her pacifism | [with clause] : this would explain why so many adult children still live with their parents.
      Adam Frost{"video":"dominance: right;\\n\ud8d3\udd81\ud8fc\udc61\ud8d3\udd89\ud8fc\udc61\ud8fc\udc07\ud8e2\ude61\ud8e2\ude75.mov"} HT 33O!e!iTfrost2008/06/29 04:36:492026/08/29 17:57:32AS1bb02S38510S10006S20500S26500S21600M518x525S1bb02490x494S20500506x514S26500501x475S21600482x498M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M516x537S1bb02488x464S14c02485x506S26500499x488S20500503x526 S38800464x496
      You might be looking for like.
      Adam Frost{"video":"dominance: right;\\nvisible: sign;"} :2U 33A !-Ufrost2008/06/29 04:37:542026/08/29 17:59:14AS14c03S38517S14c0bS38511S20e00S2c601S2c610S2c601S2c610M557x519S14c03505x483S14c0b468x483S20e00494x481S2c601524x493S2c601538x493S2c610457x493S2c610443x493
      noun
      1. items worn to cover the body: he stripped off his clothes | baby clothes | [as modifier] : a clothes shop.
      Adam Frost{"video":"dominance: equal;\\n\ud8c7\udc84\ud8fc\uddf8\ud8c7\udc8c\ud8fc\uddf2\ud8d9\udd41\ud8ea\ude42\ud8ea\ude51\ud8ea\ude42\ud8ea\ude51.mov"} PIV 33 '!}Vfrost2008/06/29 04:41:172026/08/29 18:00:22AS14c03S38547S14c0bS38541S20e00S2c601S2c610M543x537S36d10479x464S14c03505x501S14c0b468x501S20e00494x499S2c601524x511S2c610457x511
      noun
      1. a garment that fastens around the waist and hangs down around the legs, worn especially by women and girls: I was wearing a knit sweater with a long skirt | a denim skirt can be a great option.
      Adam Frost{"video":"dominance: equal;\\n\ud8c7\udc84\ud8fc\ude28\ud8c7\udc8c\ud8fc\ude22\ud8d9\udd41\ud8ea\ude42\ud8ea\ude51.mov"} bXW 33 %!)Wfrost2008/06/29 04:50:582026/08/29 18:02:59AS14c10S38510S10006S20600M524x516S14c10477x485S20600502x496
      adjective
      1. reasonably good; satisfactory: relations in the group were fine.
      2. used to express one's agreement with or acquiescence to something: anything you want is fine by me, Linda | he said such a solution would be fine.
      3. in good health and feeling well: "I'm fine, just fine. And you?".
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udc91\ud8fc\uddf1\u00d8\ud8d8\ude41.mov"} [NX 33Ak!!}Xfrost2008/06/29 04:52:112026/09/04 20:52:42AS14c20S2fe00S15a5aS2fe00S21414S20500S2a400M526x530S15a5a476x518S14c20475x492S2a400501x471M515x529S15a18486x491S10e20498x472S2e700500x504
      noun
      1. a visual work that shows a story or event unfolding over time: cartoon films and sci-fi movies | the movie is getting glowing reviews.
        • a video.
        • movies considered collectively or as an art or medium: a lifelong love of the movies | a critical overview of feminist writing on film.
        • a movie theater: we decided to go to the movies.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udca1\ud8fc\udc61\ud8c8\ude1b\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1\ud8e7\udd81.mov"}/li>
    2. [with modifier] a man associated with a particular place, activity, or occupation: a Harvard man | I'm a solid union man.
    3. a person with qualities traditionally associated with men, such as bravery, spirit, or toughness: I'm more of a man than you'll ever be.
    4. a man pursued or sought by another, especially in connection with a crime: Inspector Bull was sure they would find their man.
    5. [in singular] an individual man; one: a man could buy a lot with eighteen million dollars.
    6. (the Man) informal, mainly US English a group or person in a position of authority over others, such as a corporate employer or the police: it was a vicarious way of powerless people being able to stick it to the Man.
      • especially in African American use white people collectively regarded as the controlling group in society: he urged that Black college athletes boycott the Man's Rose Bowl.
        • iVY 33[ u!}Yfrost2008/06/29 04:53:562026/08/29 19:13:12AS1ce40S2fe00S1ce48S2fe00S38006S27100S27114M542x525S1ce40509x495S1ce48470x495S27100502x476S27114459x475
        verb
        1. to make (an idea, situation, or problem) clear to someone by making an account in more detail or revealing relevant facts or ideas: [with clauWa woman or girl: both males and females accumulate economic knowledge at a similar rate.
        2. an animal or plant typically associated with the ability to produce eggs or bear offspring: females may lay several hundred eggs in two to four weeks.
        adjective
        1. of or denoting the sex that can bear offspring or produce eggs, distinguished biologically by the production of gametes (ova) that can be fertilized by male gametes: a herd of female deer | twenty-two of the participants in the study were female.
          • relating to women or the female gender: a female name.
          • (of a plant or flower) having a pistil but no stamens.
          • (of parts of machinery, fittings, etc.) manufactured hollow so that a corresponding male part can be inserted.
        Adam Frost{"video":"dominance: right;\\n\ud8c7\udca8\ud8f0\udc05\u00d8\ud8d8\udde1\ud8db\udfc5\ud8c7\udc91\ud8fc\uddf1\ud8d8\udde1.mov"}_ith the ability to bear children: a drawing of a young woman | a jury of seven women and five men | she stormed into the women's final undefeated.
        • a woman who is a member of a workforce, team, etc.: thousands of women were laid off | CNN's woman in Baghdad | our team is two women down tonight.
        • [with modifier] a woman associated with a particular place, activity, or occupation: a Princeton woman was recently named the Young Lawyer of the Year.
        • [in singular] adult women in general: woman is intuitive.
        • a person's wife, girlfriend, or lover: he wondered whether Billy had his woman with him.
        • a person with the qualities traditionally associated with women: I feel more of a woman by empowering myself to do what is right for me.
        • [in singular] an individual woman; one: with that money, a woman could buy a house and put two kids through college.
      • dZ 33 _! Zfrost2008/06/29 04:55:082026/10/09 03:17:58AS14c20S30007S10006S20500S22a03S14c10S38510S20500M538x550S2ff00482x483S14c20515x472S22a03514x512S14c10480x519S20500505x531
        noun
        1. an adult human being typically associated with the ability to impregnate: a tall man with a beard entered the restaurant | twenty-six men and women participated in the study | the men's semi-finals.
          • a man who is a member of a workforce, team, etc.: over 700 men were laid off | CNN's man in India | Johnson took the ball past three men and scored.
          • (men) ordinary members of the armed forces as distinct from the officers: he had a platoon of forty men to prepare for battle.
          • a person's husband, boyfriend, or lover: the two of them lived for a time as man and wife.<] ++R[33 !)[frost2008/06/29 05:03:112026/08/29 21:22:23AS14c20S2fe00S10006S27106M520x520S14c20480x484S27106505x480S38b00470x493 M517x518S15a20484x491S2880a495x482 S38b04470x493
            exclamation informal
            1. used as a friendly greeting or salutation: "Hi there. How was the flight?".
            2. used when parting or ending a conversation: Okay, James. I'll call her now. Bye | Bye for now, Janie!.
            PHONOLOGICAL VARIANTS
            hi with flat hand
            Adam Frost{"video":"dominance: right;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8e2\ude67.mov"}er of: I made some money running errands | here are some of our suggestions.
          • at least a small amount or number of: he liked some music but generally wasn't musical | I can give you some of my pie if you'd like.
        pronoun
        1. an unspecified number or amount of people or things: some didn't want to participate | if you want whiskey I'll give you some.
        2. at least a small amount or number of people or things: surely some have noticed.
        adverb
        1. informal to some extent; somewhat: when you get to the majors, the rules change some.
        2. to some extent; partly (often used to contrast different parts of something): the city is now part slum, part consumer paradise.
        Adam Frost{"video":"dominance: right;\\n\ud8c8\ude02\ud8fc\udc61\ud8c8\uddfb\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e1\udde6.mov"}bric sewn inside a garment and bearing the brand name, size, or instructions for care: a garment with the label "Laura Ashley".
      • the piece of paper in the center of a record giving the artist and title.
      • a company that produces recorded music: independent labels.
      • the name or trademark of a company: she plans to launch her own designer clothes label | the Michael Jordan brand certainly hasn't hurt them.
    7. a classifying phrase or name applied to a person or thing, especially one that is inaccurate or restrictive: my reluctance to stick a label on myself politically.
      • (in a dictionary entry) a word or words used to specify the subject area, register, or geographical origin of the word being defined: the italic part-of-speech label follows the pronunciation.
    Adam Frost{"video":"dominance: right;\\n\ud8c1\udfe3\ud8fc\udc61\ud8c8\udde9\ud8fc\udc61\ud8d9\udf91\ud8d9\udd41\ud8e1\udde7.mov"} (\ 33 ! \frost2008/06/29 05:04:392026/10/09 01:39:41AS14c27S30004S10006S20500S22a04S14c10S38510S20500M530x583S2ff00482x483S14c27504x508S22a04495x534S14c10486x552S20500512x563
    noun
    1. an adult human being typically associated w`6x531S15a38484x498S1ce50493x501S20e00496x486S26a00489x470
      verb [with object]
      1. to determine the total number of (a collection of items): I started to count the stars I could see.
        • [no object] to recite numbers in ascending order, usually starting at the number one: hold the position while counting.
      noun
      1. the action or process of keeping financial accounts: an investigation into suspected false accounting | [as modifier] : standard accounting practice.
      2. the number of points, goals, runs, etc. achieved in a game or by a team or an individual: the final score was 25–16 in favor of Washington.
      Adam Frost{"video":"dominance: right;\\n\ud8d3\udd91\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc1.mov"} Z9] 33[ ;!}]frost2021/03/15 03:41:492026/08/30 01:52:49AS11502S2fe00S15a28S2fe00S21410S20e00S26506M536x514S11502472x499S15a28465x487S20e00507x501S26506521x500
      verb
      1. to attach a small piece of paper or similar material to (something): she labeled the parcels neatly, writing the addresses in capital letters.
      2. to assign to a category, especially inaccurately or restrictively: [with object and complement] : the critics labeled him a loser | children were labeled as bullies.
      noun
      1. a small piece of paper, fabric, plastic, or similar material attached to an object and giving information about it: the alcohol content is clearly stated on the label | price labels.
        • a piece of fad l^ 33;_!k^frost2008/06/29 05:13:112026/08/30 01:54:48AS20340S2fe00S20348S2fe00S21400S20e00S2880fS21600M527x521S20348504x506S20340512x490S20e00497x491S2880f474x480S21600515x479M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M528x529S20348484x514S14c40504x485S2880f485x490S20e00473x500S20340484x471 S38800464x496
          You might be looking for win.
          Adam Frost{"video":"dominance: right;\\nvisibile: sign;"} __ 33C [!A_frost2008/06/29 05:14:022026/09/13 22:13:53AS14c41S38404S10006S20e00S26500M533x537S2ff00482x483S14c41477x510S20e00520x519S26500519x501
          verb
          1. to strongly dislike or feel intense aversion to something or someone: of all birds the carrion crow is the most detested by gamekeepers | he hates flying.
          Adam Frost{"video":"dominance: right;\\n\ud8c7\udcc2\ud8fc\udd85\u00d8\ud8d9\udd41\ud8e1\udde1.mov"} MM0` 33[ )!}`frost2008/06/29 05:15:122026/08/30 02:00:49AS14c47S2fe00S14c4fS2fe00S38006S23004S23014M534x525S14c47507x476S14c4f467x476S23004505x507S23014472x507
          verb
          1. to converse in an informal or casual manner: she chatted with her mother on the phone every day | the two men talked.
            • to exchange messages online in real time with one or more simultaneous users of a computer network: I keep getting messages popping up on my screen from people wanting to chat.
          Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcc8\ud8fc\udc61\ud8c7\udcd0\ud8fc\udc61\ud8fc\udc07\ud8dc\ude05\ud8dc\ude15.mov"} uua 33[ Y!}afrost2008/06/29 05:16:002026/08/30 02:03:40AS14c50S2fe00S14c58S2fe00S38006S22510S22510M532x524S14c50508x493S14c58469x493S22510509x477S22510470x477
          verb
          1. to write (something) by pressing the keys: he typed out the second draft | [no object] : I am learning how to type.
          noun
          1. a machine with keys for producing alphabetical characters, numerals, and typographical symbols.
          Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcd1\ud8fc\udc61\ud8c7\udcd9\ud8fc\udc61\ud8fc\udc07\ud8db\uddf1\ud8db\uddf1.mov"} H4b 33) !Abfrost2008/06/29 05:16:592026/08/30 03:30:06AS14c50S2fe00S10006S22510S26506M520x524S14c50480x493S22510481x477S26506505x506
          verb
          1. to name or write the letters that form (a word) in correct sequence: Dolly fingerspelled her name | he can't spell Massachusetts | [no object] : journals have a house style about how to spell.
            • (of letters) to make up or form (a word): the letters spell the word 'how'.
          noun
          1. the system of fingerspelling.
            • the action or process of using this system: her fingerspelling was very clear.
          Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd1\ud8fc\udc61\u00d8\ud8db\uddf1\ud8e1\udde7.mov"} j\c 33 -!)cfrost2008/06/29 05:18:422026/08/30 03:33:21AS14c50S2fe00S10006S2a408M526x518S14c50474x484S2a408501x482
          adjective
          1. neither very good nor very bad: a happy ending to a so-so season | "How are you?" "So-so.".
          adverb
          1. to a moderate extent or by a moderate amount: matters have improved somewhat since then | [as submodifier] : a somewhat thicker book.
          Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd1\ud8fc\udc61\u00d8\ud8e7\udd89.mov"} ::Cd 33g +!dfrost2008/06/29 05:22:182026/08/30 03:35:53AS14c51S2fe00S15a37S2fe00S21400S20500S22a00S18551M525x529S15a37476x495S14c51483x503S22a00504x493S18551498x471
          verb
          1. to gain or acquire knowledge of or skill in (something) by study, experience, or being taught: they'd started learning French | [with infinitive] : she is learning to play the piano | [no object] : we learn from experience.
            • to commit to memory: I'd learned too many grim poems in school.
            • to become aware of (something) by information or from observation: [with clause] : I learned that they had eaten already | [no object] : the military learned of a plot to attack the presidential compound.
          Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd2\ud8fc\udc61\ud8c8\uddf8\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8db\udfc1\ud8cc\ude32.mov"} d\e33 !Oefrost2008/06/29 05:23:082026/08/30 23:45:17AS14c51S2fe00S15a37S2fe00S21400S20500S23f04S18551S15a40M530x539S15a37471x482S14c51478x490S23f04503x481S18551503x462S15a40512x512M531x531S15a37470x473S18550478x487S23f04504x469S14c50507x500
          noun
          1. a phonological variant (5-hand to flat-O to flat hand) of student.
          Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udcd2\ud8fc\udc61\ud8c8\uddf8\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8dd\udfa5\ud8cc\ude32\ud8c8\ude01.mov"}  { wg 33[ Q!}gfrost2021/03/03 17:30:232026/08/30 23:54:23AS1ce50S2fe00S15a38S2fe00S21400S20e00S26a00M51ff 33) ;!Affrost2008/06/29 05:30:362026/08/30 23:46:57AS14e00S30005S10006S20500S28108M542x536S2ff00482x483S14e00502x505S28108522x485
          adjective
          1. having a high degree of heat or a high temperature: it was hot inside the hall.
            • feeling or producing an uncomfortable sensation of heat: she felt hot and her throat was parched.
            • (of food or drink) prepared by heating and served without cooling: this soup is equally good hot or cold.
          Adam Frost{"video":"dominance: right;\\n\ud8c7\udd41\ud8f0\udc06\u00d8\ud8d8\udde1\ud8e4\udc69.mov"}
          1. used to express assent, agreement, or acceptance: OK, I'll pass on your message | OK, OK, I give in.
            • used to introduce an utterance: “OK, let's go.”.
            • used at the end of a statement to invite agreement, approval, or confirmation: humor me, OK?.
      adjective [predicative]
      1. satisfactory but not exceptionally or especially good: the flight was OK.
        • (of a person) in a satisfactory physical or mental state: are you OK, Ben?.
        • permissible; allowable: I'm not sure if it's OK to say that to a teacher.
      ORIGIN
      based on the spelling of O-K.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cb\udc61\ud8fc\udc61\u00d8\ud8c6\udc21.mov"}  i 335 W!ifrost2008/06/29 05:34:232026/08/30 23:57:31AS15410S30005S15418S30003S21100S21100S2880dS28815M531x560S2ff00482x483S15410516x497S15418469x497S21100516x524S21100470x524S2880d506x540S28815473x540
      noun
      1. facial hair on the lower part of the face: he had a black beard | three days' growth of beard.
      Adam Frost{"video":"dominance: equal;\\n\ud8c7\udf91\ud8f0\udc06\ud8c7\udf99\ud8f0\udc04\ud8d9\ude61\ud8d9\ude61\ud8e4\udf0e\ud8e4\udf16.mov"}ch 33 ;!)hfrost2008/06/29 05:33:262026/08/30 23:55:54AS1543dS2fe00S10006S26a00M514x521S1543d490x498S26a00487x480
      noun
      1. a game in which ten wooden or plastic pins are set up at the end of a track (typically one of several in a large, automated alley) and bowled down with hard rubber or plastic balls: she watches bowling on tv.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udfbe\ud8fc\udc61\u00d8\ud8e1\udfc1.mov"} vj 33A O!}jfrost2008/06/29 05:35:092026/08/31 00:01:50AS15a02S2fe00S15a0aS2fe00S21400S20500S22a00M516x522S15a02489x496S15a0a485x510S22a00498x478
      verb
      1. to open a gap in a vertical, flat surface by moving part of it upward: the hidden panel in the stone wall opened upward, revealing a narrow passage behind it | she opened the window by sliding it upward.
      adjective
      1. in a vertical, upright position, standing freely (of a flat surface): the panel was upright in the center of the room.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8db\udfc1.mov"} }}k 33A c!}kfrost2008/06/29 05:36:142026/08/31 00:04:50AS15a02S2fe00S15a0aS2fe00S21400S22a04S20500M516x522S15a02489x496S15a0a485x510S22a04498x478
      verb
      1. to close a gap in a vertical, flat surface by moving part of it downward: he lowered the metal shutter to seal off the entrance.
      2. to be completely uninterested or unreceptive; to deliberately exclude or reject (something): she totally shut him out when he brought up the topic.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf81\ud8db\udfc5\ud8d8\udde1.mov"} qq l 335 !elfrost2008/06/29 05:37:322026/08/31 00:06:44AS15a02S2fe00S15a0aS2fe00S21400S20600M526x513S15a02499x487S15a0a495x501S20600475x487
      noun
      1. an opening in the wall of a building or vehicle that is fitted with glass or other transparent material in a frame to admit light or air and allow people to see out.
        • a pane of glass filling a window: thieves smashed a window and took $600.
        • an opening in a wall or screen through which customers are served in a bank, ticket office, or similar building.
        • a space on the inside of a store's window where goods are displayed for sale: [as modifier] : beautiful window displays | I prefer the red dress that's in the window.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} 66Gm33iM!emfrost2008/06/29 05:51:202026/09/20 16:34:22AS15a10S30006S15a18S30002S26500S26510M533x518S2ff00482x483S15a10520x487S15a18468x487S26500519x469S26510467x469M540x518S2ff00482x483S15a10520x487S15a18468x487S26a00513x470S26a10461x470
      verb [to front locus]
      1. to look at or have something come to mind: Alice didn't pay attention to his sermon.
      INFLECTED FORMS
      pay attention (verb) [frequentative]
      Adam Frost{"video":"dominance: equal;\\n\ud8c8\uddd1\ud8f0\udc07\ud8c8\uddd9\ud8f0\udc03\ud8e1\udde1\ud8e1\uddf1.mov"}   pn 33A !)nfrost2021/01/04 02:13:342026/08/31 00:11:26AS16d20S2fe00S2031aS2fe00S21400S21100S2ea32M516x519S2031a485x504S16d20484x482S21100503x488
      noun
      1. a food preparation in the form of a paste or solid block made from roasted and ground cacao seeds, typically sweetened: a bar of chocolate | [as modifier] : a chocolate cookie.
        • a candy made of or covered with chocolate: a box of chocolates.
        • a deep brown color: [as modifier] : huge spiders, yellow and chocolate brown.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udd01\ud8fc\udc61\ud8d8\udd3b\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8ed\udff3.mov"} ffo 33 w!Uofrost2021/01/04 02:22:222026/09/01 18:08:54AS16d20S2fe00S10006S27106M518x520S16d20483x489S27106503x480
      noun
      1. a compound of the sterol type found in most body tissues; chemical formula: C27H45OH.
      proper noun
      1. the community in western San Diego, California bordered by Interstate 805 on the east, Interstate 5 to the west, State Route 52 to the north, and the community of Linda Vista to the south.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udd01\ud8fc\udc61\u00d8\ud8e2\ude67.mov"} ""[p335#%!epfrost2021/01/04 02:26:472026/09/06 18:55:12AS17121S2fe00S20356S2fe00S21400S20900M511x521S17121491x491S20356490x506S20900489x479S38b00470x493 M511x521S17121491x491S20356490x506S20800495x479 S38b04470x493
      noun
      1. the language of England, widely used in many varieties throughout the world.
      Adam Frost{"video":"dominance: right;\\n\ud8ca\ude82\ud8fc\udc61\ud8d8\udd77\ud8fc\udc61\ud8d9\udf81\ud8d8\udf61.mov"} |oq 33]o1!qfrost2021/01/04 02:41:372026/09/06 18:56:31AS17610S2fe00S10006M508x508S17610492x492S38b00470x493 M508x508S17618492x492 S38b04470x493
      counting number [as independent number]
      1. no quantity or number; naught: figures from zero to nine | you've left off a zero—it should be five hundred million.
      PHONOLOGICAL VARIANTS
      zero left-handed
      Adam Frost{"video":"dominance: right;\\n\ud8cb\udc51\ud8fc\udc61\u00d8.mov"} TT)r 33]o%!rfrost2021/01/04 02:43:302026/09/06 19:00:25AS17620S2fe00S10006M508x508S17620492x492S38b00470x493 M508x508S17628492x492 S38b04470x493
      noun
      1. the fifteenth letter of the fingerspelling alphabet.
        • denoting the next after N in a set of items, categories, sizes, etc.
        • a human blood type (in the ABO system) lacking both the A and B antigens. In blood transfusion, a person with blood of this group is a potential universal donor.
      number [in combination]
      1. no number; naught: thirty or forty years ago | there were 105 people at the event.
      PHONOLOGICAL VARIANTS
      O left-handed
      Adam Frost{"video":"dominance: right;\\n\ud8cb\udc61\ud8fc\udc61\u00d8.mov"}x486M538x525S1ea41502x475S1ea49468x475S2e700507x500S2e74c479x500S26506523x505S26512463x505
      verb
      1. to be the same or balanced: four plus six divided by two equals five | the total debits should equal the total credits.
      adjective
      1. having no difference or advantage; the same or balanced: equal pay | the game was tied.
      noun
      1. the state of being equal.
        • a result in a game or other competitive situation in which two or more competitors or teams have the same score or ranking: there was a tie for first place.
        • SIGN VARIATIONS
          tie (noun) with index-over-thumb hands
      Adam Frost{"video":"dominance: equal;\\n\ud8cc\udcd1\ud8fc\udc61\ud8cc\udcd9\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"}  0 A!t 33 3!tfrost2021/01/04 02:50:332026/09/06 19:12:12AS18241S38517S18249S38511S20500S20500S2c300S2c311M542x529S18241514x499S18249461x499S20500507x518S20500484x518S2c300516x472S2c311459x472
      adjective [predicative]
      1. in need of sleep or rest; weary: I'm tired after the workout | she felt tired from studying all night.
      Adam Frost{"video":"dominance: equal;\\n\ud8cc\udd02\ud8fc\uddf8\ud8cc\udd0a\ud8fc\uddf2\ud8d8\udde1\ud8d8\udde1\ud8ea\udd21\ud8ea\udd32.mov"}Es 33c{!Wsfrost2021/01/04 02:46:312026/10/10 20:32:23AS17620S2fe00S10006S14020M515x525S17620499x475S14020485x495M508x508S17620492x492 M515x515S14020486x485
      exclamationq reu335m?!ufrost2021/01/04 21:06:402026/09/30 17:17:46AS1820bS38547S18203S38541S20e00S20e00S22f00S22f10M548x531S36d10479x470S1820b517x506S18203468x506S20e00530x491S20e00457x491S22f00523x474S22f10450x474M545x542S36d10479x459S15a1c479x497S15a14459x497S22a04532x527S22a14512x527S26526494x527S22a04478x527S22a14458x527
      noun
      1. an outer garment covering the body from the waist to the ankles, with a separate part for each leg: baggy corduroy pants | (pant as modifier) : his pant leg.
      SIGN VARIATIONS
      pants with downward movements
      Adam Frost{"video":"dominance: equal;\\n\ud8cc\udccc\ud8fc\ude28\ud8cc\udcc4\ud8fc\ude22\ud8d9\udd41\ud8d9\udd41\ud8dc\udda1\ud8dc\uddb1.mov"}5x527S2ff00482x483S18210512x512S20500515x482
      noun
      1. the upper part of the human body, or the front or upper part of the body of an animal, typically separated from the rest of the body by a neck, and containing the brain, mouth, and sense organs.
        • the head regarded as the location of intellect, imagination, and memory: whatever comes into my head.
        • (heads) the obverse side of a coin (used when tossing a coin): heads or tails?.
      2. a thing resembling a head either in form or in relation to a whole.
        • the cutting, striking, or operational end of a tool, weapon, or mechanism.
        • the flattened or knobbed end of a nail, pin, screw, or match.
        • the edible leafy part at the top of the stem of such green vegetables as cabbage and lettuce.
      Adam Frost{"video":"dominance: right;\\n\ud8cc\udcd1\ud8f0\udc06\u00d8\ud8d8\udde1\ud8db\udfc1\ud8d8\udde1\ud8f0\udc08.mov"} oex 335 !!xfrost2021/01/04 21:28:152026/09/06 19:33:08AS1821bS38547S18213S38541S20e00S20e00S26a06S26a12M563x531S36d10479x470S1821b512x506S18213471x506S20e00534x511S20e00454x511S26a06549x504S26a12437x504
      noun
      1. short pants that reach only to the thighs or knees: cycling shorts.
      Adam Frost{"video":"dominance: equal;\\n\ud8cc\udcdc\ud8fc\ude28\ud8cc\udcd4\ud8fc\ude22\ud8d9\udd41\ud8d9\udd41\ud8e1\udfc7\ud8e1\udfd3.mov"}Sw 33A !qwfrost2021/01/04 21:13:582026/09/30 17:21:41AS18210S30005S10006S20500S22a00S20500S30007M53v3359e!evfrost2021/01/04 21:11:422026/09/22 16:10:29AS18210S2fe00S18218S2fe00S21406S20600M524x515S18210501x500S18218476x500S20600489|d work consisting of pages glued or sewn together along one side and bound in covers: a book of selected poems | a book on cats | [as modifier] : a book report.
      • a literary composition that is published or intended for publication as a book: the book is set in the 1940s | I'm writing a book.
      • a main division of a classic literary work, an epic, or the Bible: the Book of Genesis.
      • the libretto of an opera or musical, or the script of a play.
      • an imaginary record or list (often used to emphasize the thoroughness or comprehensiveness of someone's actions or experiences): she felt every emotion in the book of love.
    2. INFLECTED FORMS
      book [in isolation]
    Adam Frost{"video":"dominance: equal;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e7\udcc9\ud8e7\udcd1.mov"} _K>z 33O i!ezfrost2021/01/04 21:39:172026/09/06 23:47:26AS18241S38517S18249S38511S20500S20500M539x515S18241514x485S18249461x485S20500507x504S20500484x504
    verb
    1. to possess, own, hold, or be provided with (a feature): he had a new car and a boat | do you have a job yet? | I don't have that much money on me | he has the equipment with him | the house has gas heat.
    Adam Frost{"video":"dominance: equal;\\n\ud8cc\udd02\ud8fc\uddf8\ud8cc\udd0a\ud8fc\uddf2\ud8d8\udde1\ud8d8\udde1.mov"}y 335 C!eyfrost2021/01/04 21:35:312026/09/06 23:43:16AS15a02S2fe00S15a0aS2fe00S21414S20600M521x515S15a0a480x485S15a02494x490S20600488x504
    adverb [center to front loci]
    1. at a short distance: his four sisters live nearby.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf95\ud8d8\ude41.mov"} wj{ 33A 7!}{frost2021/01/04 21:44:222026/09/06 23:48:48AS18250S2fe00S15a39S2fe00S21400S28802S20500M528x514S15a39472x487S18250482x499S28802506x486
    adverb
    1. another time; once more: it was great to meet old friends again | they were disappointed yet again.
      • returning to a previous position or condition: he rose, tidied the bed, and sat down again.
      • [sentence adverb] used to introduce a further point for consideration, supporting or contrasting with what has just been said: I never saw any signs, but then again, maybe I wasn't looking.
      • used to ask someone to repeat something: what was your name again?.
    Adam Frost{"video":"dominance: right;\\n\ud8cc\udd11\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8e4\udf03\ud8d8\udde1.mov"} @/|33 ;!)|frost2021/01/04 21:46:372026/09/06 23:52:09AS18507S33d00S10006S20600M540x537S33b00482x483S18507502x510S20600518x509S38b00470x493 M521x537S33b00482x483S18507502x510 S38b04470x493
    noun
    1. any nutritious substance one eats in order to maintain life and growth: we need food and water | they had eaten their food and slept | baby foods | [as modifier] : food shortages.
      • the activity of eating a meal: [as modifier] : a dining area.
    verb
    1. to eat as an activity or process: I like eating watermelon | what are you eating?.
    Adam Frost{"video":"dominance: right;\\n\ud8cc\udde8\ud8f5\udee1\u00d8\ud8d8\ude41.mov"} ZZ#}335W!e}frost2021/01/02 23:46:272026/09/07 17:02:34AS15a11S2fe00S15a19S2fe00S21406S20600M524x518S15a11501x495S15a19476x495S20600489x482S38b00470x493 M549x520S15a11502x497S15a19477x497S20e00495x483S27100509x480S27114452x480 S38b04470x493
    noun
    1. a place known by a name, consisting of a group of houses and associated buildings.
    PHONOLOGICAL VARIANTS
    town with alternating movement
    Adam Frost{"video":"dominance: equal;\\n\ud8c8\uddd2\ud8fc\udc61\ud8c8\uddda\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"} \\!~ 33) y!A~frost2021/01/02 23:53:302026/09/07 17:05:02AS15a11S30007S10006S20500S26500M533x518S2ff00482x483S15a11510x487S26500508x469
    exclamation
    1. used as a greeting or to begin a phone conversation: hello there, Katie!.
      • expressing sarcasm or anger: Hello! Did you even get what the play was about?.
    verb [no object]
    1. to say or shout “hello”; greet someone: I pressed the phone button and helloed.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8f0\udc08\u00d8\ud8d8\udde1\ud8e1\udde1.mov"} wo33gS !Efrost2021/01/03 00:24:252026/09/13 22:29:06AS15a1cS38541S15a14S38541S22a04S22a14S26526S38547S22a04S22a14M545x542S36d10479x459S15a1c479x497S15a14459x497S22a04532x527S22a14512x527S26526494x527S22a04478x527S22a14458x527M548x531S36d10479x470S1820b517x506S18203468x506S20e00530x491S20e00457x491S22f00523x474S22f10450x474
    noun
    1. pants.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\udddd\ud8fc\ude22\ud8c8\uddd5\ud8fc\ude22\ud8db\udfc5\ud8db\udfd5\ud8e1\ude07\ud8fc\ude28\ud8db\udfc5\ud8db\udfd5.mov"} p``flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|      !!""##$$%%&&''(())**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^__``aabbccddeeffgghhiijjkkllmmnnoopp \<<BHNTZ`flrx~ (08@HPX`hpx (08@HPX`hpxrrssttuuvvwwxxyyzz{{||}}~~ $ 33Ae!Gfrost2021/01/03 00:28:492026/09/07 18:06:32AS15a20S2fe00S15a28S2fe00S21406S20500S2df04M526x514S15a20489x486S15a28475x486S2df04505x493M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M528x513S14720489x487S14728473x487S2df04507x492 S38800464x496
    You might be looking for open.
    Adam Frost{"video":"dominance: right;"} $ 33Ae!Gfrost2021/01/03 21:34:412026/09/07 18:04:13AS15a20S2fe00S15a28S2fe00S21406S20600S2e004M526x516S15a20489x485S15a28475x485S2e004505x488M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M528x516S14720489x485S14728473x485S2e004507x488 S38800464x496
    You might be looking for door.
    Adam Frost{"video":"dominance: right;"} * 33Aq!Gfrost2021/01/03 21:42:562026/09/07 18:08:46AS15a20S2fe00S15a28S2fe00S21406S2df0cS20500M526x514S15a20489x486S15a28475x486S2df0c505x493M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M528x513S14720489x487S14728473x487S2df0c507x492 S38800464x496
    You might be looking for close door.
    Adam Frost{"video":"dominance: right;"} ==? 33Q !Kfrost2021/01/03 21:46:342026/09/07 18:13:00AS15a20S2fe00S10006S2880aM517x518S15a20484x491S2880a495x482M520x520S14c20480x484S27106505x480
    exclamation informal
    1. a phonological variant (flat hand) of hi.
    Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c8\udde1\ud8fc\udc61\u00d8\ud8e4\udf0b.mov"} # 33[ s!}frost2021/01/03 21:49:112026/09/07 18:46:00AS15a30S2fe00S15a38S2fe00S38006S2e508S2e510M532x530S15a30512x471S15a38475x471S2e508509x503S2e510468x503
    adverb
    1. in, at, or to this place: they have lived here most of their lives | [after preposition] : I'm getting out of here | it's too hot in here.
      • [with infinitive] used to indicate one's role in a particular situation: I'm here to help you | we're not here to mess around.
      • used to refer to existence in the world in general: what are we all doing here?.
    Adam Frost{"video":"dominance: equal;\\n\ud8c8\uddf1\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8fc\udc07\ud8ed\udde9\ud8ed\uddf1.mov"}orms, according to whether they indicate the speaker (first person), the addressee (second person), or a third party (third person).
    suffix
    1. denoting a person that performs a specified action or activity: farmer.
      • [chiefly in translation] denoting an animal or thing that performs a specified action or activity: changer.
    2. denoting a person that has a specified attribute or form: foreigner.
      • [chiefly in translation] denoting a thing that has a specified attribute or form: two-wheeler.
    3. denoting a person concerned with a specified thing or subject: philosopher.
    4. [chiefly in translation] denoting a person belonging to a specified place or group: city-dweller | New Yorker.
    Adam Frost{"video":"dominance: equal;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"} xx|33g!!frost2021/01/03 21:54:522026/09/19 21:25:02AS15a40S2fe00S15a48S2fe00S21406S20500S2a208S2a210M535x523S15a40500x496S15a48487x496S2a208512x478S2a210465x478M536x529S15a40502x502S15a48487x502S2a308513x472S2a310465x472
    verb
    1. to part the sides from a folded position: he unfolded the map and laid it out on the table.
      • to part the covers of (a book or binder) to read it: she opened her book at the prologue.
    adjective
    1. with the sides parted from a folded position: the student gave the unfolded paper to the teacher.
      • (of a book or binder) with the covers parted in view, allowing it to be read: she was copying verses from an open Bible.
    noun
    1. a written or printe 33g9!frost2021/01/03 21:57:092026/09/08 21:58:20AS15a40S2fe00S15a48S2fe00S21406S20600S2a308S2a310M536x529S15a40502x502S15a48487x502S2a308513x472S2a310465x472M535x523S15a40500x496S15a48487x496S2a208512x478S2a210465x478
      noun [in isolation]
      1. a book.
      Adam Frost{"video":"dominance: equal;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41\ud8e7\udd29\ud8e7\udd31.mov"}gether, especially in half: she folded the paper in half.
      • to bring the covers of (a book or binder) together to stop reading: Ron closed the book.
    2. to make flat or compact: she folded the chair flat.
    adjective
    1. (of a flat object) with two sides brought together, especially in half: the student gave the folded paper to the teacher.
      • (of a book or binder) with the covers brought together, no longer open to being read: she picked up the closed book.
    2. in a flat or compact configuration: the folded box was stored in the closet.
      • able to be bent or rearranged into a flatter or more compact shape, typically in order to make it easier to store or carry: a folding chair.
    Adam Frost{"video":"dominance: equal;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8e7\udcc1\ud8e7\udcd9\ud8d8\udde1.mov"}   T 33[ o!}frost2021/01/03 21:58:592026/09/09 18:14:14AS15a40S2fe00S15a48S2fe00S38006S22a04S22a14M523x523S15a40510x478S15a48478x478S22a04510x508S22a14477x508
    noun
    1. a human being regarded as an individual: the porter was the last person to see her | she is a person of astonishing energy.
      • used in legal or formal contexts to refer to an unspecified individual: the entrance fee is $10.00 per person.
      • [with modifier] an individual characterized by a preference or liking for a specified thing: she's not a cat person.
    2. Grammar a category used in the classification of pronouns, possessive determiners, and verb fy as to produce beauty of form, harmony, and expression of emotion: couples were dancing to the music | baroque music.
    3. a short poem or other set of words set to music or meant to be sung.
      • the musical phrases uttered by some birds, whales, and insects, typically forming a recognizable and repeated sequence and used chiefly for territorial defense or for attracting mates.
    verb [no object]
    1. to make musical sounds with the voice, especially words with a set tune: Bella sang to the baby.
      • [with object] to perform (a song, words, or tune) with the voice: someone started singing “God Bless America”.
    DERIVATIVES
    musician noun
    Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\ude63\ud8c8\uddfb\ud8fc\udc61\ud8e7\udd85.mov"} h 33Cm}!Mfrost2021/01/03 22:10:422026/09/10 19:25:10AS15a40S38622S15a3aS2fe00S2a404M534x524S37806475x517S15a3a507x512S15a40497x478S2a404467x476M534x551S37806475x490S15a3a507x485S15a40497x451S2a404467x449S15a40510x506S15a48478x506S22a04510x536S22a14477x536
    noun
    1. vocal or instrumental sounds (or both) combined in such a wau 33g !frost2021/01/03 22:02:072026/09/10 18:41:23AS15a40S2fe00S15a48S2fe00S21406S2a200S2a218S20500M536x524S15a40501x497S15a48488x497S2a200513x476S2a218465x476
      verb
      1. (of a flat object) to bring two sides toorland.
      2. [with object] travel along or over (a route or area) on foot: the police department has encouraged officers to walk the beat.
      3. to take (a domestic animal, typically a dog) out for exercise: a man walking his retriever.
      noun
      1. an act of traveling or an excursion on foot: he was too restless to sleep, so he went out for a walk.
        • [in singular] used to indicate the time that it will take someone to reach a place on foot or the distance that they must travel: the library is within five minutes' walk.
      2. [in singular] an unhurried rate of movement on foot: they crossed the field at a leisurely walk.
        • a person's manner of walking: the spring was back in his walk.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\ud8c8\ude19\ud8fc\udc61\ud8fc\udc07\ud8eb\udf81\ud8eb\udf92.mov"}as modifier] : a paper bag.
    2. (usually papers) a piece or sheet of paper with something written or drawn on it: he riffled through the papers on his desk.
      • a piece of written, printed, or electronic matter that provides information or evidence or that serves as an official record.
      • (papers) significant or important documents belonging to a person: the personal papers of major political figures.
      • (papers) documents attesting identity; credentials: two men stopped us and asked us for our papers.
      • a government report or policy document: a recently leaked cabinet paper.
    3. an essay or thesis, especially one read at an academic lecture or seminar or published in an academic journal: he published a highly original paper on pattern formation.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc4.mov"} n 33[ #!}frost2021/01/03 22:13:532026/09/12 22:03:27AS15a50S2fe00S15a58S2fe00S38006S2d400S2d411M548x538S15a50509x483S15a58477x462S2d400505x515S2d411452x495
    verb
    1. to move at a regular pace by lifting and setting down each foot in turn, never having both feet off the ground at once: I walked across the lawn | she turned and walked a few paces.
      • go on foot for recreation and exercise: you can walk in 21,000 acres of mountain and mo xk 33 I!)frost2021/01/03 22:17:302026/09/12 22:05:43AS15a50S2fe00S10006S22a00M507x523S15a50495x496S22a00494x477
        verb
        1. (of a person) to undergo natural development by increasing in size and changing physically; progress to maturity: he would watch Nick grow to manhood.
          • to advance to maturity; develop into an adult: I grew up in a small town in Michigan.
        2. to bring up (a child): he was born and raised in San Francisco.
        Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\u00d8\ud8db\udfc1.mov"} and heating the ingredients in various ways: shall I cook dinner tonight? | [no object] : I told you I could cook.
        • [no object] (of food) be heated so that the condition required for eating is reached: while the rice is cooking, add the saffron to the stock.
    noun
    1. a person who prepares and cooks food, especially as a job or in a specified way: I'm a good cook | a short order cook.
    2. the practice or skill of preparing food by combining, mixing, and heating ingredients: she first became interested in cooking at the age of 17.
      • food that has been prepared in a particular way: authentic Italian cooking.
      • [as modifier] suitable for or used in cooking: cooking oil.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e7\udcc9\ud8d8\udde1.mov"} QQ 33[ I!}frost2021/01/03 22:20:502026/09/30 17:22:40AS15a51S2fe00S15a39S2fe00S21400S20e00S26a03M529x523S15a39506x478S15a51492x478S20e00488x495S26a03472x502
    noun
    1. material manufactured in thin sheets from the pulp of wood or other fibrous substances, used for writing, drawing, or printing on, or as wrapping material: a sheet of paper | [ 33g I!frost2021/01/03 22:22:562026/09/12 22:12:46AS15a51S2fe00S15a39S2fe00S21400S20500S2a208S20500M527x523S15a39474x491S15a51485x500S20600482x477S2a208504x486
      verb
      1. [with object] to prepare (food, a dish, or a meal) by combiningw 33[ 5!}frost2021/01/03 22:28:072026/09/12 22:15:34AS15a51S2fe00S15a39S2fe00S21400S20e00S28800M519x528S15a39496x505S15a51482x504S20e00495x495S28800506x473
        noun
        1. an educational institution or establishment, in particular one providing higher education or specialized professional or vocational training: my brother wanted to go to college | I'm at college, studying graphic design.
          • any of the independent institutions into which certain universities are separated, each having its own teaching staff, students, and buildings: the Oxford colleges | [in names] : Trinity College, Cambridge.
          • (within a university) a school offering a general liberal arts curriculum leading only to a bachelor's degree: [in names] : Harvard College.
          • the teaching staff and students of a college considered collectively: the college was shocked by his death.
        2. an organized group of professional people with particular aims, duties, and privileges: [in names] : the electoral college.
        Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e4\udf01.mov"}cf different ingredients used in a mixture: repot plants in a mixture of three parts soil, one part sand.
      2. some but not all of something: the painting tells only part of the story.
        • a point on or area of something: hold the furthest part of your leg that you can reach.
        • (parts) informal a region, especially one not clearly specified or delimited: they wanted to know why he was loitering in these parts.
      3. the contribution made by someone or something to an action or situation: he played a key part in ending the revolt | he may be jailed for his part in the robbery | they were legislating for a future they had no part in.
        • the behavior appropriate to or expected of a person in a particular role or situation; a person's duty: in such a place his part is to make good.
      predeterminer
      1. an unspecified amount or numb / 33[ %!}frost2021/01/03 22:29:482026/09/12 22:16:33AS15a51S2fe00S15a39S2fe00S21400S21100S26507M519x524S15a39496x501S15a51481x501S21100493x489S26507506x476
        adjective
        1. pleasant; agreeable; satisfactory: we had a nice time.
        2. (of a person) pleasant in manner; good-natured; kind: he's a really nice guy | Joe had been very nice to her.
        Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e1\udde8.mov"} the wind        .
      2. in a way appropriate to: students were angry at being treated like children.
      3. such as one might expect from; characteristic of: just like you to put a damper on people's enjoyment.
      4. used in questions to ask about the characteristics or nature of someone or something: what is it like to be a tuna fisherman? | what's she like?.
      5. used to draw attention to the nature of an action or event: I apologize for coming over unannounced like this | why are you talking about me like that?.
      6. such as; for example: the cautionary vision of works like Animal Farm and 1984.
      conjunction
      1. in the same way that: people who change countries like they change clothes.
      2. as though; as if: I felt like I'd been kicked by a camel.
      Adam Frost{"video":"dominance: right;\\n\ud8ce\udde1\ud8fc\udc61\u00d8\ud8e2\ude67.mov"} ..B 33[ K!}frost2021/01/03 22:36:002026/09/12 22:22:28AS15a41S2fe00S15a3aS2fe00S21400S21100S26505M527x517S15a3a477x501S15a41473x483S21100501x489S26505514x504
      noun
      1. a piece or segment of something such as an object, activity, or period of time, which combined with other pieces makes up the whole: divide the circle into three equal parts | the early part of 1989.
        • an element or constituent that belongs to something and is essential to its nature: I was part of the family.
        • a component of a machine: the production of aircraft parts.
        • a specified fraction of a whole: they paid a twentieth part of the cost.
        • a division of a book treated as a unit in which a particular topic is discussed: this theme will be further explored in Parts Four and Five of the book | Part Four of the series.
        • a measure allowing comparison between the amounts o22x522S15a02495x479S15a0a479x483S20e00501x494S26a04494x508
          adjective
          1. achieved without great effort; presenting few difficulties: an easy way of retrieving information.
          2. (of a period of time or way of life) free from worries or problems: promises of an easy life in the New World.
          adverb
          1. without difficulty or effort: he climbed the mountain easily | the area is easily accessible by road.
            • more quickly or frequently than is usual: they get bored easily.
          2. without doubt; by far: English is easily the reigning language in the financial world.
            • very probably: events that could easily become stodgy and predictable.
          Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf91\ud8d9\udd41\ud8e1\udfc5.mov"}  33 !)frost2021/01/03 22:40:082026/09/12 22:24:16AS15a00S2fe00S10006S22114M513x518S15a00494x491S22114487x483
          number
          1. the cardinal number equivalent to the product of three and five; one more than fourteen, or five more than ten: all fifteen species of cranes mate for life | fifteen feet high | fifteen of the passengers made their appearance.
          Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc1\ud8fc\udc61\u00d8\ud8db\udc75.mov"}2 33[ +!}frost2021/01/03 23:55:192026/09/13 17:18:35AS15a02S2fe00S15a0aS2fe00S21410S20e00S26a04M52x474S2df1e478x474 M509x510S16d20492x490
          noun
          1. a group of students who are taught together: selected pupils act as representatives for the whole class.
            • an occasion when students meet with their teacher for instruction; a lesson: I was late for a class.
            • a course of instruction: I took classes in Indian music.
            • all those graduating from a school or college in a particular year: the class of 1907.
          2. a class or division of people or things regarded as having particular shared characteristics: five categories of intelligence.
          ORIGIN
          based on group with C handshapes.
          Adam Frost{"video":"dominance: equal;\\nletter: integrated;\\n\ud8ca\udcf1\ud8fc\udc61\ud8ca\udcf9\ud8fc\udc61\ud8fc\udc07\ud8ec\udfa7\ud8ec\udfbf.mov"} OO- 33O Q!Yfrost2021/01/04 00:18:582026/09/13 17:21:12AS15a02S30000S10006S20e00S26506S1f502M567x518S2ff00482x483S15a02501x488S26506532x487S1f502552x477
          verb
          1. to fail to recall or remember as if the thought were wiped from the mind: he had forgotten his lines | [with clause] : she had completely forgotten how tired and hungry she was.
            • to inadvertently neglect to do, bring, or mention something: I forgot my raincoat | [with infinitive] : she forgot to lock her door | [no object] : I'm sorry, I just forgot.
            • to put out of one's mind; cease to think of or consider: forget all this romantic stuff | [no object] : for years she had struggled to forget about him.
          Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8f0\udc01\u00d8\ud8d9\udd41\ud8e1\udde7\ud8d6\udfe3.mov"} WH33[1!)frost2021/01/04 00:33:112026/10/10 20:32:09AS16d10S2fe00S16d18S2fe00S38006S2df06S2df1eM522x524S16d10505x504S16d18478x504S2df06502x476S2df1e478x476M522x527S15410507x502S15418478x502S2df0650% 33 #!)frost2021/01/04 00:25:452026/09/13 17:22:14AS15a11S38407S10006S20600M531x518S2ff00482x483S15a11508x477S20600502x464
          noun
          1. a shaped covering for the head worn for warmth, as a fashion item, or as part of a uniform: a black straw hat | a woolly hat.
          Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8fc\udd88\u00d8\ud8d8\ude41.mov"}fe00S38006S22a04S22a14M542x566S2ff00482x483S18510517x486S18518458x486S15a10510x521S15a18478x521S22a04510x551S22a14477x551
          noun
          1. a person who teaches, especially in a school: a history teacher.
          2. a person who teaches something: a driving instructor.
            • a college teacher ranking below assistant professor.
          3. (also full professor) a teacher of the highest rank in a college or university: [as title] : Professor Goodwin | a professor of Art History.
            • an associate professor or an assistant professor.
            • informal any instructor, especially in a specialized field.
          Adam Frost{"video":"dominance: equal;\\n\ud8cc\uddf1\ud8f0\udc08\ud8cc\uddf9\ud8f0\udc02\ud8c8\uddd1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"} pg 33 a!}frost2021/01/04 01:29:142026/09/13 17:24:15AS16d10S31410S15a20S2fe00S22a03S21410S20500M523x568S2ff00482x483S16d10506x491S22a03504x516S16d10488x529S15a20481x541S20500496x551
          noun
          1. a still visual representation, created via photography, drawing, painting, printing, or other media: draw a picture of a tree | a photograph of her father | her work juxtaposed images from serious and popular art.
          Adam Frost{"video":"dominance: right;\\n\ud8ca\udcf1\ud8f1\udf91\ud8c8\udde1\ud8fc\udc61\ud8db\udfc4\ud8d9\udf91\ud8d8\udde1.mov"} u331q!Ufrost2021/01/04 01:33:192026/10/10 20:31:54AS16d10S30007S10006S20600M543x518S2ff00482x483S16d10512x471S20600521x493M535x528S1c527510x472S1c52f465x472S2e508506x501S2e510472x501 M509x510S16d20492x490
          noun
          1. a computer.
          ORIGIN
          based on brain with a C handshape.
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udcf1\ud8f0\udc08\u00d8\ud8d8\ude41.mov"} pp  33) M!Afrost2021/01/04 01:35:042026/09/13 17:31:46AS16d10S33d00S10006S20500S2c304M555x518S33b00482x483S16d10507x492S2c304528x489
          verb
          1. to take (a liquid) into the mouth and swallow: we sat by the fire, drinking our coffee | [no object] : he drank thirstily.
          noun
          1. a liquid that can be swallowed as refreshment or nourishment: cans of soda and other drinks | a table covered with food and drink.
          Adam Frost{"video":"dominance: right;\\n\ud8ca\udcf1\ud8f5\udee1\u00d8\ud8d8\udde1\ud8ea\udd25.mov"} ,  33 3!)frost2021/01/04 01:40:532026/09/13 17:34:14AS16d17S33010S10006S20500M537x518S2ff00482x483S16d17517x496
          verb
          1. to give one's attention to a sound: if I've had a stressful day I love to chill out and listen to music.
            • to take notice of and act on what someone says; respond to advice or a request: I told her over and over again, but she wouldn't listen.
          Adam Frost{"video":"dominance: right;\\n\ud8ca\udcf8\ud8f4\ude11\u00d8\ud8d8\udde1.mov"} **R 33] !_frost2021/01/04 01:42:592026/09/13 17:36:20AS16d20S2fe00S10006M509x510S16d20492x490
          noun
          1. the third letter of the fingerspelling alphabet.
            • denoting the third in a set of items, categories, sizes, etc.
            • the third highest class of academic mark: he scraped along with C's and D's in most subjects.
          combining form
          1. (following a numeral) used to represent multiplication by one hundred: he paid the bill with three hundred dollars.
          Adam Frost{"video":"dominance: right;\\nletter: integrated (combining form);\\n\ud8ca\udd01\ud8fc\udc61\u00d8.mov"} ~~~ 33c]!efrost2021/01/04 01:45:112026/10/10 20:30:44AS16d20S2fe00S10006S10e20M509x527S16d20492x473S10e20494x497M509x510S16d20492x490 M508x515S10e20493x485
          noun
          1. a brief account of a person's education, qualifications, and previous experience, typically sent with a job application: if you feel that you have these skills then please send us your CV.
          proper noun
          1. a city in southwestern California, south of San Diego, near the Mexican border.
          ORIGIN
          based on the spelling of C-V.
          Adam Frost{"video":"dominance: right;\\nfingerspelled; abbreviated;\\n\ud8ca\udd01\ud8fc\udc61\u00d8\ud8c1\udd61.mov"} - 33[E!!)frost2021/01/04 02:03:532026/10/10 20:31:29AS16d20S2fe00S2031aS2fe00S21400S20e00S26a02M524x520S2031a508x505S16d20507x484S20e00492x489S26a02476x481M535x528S1c527510x472S1c52f465x472S2e508506x501S2e510472x501 M523x538S3780b478x478S20359502x463S14741495x483S20e00489x499S2ea00489x513 M509x510S16d20492x490
          noun
          1. a computer.
          ORIGIN
          based on remodel with a C handshape.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udd01\ud8fc\udc61\ud8d8\udd3b\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc3.mov"}  33 q!-frost2021/01/04 22:02:032026/09/13 17:40:58AS18510S2fe00S18514S2fe00S21406S20500S2c300S2c314S20500M535x531S18510497x496S18514473x488S20600485x478S2c300509x469S2c314465x507
          noun
          1. an arithmetical value, expressed by a word, symbol, or figure, representing a particular quantity and used in counting and making calculations and for showing order in a series or for identification: she dialed the number carefully | an even number.
          2. a quantity or amount: the company is seeking to increase the number of women on its staff.
          Adam Frost{"video":"dominance: right;\\n\ud8cc\uddf1\ud8fc\udc61\ud8cc\uddf5\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ea\udd21\ud8ea\udd35\ud8d8\udde1.mov"} {X 33 9!frost2021/01/04 22:25:442026/09/13 22:00:33AS18510S2fe00S18548S2fe00S21406S21000S26a06S26a12M527x526S18548477x474S18510500x479S21000490x505S26a06513x499S26a12473x499
          noun
            verb [frequentative]
            1. to teach.
          Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8cc\uddf1\ud8f0\udc08\ud8cc\uddf9\ud8f0\udc02\ud8e1\udfc1\ud8e1\udfd1.mov"}i>an account of imaginary or real people and events told for entertainment: an adventure story | I'm going to tell you a story.
          • a plot or story line: the novel has a good story.
        • an account of past events in someone's life or in the evolution of something: the story of modern farming | the film is based on a true story.
          • a particular person's representation of the facts of a matter, especially as given in self-defense: during police interviews, Harper changed his story.
          • [in singular] a situation viewed in terms of the information known about it or its similarity to another: having such information is useful, but it is not the whole story | many children with leukemia now survive—twenty years ago it was a very different story.
      Adam Frost{"video":"dominance: right;\\n\ud8cc\uddf1\ud8fc\udc61\ud8cc\ude29\ud8fc\udc61\ud8d9\udf87\ud8d9\ude01\ud8e1\udfc7\ud8e1\udfd3.mov"}y sources, including solar, wind, and water.
    2. one of the four elements in ancient and medieval philosophy and in astrology (considered essential to the nature of the signs Cancer, Scorpio, and Pisces): [as modifier] : a water sign.
    3. (the water) a stretch or area of water, such as a river, sea, or lake: the lawns ran down to the water's edge.
      • the surface of an area of water: she ducked under the water.
      • [as modifier] found in, on, or near areas of water: a water plant.
      • (waters) the water of a particular sea, river, or lake: the waters of Hudson Bay.
    4. the amniotic fluid surrounding a fetus in the uterus, especially as discharged in a flow shortly before birth: she said her water broke in the middle of the night while she was sleeping.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cc\udeb1\ud8f0\udc05\u00d8\ud8d8\ude41.mov"} ZZ"!33eQ!9frost2021/01/04 22:29:592026/10/10 20:33:46AS18517S30005S10006S20500S20320S2fe00S20356S2fe00S21400S20500M531x570S2ff00482x483S18517512x509S20320493x539S20356501x555M553x536S2ff00482x483S18517512x509S20600531x504S26504535x518 M521x516S20320480x485S2035a490x501S20600499x486
    noun
    1. schoolwork that a student is required to do at home.
      • work or study done in preparation for a certain event or situation: he had evidently done his homework and read his predecessor's reports.
    ORIGIN
    a compound of home and work.
    Adam Frost{"video":"dominance: right;\\n\ud8cc\uddf8\ud8f0\udc06\u00d8\ud8d8\udde1\ud8d8\udd41\ud8fc\udc61\ud8d8\udd77\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1.mov"} !!["33[!}frost2021/01/04 22:32:392026/09/15 16:02:47AS1851cS2fe00S15a39S2fe00S21400S20e00S26a07M533x528S15a39468x505S1851c480x501S20e00505x489S26a07512x473M531x526S15a39469x503S1851c481x499S20e00506x487S26507518x474
    verb [frequentative]
    1. to buy.
    noun [often as modifier]
    1. the action or activity of purchasing goods from stores: shopping is so exhausting—all those decisions! | a busy shopping area.
    Adam Frost{"video":"dominance: right;\\n\ud8cc\uddfd\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc8.mov"} b# 33g g!frost2021/01/04 22:45:332026/09/15 16:08:49AS18550S2fe00S15a39S2fe00S21400S20500S15a51S20500M518x533S15a39483x468S18550493x479S15a39483x497S15a51492x510
    verb
    1. to put into writing or some other permanent form: when you've found the answers, jot them down.
    noun
    1. written information kept for reference: identification was made through dental records.
      • recorded material for viewing or reference: a documentary about marine life.
    Adam Frost{"video":"dominance: right;\\n\ud8cc\ude31\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8c8\ude12\ud8d8\udde1.mov"} eZ$ 33i !efrost2021/01/04 22:49:092026/09/15 16:14:16AS18551S30007S18559S30001S22101S22107M549x518S2ff00482x483S18551522x470S18559451x470S22101517x474S22107473x474
    verb
    1. to switch on a set of overhead lights: she turned on the lights.
    2. (of a set of overhead lights) to come on: the lights in his room turned on by themselves.
    3. (of a set of overhead lights) to be on: the lights are on.
    Adam Frost{"video":"dominance: equal;\\n\ud8cc\ude32\ud8f0\udc08\ud8cc\ude3a\ud8f0\udc02\ud8db\udc62\ud8db\udc68.mov"} k`% 33i !efrost2021/01/04 22:54:552026/09/16 00:41:56AS18551S30007S18559S30001S22105S22103M549x518S2ff00482x483S18551522x472S18559451x472S22105516x473S22103474x473
    verb
    1. to switch off a set of overhead lights: she turned off the lights.
    2. (of a set of overhead lights) to come off: the lights in his room turned off by themselves.
    3. (of a set of overhead lights) to be off: the lights are off.
    Adam Frost{"video":"dominance: equal;\\n\ud8cc\ude32\ud8f0\udc08\ud8cc\ude3a\ud8f0\udc02\ud8db\udc66\ud8db\udc64.mov"}34x520S19a00506x481S19a08467x481S22a04513x505S22a14475x505
    adverb
    1. at the present time or moment: where are you living now? | it's the most popular style of jazz right now | not now, I'm late | [after preposition] : they should be back by now.
      • at the time directly following the present moment: if we leave now we can be home by ten | I'd rather do it now than leave it till later.
      • under the present circumstances; as a result of something that has recently happened: it is now clear that we should not pursue this policy | I didn't receive the letter, but it hardly matters now.
      • on this further occasion, typically as the latest in a series of annoying situations or events: what do you want now?.
    Adam Frost{"video":"dominance: equal;\\n\ud8ce\uddc1\ud8fc\udc61\ud8ce\uddc9\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"} & 33 /!Ufrost2021/01/04 23:42:122026/09/30 17:31:32AS18710S30004S10006S20600M535x543S2ff00482x483S18710491x514S20600513x513
    noun
    1. a colorless, transparent, odorless liquid that forms the seas, lakes, rivers, and rain and is the basis of the fluids of living organisms: sodium chloride dissolves in water | can I have a drink of water?.
      • water as supplied to houses or commercial establishments through pipes and taps: each bedroom has a washbasin with hot and cold water | [as modifier] : water pipes.
      • tides, waves, and other flowing water as a source of energy from which power for domestic or industrial use may be generated: this involves the exploration of renewable energ xx' 33 {!)frost2021/01/05 00:01:522026/09/16 00:45:50AS10043S38510S10006S20500M521x516S10043491x485S20500479x505
        pronoun [at center locus]
        1. used to refer to a person or thing: I like coffee | do you understand me?.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc44\ud8fc\uddf1\u00d8\ud8d8\udde1.mov"} *(331!)frost2021/01/05 00:03:382026/09/16 01:53:05AS18710S2fe00S10006S2e008M521x521S18710480x492S2e008500x480M520x519S18720481x482S20e00503x495S22814499x509 M509x528S1f540492x472S18720491x499
        number
        1. equivalent to the product of four and four; one more than fifteen, or six more than ten: sixteen miles east of Detroit | sixteen of our eighteen patients.
        SIGN VARIATIONS
        sixteen with brushing movement
        sixteen beginning with a thumbs-up hand
        Adam Frost{"video":"dominance: right;\\n\ud8cc\udeb1\ud8fc\udc61\u00d8\ud8ed\udc09.mov"} _M) 33] M!frost2021/01/05 00:06:532026/09/16 00:48:37AS18720S2fe00S10006M509x515S18720491x486
        noun
        1. the twenty-third letter of the fingerspelling alphabet.
          • denoting the next after V in a set of items, categories, sizes, etc.
        number
        1. equivalent to the product of two and three; one more than five, or four less than ten: six of the people arrested have been charged.
        Adam Frost{"video":"dominance: right;\\n\ud8cc\udec1\ud8fc\udc61\u00d8.mov"} F{+ 33] )!frost2021/01/05 18:21:122026/09/16 15:49:51AS18d20S2fe00S10006M510x513S18d20490x488
        noun
        1. the thirteenth letter of the fingerspelling alphabet.
          • denoting the next after L in a set of items, categories, sizes, etc.
        Adam Frost{"video":"dominance: right;\\n\ud8cd\udd01\ud8fc\udc61\u00d8.mov"}6* 33)Q;!cfrost2021/01/05 18:17:572026/09/16 01:39:15AS18720S2fe00S10006S20e00S22814M520x519S18720481x482S20e00503x495S22814499x509M521x521S18710480x492S2e008500x480
        number [regional]
        1. sixteen.
        Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8d9\udd41\ud8db\udf15.mov"} ^^9$- 33 y!kfrost2021/01/05 18:24:132026/09/16 16:11:27AS19220S2fe00S10006S2a20cM519x518S19220498x499S2a20c482x483
        noun
        1. the tenth letter of the fingerspelling alphabet.
          • denoting the next after I in a set of items, categories, sizes, etc.
        2. [in combination] a drink made from fruit or vegetable juice: a glass of carrot juice.
        Adam Frost{"video":"dominance: right;\\nletter: abbreviated (sense 2);\\n\ud8cd\udee1\ud8fc\udc61\u00d8\ud8e7\udccd.mov"}v, 33] !frost2021/01/05 18:22:322026/09/16 15:53:03AS19220S2fe00S10006M511x510S19220490x491
        noun
        1. the ninth letter of the fingerspelling alphabet.
          • denoting the next after H in a set of items, categories, sizes, etc.
        Adam Frost{"video":"dominance: right;\\n\ud8cd\udee1\ud8fc\udc61\u00d8.mov"} nnse/ 33 =!)frost2021/01/05 18:59:292026/09/16 16:21:49AS19420S2fe00S10006S22f04M513x519S19420492x482S22f04488x505
        proper noun
        1. an industrial port in California, on the eastern side of San Francisco Bay.
        Adam Frost{"video":"dominance: right;\\n\ud8cd\udfa1\ud8fc\udc61\u00d8\ud8dc\udda5.mov"}%.33[u!frost2021/01/05 18:32:412026/09/16 16:15:45AS14e50S2fe00S14e58S2fe00S38006S26504S26514M532x525S14e50506x476S14e58469x476S26504513x510S26514474x510M531x525S14e00506x494S14e08469x494S26500511x475S26510475x475
        noun [at front to center loci, facing front]
        1. an audience.
        Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8c7\udd91\ud8fc\udc61\ud8c7\udd99\ud8fc\udc61\ud8fc\udc07\ud8e1\udde5\ud8e1\uddf5.mov"}he wrong answer        .
        • [predicative] having judged incorrectly: I was wrong about him being on the yacht that evening.
        • unsuitable or undesirable: they asked all the wrong questions.
        • [predicative] in a bad or abnormal condition: something was wrong with the pump.
      • unjust, dishonest, or immoral: they were wrong to take the law into their own hands | it was wrong of me to write you such an angry note.
    adverb
    1. in an unsuitable or undesirable manner or direction: what am I doing wrong?.
      • with an incorrect result: she guessed wrong.
    conjunction
    1. introducing an unexpected or surprising result: I went to the store, when unexpectedly it started to rain.
    Adam Frost{"video":"dominance: right;\\n\ud8ce\uddc1\ud8f0\udc05\u00d8\ud8d8\udde1.mov"} @@{2 33 i!)frost2021/03/03 17:49:402026/09/16 16:39:29AS10011S2fe00S10006S2c300M513x527S10011487x497S2c300487x473
    adjective
    1. foremost in order or importance: I always put myself first | football must come first.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8fc\udc61\u00d8\ud8ea\udd21.mov"}F1 33 !)frost2021/01/05 19:49:312026/09/16 16:31:37AS19a00S30004S10006S20500M518x526S2ff00482x483S19a00487x506
    adjective
    1. not correct or true: that is tJ0 33[ [!}frost2021/01/05 19:46:402026/09/16 16:23:36AS19a00S2fe00S19a08S2fe00S38006S22a04S22a14M5~t $).38=BGLQV[`ejoty~z #(-27<AFKPUZ_dinsx}tVS         !"#$%&'() *!,"-$.%/'0)1*3+4-5.6/718293;5<7>8?9@:A;B<C>D?EAFBGCHDIEJFKGLIMJNKOLPNQOSPURTQXTYUZV[W\X^YaZb[e\g]h^i_j`kalbmcndoepgrisjtkulvmwnxoypzq{r}t~uxz{|}~ p`Jflrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|`1 !"#$%&'()+-/2ā3Ł4ȁ5ʁ6ˁ7́9΁:ρ;Ё=с>ҁ?ӁAԁCՁDցF؁GفHځJ܁LށM߁NOPQRSTUVWXYZ\]^_`abdefghijknopqrsv w x y {|~   " #$%&(*+,.0/5 :!;#>%A&B'C(E*F+G,H-I.age as you are.
    2. of one type; exactly similar: they all wore the same clothes.
    pronoun
    1. the same thing as something previously mentioned: I'll resign and encourage everyone else to do the same.
      • people or things that are identical or share the same characteristics: there are several brands and they're not all the same.
    adverb
    1. similarly; in the same way: treating women the same as men | he gave me five dollars, same as usual.
    preposition
    1. having the same characteristics or qualities as; similar to: they were like brothers | she looked nothing like Audrey Hepburn | there were other suits like mine in the shop.
      • in the manner of; in the same way or to the same degree as: he was screaming like a banshee | you must run like G83 33Qs!Ufrost2021/01/05 19:53:472026/09/16 21:02:56AS19a10S2fe00S10006S2e100M514x525S19a10486x505S2e100487x475M514x521S19a10486x501S2df08490x480
        noun
        1. the color or pigment between green and orange in the spectrum, a primary subtractive color complementary to blue; colored like ripe lemons or egg yolks: the craft detonated in a blaze of red and yellow | a wide range of colors from rich vibrant reds, yellows, blues, and greens to more unexpected pastel shades.
        adjective [in isolation]
        1. of the color yellow.
        Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ce\uddd1\ud8fc\udc61\u00d8\ud8ed\udc61.mov"} }4 33] -!frost2021/01/05 20:24:222026/09/17 00:01:21AS19a20S2fe00S10006M514x510S19a20486x490
        noun
        1. the twenty-fifth letter of the fingerspelling alphabet.
          • denoting the next after X in a set of items, categories, sizes, etc.
        Adam Frost{"video":"dominance: right;\\n\ud8ce\udde1\ud8fc\udc61\u00d8.mov"} aster that claimed the lives of 266 Americans         | she didn't want to die; she loved life.
        • [with adjective or noun modifier] a particular type or aspect of people's existence: his father decided to start a new life in California | an experienced teacher will help you settle into school life | revelations about his private life.
        • either of the two states of a person's existence separated by death (as in Christianity and some other religious traditions): too much happiness in this life could reduce the chances of salvation in the next.
        • any of a number of successive existences in which a soul is held to be reincarnated (as in Hinduism and some other religious traditions): a spiritual pilgrimage into her past lives.
        • a chance to live after narrowly escaping death (with reference to the nine lives traditionally attributed to cats): we were called to the hospital, but the old rogue had nine lives and seemed to be negotiating to take part in (a sport): I play softball and tennis.
          • to participate in (an athletic match or contest): the Red Sox will play two games on Wednesday.
    noun
    1. activity engaged in for enjoyment and recreation, especially by children: a child at play may use a stick as an airplane.
      • behavior or speech that is not intended seriously: I flinched, but only in play.
    INFLECTED FORMS
    play [frequentative]
    play [durative]
    DERIVATIVES
    player noun
    Adam Frost{"video":"dominance: equal;\\n\ud8ce\ude01\ud8fc\udc61\ud8ce\ude09\ud8fc\udc61\ud8fc\udc07\ud8e7\udd8d\ud8e7\udd95.mov"} L 5 33 !)frost2021/01/05 20:29:102026/09/17 03:35:51AS19a20S2fe00S10006S27106M523x520S19a20477x489S27106508x480
    adjective
    1. of one person or thing rather than separate ones: she was saying the same thing over and over | I have never made the same mistake since | [with clause] : he put on the same costume that he had worn in Ottawa.
      • not having changed; unchanged: he's worked at the same place for quite a few years.
      • used to emphasize that one is referring to a particular, unique person or thing: people will always notice if you wear the same shirt two days running | they drank out of the same glass.
    2. of equal quality, amount, or value: I'm the same tion living in a camp, tent, or camper: camping attracts people of all ages | [as modifier] : a camping trip.
    3. a place with temporary accommodations of huts, tents, or other structures, typically used by soldiers, refugees, prisoners, or travelers: the enemy camp | a detention camp | the shot woke the whole camp
      • a recreational institution providing facilities for outdoor activities, sports, crafts, and other special interests and typically featuring rustic overnight accommodations: a summer camp for children | drama camp.
      • temporary overnight lodging out of doors, typically in tents: we pitched camp at a fine spot | we made camp at a bend in the creek.
      • a facility at which athletes train during the off-season: football tryout camps.
    Adam Frost{"video":"dominance: equal;\\n\ud8cf\udc12\ud8fc\udc61\ud8cf\udc1a\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8dc\udda6\ud8dc\uddb4.mov"} pC633[I!}frost2021/01/05 20:31:082026/09/18 16:19:34AS19a40S2fe00S19a48S2fe00S38006S2a40cS2a414M532x532S19a48469x468S19a40504x468S2a40c505x496S2a414470x495M532x533S19a48469x467S19a40504x467S2a304507x493S2a31c470x492 M532x526S19a48469x475S19a40504x475S2ea00512x501S2ea18474x500 S38a00464x490 M532x536S19a40504x464S19a48469x464S15a40512x490S15a48477x490S22a04511x521S22a14476x521
    verb
    1. [no object] to engage in activity for enjoyment and recreation rather than a serious or practical purpose: the children were playing outside.
      • [with object] to engage in (a game or activity) for enjoyment: I want to play Monopoly.
      • to amuse oneself by engaging in imaginative pretense: the boys were playing cops and robbers.
    2. [with object] {o7 33[ %!}frost2021/01/05 20:33:402026/09/18 16:23:02AS19a50S2fe00S19a58S2fe00S38006S2d200S2d211M533x525S19a50505x476S19a58467x476S2d200507x502S2d211467x502
      adverb
      1. up to and including the present or the time mentioned; even now (or then) as formerly: he still lives with his mother | it was still raining.
        • referring to something that will or may happen in the future: we could still win.
      Adam Frost{"video":"dominance: equal;\\n\ud8ce\ude11\ud8fc\udc61\ud8ce\ude19\ud8fc\udc61\ud8fc\udc07\ud8eb\udec1\ud8eb\uded2.mov"} [se9 33 =!)frost2021/01/05 20:39:242026/09/18 16:24:31AS19c40S2fe00S10006S2a408M514x535S19c40486x466S2a408486x499
      proper noun
      1. a resort section of northern San Diego in California, on the Pacific Ocean.
      Adam Frost{"video":"dominance: right;\\n\ud8ce\udec1\ud8fc\udc61\u00d8\ud8e7\udd89.mov"}!8 33 5!)frost2021/01/05 20:35:222026/09/18 16:23:54AS19a50S2fe00S10006S22f04M514x520S19a50486x480S22f04488x506
      exclamation
      1. used to express comprehension, acknowledgment, or realization in response to new information: oh, the file wasn't uploaded yet.
      Adam Frost{"video":"dominance: right;\\n\ud8ce\ude11\ud8fc\udc61\u00d8\ud8dc\udda5.mov"}535x528S1c527510x472S1c52f465x472S2e508506x501S2e510472x501M524x520S2031a508x505S16d20507x484S20e00492x489S26a02476x481 M543x518S2ff00482x483S16d10512x471S20600521x493
      noun
      1. an electronic device for storing and processing data, typically in binary form, according to instructions given to it in a variable program: my computer is frozen | the computer handles the entire process | [as modifier] : a computer program | there is a hugely expensive new computer system.
      SIGN VARIATIONS
      computer with C-hand on base hand
      computer with C-hand on the head
      Adam Frost{"video":"dominance: equal;\\n\ud8d2\ude08\ud8fc\udc61\ud8d2\ude10\ud8fc\udc61\ud8fc\udc07\ud8ed\udde9\ud8ed\uddf1.mov"} bb: 33 -!frost2021/01/05 20:45:272026/09/18 16:26:18AS1a011S2fe00S1a019S2fe00S21406S20500S22f05S22f13M542x528S1a019471x485S1a011501x485S20500495x472S22f05521x507S22f13459x507
      noun
      1. a portable shelter made of cloth, supported by one or more poles and stretched tight by cords or loops attached to pegs driven into the ground.
      2. the activity of spending a vaca  |;331E!)frost2021/01/05 20:47:302026/09/18 16:35:00AS1a510S2fe00S10006S2e008M523x520S1a510478x492S2e008502x480M520x518S1a520481x482S20e00503x494S22814499x508 M511x528S1f540491x473S1a520490x500
        number
        1. equivalent to one more than sixteen, or seven more than ten: seventeen years later | a list of names, seventeen in all.
        SIGN VARIATIONS
        seventeen with brushing movement
        seventeen beginning with a thumbs-up hand
        Adam Frost{"video":"dominance: right;\\n\ud8cf\uddf1\ud8fc\udc61\u00d8\ud8ed\udc09.mov"} S8= 33)Q?!cfrost2021/01/05 20:51:312026/09/18 16:37:04AS1a520S2fe00S10006S20e00S22814M520x518S1a520481x482S20e00503x494S22814499x508M523x520S1a510478x492S2e008502x480
        number [regional]
        1. seventeen.
        Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8cf\ude01\ud8fc\udc61\u00d8\ud8d9\udd41\ud8db\udf15.mov"})< 33] !frost2021/01/05 20:49:422026/09/18 16:28:23AS1a520S2fe00S10006M511x514S1a520490x486
        number
        1. equivalent to the sum of three and four; one more than six, or three less than ten: two sevens are fourteen | the remaining seven were sentenced to terms of imprisonment.
        Adam Frost{"video":"dominance: right;\\n\ud8cf\ude01\ud8fc\udc61\u00d8.mov"} hY> 33C M!Afrost2021/01/05 20:58:382026/09/18 17:53:54AS1bb00S30004S10006S21d00S20b00M530x537S2ff00482x483S1bb00487x509S21d00512x525S20b00515x510
        noun
        1. the natural agent that stimulates sight and makes things visible: the light of the sun | [in singular] : the street lamps shed a faint light into the room.
          • a source of illumination, especially an electric lamp: a light came on in his room.
          • decorative illuminations: Christmas lights.
          • a traffic light: turn right at the light.
          • the amount or quality of light in a place: the plant requires good light | in some lights she could look beautiful.
        Adam Frost{"video":"dominance: right;\\n\ud8d1\ude21\ud8f0\udc05\u00d8\ud8da\udee1\ud8d9\udc21.mov"} n_?331 !)frost2021/01/05 21:00:482026/09/18 17:59:46AS1bb10S2fe00S10006S2e008M522x520S1bb10478x492S2e008501x480M519x518S1bb20481x482S20e00502x494S22814498x508 M511x528S1f540491x473S1bb20490x500
        number
        1. equivalent to the product of two and nine; one more than seventeen, or eight more than ten: she wrote eighteen novels | out of sixty batches checked, eighteen were incorrect | eighteen of the guests were gathered.
        SIGN VARIATIONS
        eighteen with brushing movement
        eighteen beginning with a thumbs-up hand
        Adam Frost{"video":"dominance: right;\\n\ud8d1\ude31\ud8fc\udc61\u00d8\ud8ed\udc09.mov"} r7A 33)Q=!cfrost2021/01/05 21:03:532026/09/19 18:06:05AS1bb20S2fe00S10006S20e00S22814M519x518S1bb20481x482S20e00502x494S22814498x508M522x520S1bb10478x492S2e008501x480
        number [regional]
        1. eighteen.
        Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d1\ude41\ud8fc\udc61\u00d8\ud8d9\udd41\ud8db\udf15.mov"} @ 33] G!frost2021/01/05 21:02:202026/09/19 18:04:57AS1bb20S2fe00S10006M511x514S1bb20490x486
        number
        1. equivalent to the product of two and four; one more than seven, or two less than ten: a committee of eight members | eight were acquitted.
        Adam Frost{"video":"dominance: right;\\n\ud8d1\ude41\ud8fc\udc61\u00d8.mov"} 9C 33C !Mfrost2021/01/05 21:14:212026/09/19 18:09:01AS1c500S30007S1c509S38531S20500M537x563S2ff00482x483S1c500507x476S1c509477x526S20500497x552
        adjective
        1. affected by physical or mental illness: nursing very sick children | we were sick with bronchitis.
        Adam Frost{"video":"dominance: right;\\n\ud8d2\udde1\ud8f0\udc08\ud8d2\uddea\ud8fc\ude12\ud8d8\udde1.mov"}$B33gO!7frost2021/01/05 21:11:462026/09/19 18:07:34AS1bb51S2fe00S20348S2fe00S21400S20500S14c51S20500M515x538S20348494x481S1bb51488x462S20348494x523S14c51485x499M519x538S20348490x481S1c551494x462S20348490x523S14c51481x499
        noun
        1. a phonological variant (8-hand) of soda.
        Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d1\ude72\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8c7\udcd2\ud8d8\udde1.mov"} CC9D 33Q!)frost2021/01/05 21:29:312026/09/19 18:25:35AS1c507S30004S10006S20600M540x543S2ff00482x483S1c507499x518S20600518x508M524x543S2ff00482x483S1c507499x518
        noun
        1. a person or thing that is particularly well liked by someone: that song is her favorite.
          • a record of the address of a website or other data made to enable quick access; a bookmark.
        adjective [in isolation]
        1. favorite.
        Adam Frost{"video":"dominance: right;\\n\ud8d2\udde8\ud8f0\udc05\u00d8\ud8d8\ude41.mov"} BBy"F33[e1!}frost2021/01/05 21:47:202026/09/13 22:50:06AS1c527S2fe00S1c52fS2fe00S38006S2e508S2e510M̈́KE 33QE!)frost2021/01/05 21:39:402026/09/21 20:58:59AS1c520S2fe00S10006S22114M524x514S1c520494x486S22114477x487M515x532S1dc20486x468S14c20492x501
        number
        1. equivalent to the sum of thirteen and twelve; five more than twenty: the package weighs twenty-five pounds.
        SIGN VARIATIONS
        twenty-five starting with an L-hand
        Adam Frost{"video":"dominance: right;\\n\ud8d2\ude01\ud8fc\udc61\u00d8\ud8db\udc75.mov"}=propernoun203> proper noun
        1. a country in western Europe, on the Atlantic Ocean; capital, Paris.
      adjective
      1. relating to France or its people or language: the French government | her accent is very French.
      noun
      1. the Romance language of France, also used in parts of Belgium, Switzerland, and Canada, in several countries of northern and western Africa and the Caribbean, and elsewhere: I am fluent in French | [as modifier] : French lessons.
      2. the people of France collectively: the French, they say, live to eat.
      3. a monetary amount equivalent to nine units of the currency of the United States: it rang up to nine dollars and ninety cents.
      Adam Frost{"video":"dominance: right;\\nletter: integrated (proper noun, adjective, noun sense 1 & sense 2);\\n\ud8d3\udd61\ud8fc\udc61\u00d8\ud8ec\udfa1.mov"} dG331!)frost2021/01/05 21:50:102026/09/19 20:46:48AS1ce10S2fe00S10006S2e008M522x522S1ce10478x492S2e008501x478M519x519S1ce20481x481S20e00502x495S22814498x509 M511x529S1f540490x472S1ce20489x499
      number
      1. equivalent to one more than eighteen; nine more than ten: nineteen of the interviewees had never worked.
      SIGN VARIATIONS
      nineteen with brushing movement
      nineteen beginning with a thumbs-up hand
      Adam Frost{"video":"dominance: right;\\n\ud8d3\udd51\ud8fc\udc61\u00d8\ud8ed\udc09.mov"} &&VH 33] _!frost2021/01/05 21:51:302026/09/19 20:48:45AS1ce20S2fe00S10006M511x515S1ce20489x485
      noun
      1. the sixth letter of the fingerspelling alphabet.
        • denoting the next after E in a set of items, categories, sizes, etc.
        • the lowest class of academic marks (also used to represent “Fail”): they are guaranteed F's if they goof around.
      number
      1. equivalent to the product of three and three; one more than eight, or one less than ten: all nine justices agreed that the law could not stand.
      Adam Frost{"video":"dominance: right;\\n\ud8d3\udd61\ud8fc\udc61\u00d8.mov"} EJ 33 u!Ufrost2021/01/06 15:55:582026/09/19 20:51:58AS1ce20S2fe00S10006S22f04M513x525S1ce20491x476S22f04487x511
      proper noun
      1. an industrial and commercial city in north central California, south of Oakland, off San Francisco Bay.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d3\udd61\ud8fc\udc61\u00d8\ud8dc\udda5.mov"}7I 33)Q=!cfrost2021/01/05 21:52:402026/09/19 20:51:05AS1ce20S2fe00S10006S20e00S22814M519x519S1ce20481x481S20e00502x495S22814498x509M522x522S1ce10478x492S2e008501x478
      number [regional]
      1. nineteen.
      Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d3\udd61\ud8fc\udc61\u00d8\ud8d9\udd41\ud8db\udf15.mov"}ntry or community: the book was translated into twenty-five languages.
      • Computing a system of symbols and rules for writing programs or algorithms: a new programming language.
    3. the style of a piece of writing or speech: he explained the procedure in simple, everyday language.
      • the phraseology and vocabulary of a particular profession, domain, or group: legal language.
    SIGN VARIATIONS
    language (noun sense 2) with F-hand
    ORIGIN
    based on sentence with L handshapes.
    Adam Frost{"video":"dominance: equal;\\nletter: integrated;\\n\ud8d4\uded1\ud8fc\udc61\ud8d4\uded9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e4\udf06\ud8e4\udf1e.mov"} OxOE%L 33[ !}frost2021/01/06 15:59:332026/09/30 17:40:52AS1ce40S2fe00S1ce48S2fe00S21406S20e00S2e50eM529x526S1ce48472x475S1ce40494x475S20e00488x507S2e50e502x503
    verb [frequentative]
    1. to join, fasten, or repair (something) by making stitches with a needle and thread or a sewing machine: she sewed the seams and hemmed the border | [no object] : I don't even sew very well.
      • to attach (something) to something else by sewing: she could sew the veil on properly in the morning.
      • to make (a garment) by sewing: the two sisters sewed their own dresses.
    Adam Frost{"video":"dominance: right;\\n\ud8d3\udd81\ud8fc\udc61\ud8d3\udd89\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8ed\uddef.mov"}|K 33 ]!7frost2021/01/06 15:58:052026/09/19 20:55:05AS1ce20S2fe00S10006S2df00M517x526S1ce20495x496S2df00484x475
    .
    • [no object] to have the ability to mark down coherent letters or words: he couldn't read or write.
    • to fill in (a check): he had to write a check for $800.
  • to compose (a text or work) for written or printed reproduction or publication; to put into literary form and set down in writing: I didn't know you wrote poetry.
    • to compose (a musical work): he has written a song specifically for her.
  • Computing to enter (data) into an electronic or magnetic storage device, or into a particular location in a computer’s file system: files can be read and written directly into the file system.
    • INFLECTED FORMS
    write [frequentative]
    Adam Frost{"video":"dominance: right;\\n\ud8d6\udc71\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde8.mov"} 55?M33g1O!Afrost2021/01/06 16:02:212026/10/10 20:34:06AS1dc50S2fe00S1dc58S2fe00S21406S20500S28805S2881dM535x527S1dc50502x473S1dc58475x473S28805515x507S2881d466x507M538x515S1ce40501x485S1ce48477x485S26506523x500S26512462x500 M512x515S1dc20488x485
    noun
    1. the principal method of human communication, consisting of words used in a structured and conventional way and conveyed by signs, speech, writing, or gesture: a study of the way children learn language | [as modifier] : language development.
      • a nonverbal method of expression or communication: body language.
    2. a system of communication used by a particular cou UU'N33Co!Afrost2021/01/06 16:09:562026/09/20 16:45:51AS1ce02S38517S10006S20800S26a00M551x519S36d00479x485S1ce02499x497S20800532x500S26a00524x482M545x526S36d00479x504S1ce11517x491S20800516x516S22f00520x475
      noun
      1. a piece of clothing worn on the upper body under or without outerwear: she bought a new shirt for the weekend.
      noun, verb
      1. a phonological variant (forward movement) of volunteer.
      Adam Frost{"video":"dominance: right;\\n\ud8d3\udd43\ud8fc\uddf8\u00d8\ud8d8\udf01\ud8e1\udfc1.mov"} [[!O 33C ]!Afrost2021/01/06 16:15:032026/09/20 16:50:15AS1ce10S38407S10006S20800S26a06M554x518S2ff00482x483S1ce10514x467S20800506x472S26a06540x472
      noun
      1. any of the fine threadlike strands growing from the skin of humans, mammals, and some other animals: coarse outer hairs overlie the thick underfur | thick black hairs on his huge arms.
        • a fine threadlike strand growing from the epidermis of a plant, or forming part of a living cell: scalloped leaves edged with silver hairs | it damages the cilia, tiny hairs that clear invading bacteria from the lung.
      2. hairs collectively, especially those growing on a person's head: a woman with shoulder-length fair hair | [as modifier] : a hair salon.
      Adam Frost{"video":"dominance: right;\\n\ud8d3\udd51\ud8fc\udd88\u00d8\ud8d8\udf01\ud8e1\udfc7.mov"}  P 33A !}frost2021/01/06 16:24:292026/09/20 18:01:46AS1ce51S2fe00S17648S2fe00S21400S21300S2ea06M520x525S17648481x498S1ce51481x476S21300499x509
      noun
      1. a hot drink made by infusing the dried crushed leaves of the tea plant in boiling water: Catherine sipped her tea.
        • the dried leaves used to make tea: tea from India and Ceylon | [count noun] : tea bags containing teas from selected estates.
        • [usually with modifier] a hot drink made from the infused leaves, fruits, or flowers of other plants: herbal tea | fruit teas.
      Adam Frost{"video":"dominance: right;\\n\ud8d3\udd92\ud8fc\udc61\ud8cb\udc89\ud8fc\udc61\ud8d9\udf81\ud8d9\udf21\ud8ed\udfc7.mov"} bQ 33g!!ifrost2021/01/06 16:29:152026/09/20 18:04:07AS1ce40S2fe00S1ce48S2fe00S21406S20500S28805S2881dM527x527S1ce40502x474S1ce48478x474S28805507x507S2881d474x507M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M538x515S1ce40501x485S1ce48477x485S26506523x500S26512462x500 S38800464x496
      You might be looking for sentence/language.
      Adam Frost{"video":"dominance: equal;\\nvisible: sign;"} o]R 33] m!frost2021/01/06 16:33:062026/09/20 18:06:29AS1dc20S2fe00S10006M512x515S1dc20488x485
      noun
      1. the twelfth letter of the fingerspelling alphabet.
        • denoting the next after K in a set of items, categories, sizes, etc.
      combining form
      1. used to represent twenty as the tens component in numerals from twenty-three to twenty-nine: there are twenty-seven students in the class.
      Adam Frost{"video":"dominance: right;\\n\ud8d4\udea1\ud8fc\udc61\u00d8.mov"}  S335e!frost2021/01/06 16:41:152026/10/10 20:34:37AS1dc20S2fe00S10018S2fe00S21406S20600M521x526S10018494x496S1dc20497x475S20600480x481M518x524S10018486x494S1f010489x494S20600482x476 M512x515S1dc20488x485
      noun
      1. a character representing one or more of the sounds used in speech; any of the symbols of an alphabet, typically the English alphabet: a capital letter.
      ORIGIN
      based on word with an L handshape.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d4\udea1\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"} rr T33)G!Kfrost2021/01/06 16:45:032026/09/21 01:37:32AS1dc20S2fe00S10006S11e20M512x532S1dc20488x469S11e20489x502M519x516S12420481x486S22114493x484 M512x515S1dc20488x485 M512x515S11e20489x485
      number
      1. twenty-three.
      ORIGIN
      A compound of twenty- and three.
      Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8c2\udf61.mov"} ||U 33c!)frost2021/01/06 16:47:592026/09/21 20:53:45AS1dc20S2fe00S10006S14420M515x532S1dc20485x468S14420493x501M512x515S1dc20488x485 M511x516S14420489x485
      number
      1. equivalent to the product of three and eight; four more than twenty: there are twenty-four hours in a day.
      ORIGIN
      A compound of twenty- and four.
      Adam Frost{"video":"dominance: right;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8c6\udda1.mov"} eeV33EE!Kfrost2021/01/06 16:49:022026/10/10 20:34:52AS1dc20S2fe00S10006S14c20M515x532S1dc20486x468S14c20492x501M524x514S1c520494x486S22114477x487 S38a00464x490 M512x515S1dc20488x485 M512x516S14c20489x485
      number
      1. twenty-five.
      ORIGIN
      a compound of twenty- and five.
      Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8c7\udca1.mov"} {{W 33c!)frost2021/01/06 16:50:072026/10/10 20:35:02AS1dc20S2fe00S10006S18720M513x531S1dc20487x469S18720495x502M512x515S1dc20488x485 M509x515S18720491x486
      number
      1. equivalent to the product of two and thirteen; four less than thirty: she bought twenty-six tickets.
      ORIGIN
      a compound of twenty- and six.
      Adam Frost{"video":"dominance: right;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8cc\udec1.mov"} tX 33c!)frost2021/01/06 16:51:062026/10/10 20:35:22AS1dc20S2fe00S10006S1a520M515x531S1dc20486x470S1a520494x503M512x515S1dc20488x485 M511x514S1a520490x486
      number
      1. equivalent of the product three and nine; three less than thirty: the book has twenty-seven chapters.
      ORIGIN
      a compound of twenty- and seven.
      Adam Frost{"video":"dominance: right;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8cf\ude01.mov"} _QY 33 !)frost2021/01/06 16:55:042026/10/10 20:35:32AS1dc20S2fe00S10006S1bb20M515x531S1dc20486x470S1bb20494x503
      number
      1. equivalent of the product four and seven; two less than thirty: the class have twenty-eight students.
      ORIGIN
      a compound of twenty- and eight.
      Adam Frost{"video":"dominance: right;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8d1\ude41.mov"} qq Z 33c3!)frost2021/01/06 16:56:192026/10/10 20:35:41AS1dc20S2fe00S10006S1ce20M515x532S1dc20485x469S1ce20493x502M512x515S1dc20488x485 M511x515S1ce20489x485
      number
      1. equivalent of the sum of fourteen and fifteen; one less than thirty: twenty-nine people attended the meeting.
      ORIGIN
      a compound of twenty- and nine.
      Adam Frost{"video":"dominance: right;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8d3\udd61.mov"} \ 33 e!)frost2021/01/06 17:00:202026/09/21 21:24:26AS1e101S31410S10006S26500M531x524S2ff00482x483S1e101502x496S26500517x483
      verb [to front loci]
      1. to look at or observe something recreationally: we watched the movie together.
      Adam Frost{"video":"dominance: right;\\n\ud8d5\udc62\ud8f1\udf91\u00d8\ud8e1\udde1.mov"}y[ 33 e!)frost2021/01/06 16:58:162026/09/21 21:23:09AS1dc20S2fe00S10006S21802M517x516S1dc20493x485S21802483x498
      number
      1. equivalent to the product of three and seven; one more than twenty: he completed twenty-one laps.
      Adam Frost{"video":"dominance: right;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8da\udd03.mov"} md] 33[ !}frost2021/03/03 20:51:382026/09/22 15:38:59AS15a41S2fe00S15a0aS2fe00S21400S20e00S27102M528x520S15a0a490x508S15a41505x497S20e00490x494S27102472x480
      preposition
      1. at, into, or across the space separating (two objects or regions): the border between Mexico and the United States | the dog crawled between us and lay down at our feet | those who travel by train between London and Paris.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\ude02\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e2\ude63.mov"} ^ 33Ak!}frost2021/01/06 17:26:322026/09/22 15:49:53AS1e140S2fe00S1e148S2fe00S21410S20800S27120M520x530S1e140481x490S1e148492x504S27120481x471M518x530S1e140483x490S1e148494x504S26520495x471
      noun
      1. the act or activity of moving at a speed faster than a walk: I usually go for a run in the morning | a cross-country marathon.
        • a running pace: Bobby set off at a run.
      verb [continuative]
      1. to run: I run every morning.
      Adam Frost{"video":"dominance: right;\\n\ud8d5\udca1\ud8fc\udc61\ud8d5\udca9\ud8fc\udc61\ud8d9\udf91\ud8d8\udf01\ud8e2\ude81.mov"} YY#_ 33A U!Ofrost2021/03/15 03:52:342026/09/22 15:50:54AS14051S2fe00S10006S11a20S17620S11920S17620S11520S11920M516x596S14051485x404S11a20498x432S17620498x466S11920492x486S17620498x516S11520498x536S11920492x570
      noun Grammar
      1. a word that can function by itself as a noun phrase and that refers either to the participants in the discourse (e.g., I, you) or to someone or something mentioned elsewhere in the discourse (e.g., she, it, this).
      Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udc52\ud8fc\udc61\u00d8\ud8c2\udde1\ud8cb\udc61\ud8c2\udd81\ud8cb\udc61\ud8c2\udc01\ud8c2\udd81.mov"} <,` 33' #!-frost2021/01/06 17:46:042026/09/22 15:58:38AS1ea41S2fe00S1ea49S2fe00S38006S2e700S2e74cS26506S26512M538x525S1ea41502x475S1ea49468x475S2e700507x500S2e74c479x500S26506523x505S26512463x505
      verb
      1. to form (a string, ribbon, or lace) into a knot or bow: Rick bent to tie his shoelaces.
      2. to tie: he tied for second in the league | [with object] : Toronto tied the score in the fourth inning.
      noun
      1. a tie (noun sense 1a).
      Adam Frost{"video":"dominance: right;\\n\ud8d6\udc02\ud8fc\udc61\ud8d6\udc0a\ud8fc\udc61\ud8fc\udc07\ud8ed\udea1\ud8ed\udeed\ud8e1\udde7\ud8e1\uddf3.mov"} ya 33 e!)frost2021/01/06 17:50:352026/09/22 17:19:59AS1eb37S2fe00S10006S21d00M512x519S1eb37493x492S21d00489x482
      determiner, pronoun
      1. a small amount of: [as determiner] : we got a little help from my sister | [as pronoun] : you only see a little of what he can do.
      adverb
      1. to a small extent: he reminded me a little of my parents | I was always a little afraid of her.
      Adam Frost{"video":"dominance: right;\\n\ud8d6\udc58\ud8fc\udc61\u00d8\ud8da\udee1.mov"} ^Lb 33[ _!}frost2021/01/06 17:52:232026/09/22 18:00:28AS1ea40S2fe00S1ea48S2fe00S38007S23000S23010M527x537S1ea40502x485S1ea48475x516S23000502x464S23010473x495
      noun
      1. the activity of catching fish, either for food or as a sport: the area is renowned for its excellent deep-sea fishing | [as modifier] : fishing boats.
      verb
      1. to catch or try to catch fish, typically by using a net or hook and line: he was fishing for bluefish.
        • to try subtly or deviously to elicit a response or some information from someone: I was not fishing for compliments.
      Adam Frost{"video":"dominance: right;\\n\ud8d6\udc01\ud8fc\udc61\ud8d6\udc09\ud8fc\udc61\ud8fc\udc08\ud8dc\ude01\ud8dc\ude11.mov"}ten, typed, or printed communication, especially one sent in an envelope: he sent a letter to Mrs. Falconer.
    3. letters and packages conveyed by the postal system: I did not receive any mail.
      • [in singular] a single delivery or collection of mail: the new magazine that came in the mail today.
    4. a letter of an alphabet.
    USAGE
    This sign is conventionally distinguished as referring to a written communication or mail, while letter refers to a character of an alphabet. However, many signers also use this sign for an alphabetic character, and this usage is discouraged by some signers and in some instructional settings.
    Adam Frost{"video":"dominance: right;\\n\ud8d6\udfe3\ud8f5\udee1\ud8d6\udfeb\ud8fc\udc61\ud8d8\udde1\ud8db\udfc6\ud8d7\udc01\ud8d9\udf95\ud8d8\udde1.mov"} )%)xd 33i A!efrost2021/01/06 18:11:072026/09/22 18:05:06AS1ed17S31410S1ed1fS31420S20600S20600M536x529S2ff00482x483S1ed17510x489S1ed1f465x489S20600514x518S20600464x518
    noun
    1. a pair of lenses set in a frame, especially a rounded frame, that rests on the nose and ears, used to correct or assist poor eyesight or protect the eyes.
    Adam Frost{"video":"dominance: equal;\\n\ud8d6\udcf8\ud8f1\udf91\ud8d6\udd00\ud8f1\udfa1\ud8d8\ude41\ud8d8\ude41.mov"}Oc33[k!}frost2021/01/06 17:55:262026/09/22 18:03:52AS1eb50S2fe00S15a39S2fe00S21400S20e00S26507M525x522S15a39475x483S1eb50488x503S20e00500x492S26507512x479M527x523S15a39473x484S1eb50486x504S20e00498x493S26a07506x478
    verb
    1. to mark (letters, words, or other symbols) on a surface, typically paper, with a pen, pencil, or similar implement: he wrote his name on the paper | [no object] : he wrote very neatly in vve33C!!Mfrost2021/01/06 23:04:052026/09/22 18:16:49AS1ed10S30007S1ed18S30001S21800M546x518S2ff00482x483S1ed10520x486S1ed18454x486S21800517x476M546x518S2ff00482x483S1ed10520x486S1ed18454x486S21600522x476
      noun
      1. a device for taking photographs: she faced the cameras | a photographer's camera flashed.
      verb [frequentative]
      1. to take a picture.
      Adam Frost{"video":"dominance: right;\\n\ud8d6\udcf1\ud8f0\udc08\ud8d6\udcf9\ud8f0\udc02\ud8da\udd01.mov"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx            !!""##$$%%&&'' UU'f 33]s!frost2021/01/06 23:07:012026/09/23 16:43:05AS1f000S2fe00S10006M515x508S1f000486x493S38b00470x493 M515x508S1f010486x493 M515x508S1f020486x493 M515x512S1dc02485x488 M515x508S1f008486x493 S38b04470x493
      noun
      1. the seventh letter of the fingerspelling alphabet.
        • denoting the next after F in a set of items, categories, sizes, etc.
      PHONOLOGICAL VARIANTS
      G with knuckles facing upward
      G with palm facing forward
      G with thumb extended
      G left-handed
      Adam Frost{"video":"dominance: right;\\n\ud8d6\ude01\ud8fc\udc61\u00d8.mov"} QEg 335 _!frost2021/01/06 23:08:102026/09/23 16:44:01AS1f010S33d00S1f018S33d00S21100S21100S2880bS28813M569x524S33b00482x483S1f010503x499S1f018469x499S21100534x500S21100454x500S2880b549x504S28813431x504
      noun
      1. a strip of hair left to grow above the upper lip.
        • a growth similar to a moustache, or a marking that resembles one, around the mouth of some animals.
      Adam Frost{"video":"dominance: equal;\\n\ud8d6\ude11\ud8f5\udee1\ud8d6\ude19\ud8f5\udee1\ud8d9\ude61\ud8d9\ude61\ud8e4\udf0c\ud8e4\udf14.mov"} wh 33Qq!Ufrost2021/01/06 23:11:092026/09/23 16:51:49AS1f010S2fe00S10006S2e100M516x524S1f010485x509S2e100493x476M516x520S1f010485x505S2df08495x480
      noun
      1. the color or pigment between blue and yellow in the spectrum; colored like grass or emeralds: major roads are marked in green.
      adjective [in isolation]
      1. of the color green.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d6\ude11\ud8fc\udc61\u00d8\ud8ed\udc61.mov"} vi 33] !frost2021/01/06 23:12:182026/09/23 16:55:43AS1f051S2fe00S10006M515x512S1f051485x489
      noun
      1. the seventeenth letter of the fingerspelling alphabet.
        • denoting the next after P in a set of items, categories, sizes, etc.
      Adam Frost{"video":"dominance: right;\\n\ud8d6\ude52\ud8fc\udc61\u00d8.mov"} VV&j 335ok!ifrost2021/01/06 23:15:022026/09/23 16:57:21AS1f410S31410S1f418S31420S26a06S26a12S22114S22114M569x518S2ff00482x483S1f410540x491S1f418431x491S26a06522x485S26a12463x485S22114540x481S22114432x481M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M586x518S2ff00482x483S1f010507x489S1f018464x489S26a06540x483S26a12445x483S1f410557x489S1f418413x489 S38800464x496
      You might be looking for glasses.
      Adam Frost{"video":"dominance: right;\\nvisible: sign;"} FF6k 33 _!)frost2021/01/06 23:19:572026/09/23 16:58:23AS1f420S2fe00S10006S22114M517x513S1f420488x498S22114484x488
      number
      1. equivalent to the product of two and ten; ten less than thirty: twenty or thirty years ago | twenty of us stood and waited | a twenty-foot aerial.
      Adam Frost{"video":"dominance: right;\\n\ud8d6\udfa1\ud8fc\udc61\u00d8\ud8db\udc75.mov"} QQ~un 335 o!efrost2021/01/07 03:23:562026/09/30 17:41:59AS1f502S2fe00S1f50aS2fe00S21406S20600M516x519fm 33 1!-frost2021/01/07 03:18:282026/10/06 16:42:23AS1f502S33d00S1f50aS2fe00S20500S22a05S1f520S21414S20500M525x586S33b00482x483S1f502492x510S22a05498x537S1f50a493x562S1f520501x553
      noun
      1. a writHl 33C!o!ifrost2021/01/06 23:21:572026/09/23 17:00:03AS1f420S30007S10006S26504S22104M546x518S2ff00482x483S1f420517x486S26504526x458S22104519x477M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M546x518S2ff00482x483S1f020517x447S26504529x467S1f420517x486 S38800464x496
        You might be looking for Gallaudet.
        Adam Frost{"video":"dominance: right;\\nvisible: sign;"}S1f502501x482S1f50a485x482S20600490x508
        noun
        1. a form of play or sport, especially a competitive one played according to rules and decided by skill, strength, or luck.
          • (games) a meeting for sporting contests, especially track and field: the Olympic Games.
          • the equipment for a game, especially a board game or a video game.
        2. a complete episode or period of play, ending in a definite result: a baseball game.
        3. informal a type of activity or business regarded as a game: this was a game of shuttle diplomacy at which I had become adept.
          • a secret and clever plan or trick: I was on to his little game, but I didn't want him to know.
        Adam Frost{"video":"dominance: equal;\\n\ud8d6\udfe3\ud8fc\udc61\ud8d6\udfeb\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"}30x520S1f701509x480S1f709471x480S21100494x482S28804503x498S2881c486x498
        noun
        1. an outer garment extending either to the waist or the hips, typically having sleeves and a fastening down the front: she chose to wear a blue jacket with white stripes | [as modifier] : he put his hand in his jacket pocket.
        2. an outer garment worn outdoors, having sleeves and typically extending below the hips: a winter coat | [as modifier] : his coat pocket.
          • a man's jacket or tunic, especially as worn when hunting or by soldiers.
          • a man's or woman's tailored jacket: she wore a pale linen coat and skirt.
        verb
        1. to put on a jacket or coat.
        Adam Frost{"video":"dominance: equal;\\n\ud8d7\udca2\ud8fc\uddf8\ud8d7\udcaa\ud8fc\uddf2\ud8d9\ude61\ud8e4\udf05\ud8e4\udf1d.mov"} CC9o 33 W!-frost2021/01/07 03:28:532026/09/23 23:58:08AS1f520S30007S1f50aS2fe00S20500S22a04S1f520S21414S20500M537x554S2ff00482x483S1f520513x481S22a04523x502S1f50a505x530S1f520513x521
        verb
        1. to have in or to be able to bring to one's mind an awareness of (someone or something that one has seen, known, or experienced in the past): I remember the screech of the horn as the car came toward me | no one remembered his name.
          • [with infinitive] to do something that one has undertaken to do or that is necessary or advisable: did you remember to mail the letters?.
          • [with clause] used to emphasize the importance of what is asserted: you must remember that this is a secret.
        Adam Frost{"video":"dominance: right;\\n\ud8d7\udc01\ud8f0\udc08\ud8d6\udfeb\ud8fc\udc61\ud8d8\udde1\ud8db\udfc5\ud8d7\udc01\ud8d9\udf95\ud8d8\udde1.mov"} pp p33C1!Kfrost2021/01/07 03:36:132026/10/10 20:35:59AS1f540S2fe00S10006S18720M509x528S1f540492x472S18720491x499M521x521S18710480x492S2e008500x480 M523x518S1f540478x491S2a408498x482 M509x515S18720491x486
        number
        1. sixteen.
        ORIGIN
        a compound of ten and six.
        Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d7\udc21\ud8fc\udc61\u00d8\ud8cc\udec1.mov"} eeq33_+!Kfrost2021/01/07 03:38:492026/10/10 20:36:08AS1f540S2fe00S10006S1a520M511x528S1f540491x473S1a520490x500M523x520S1a510478x492S2e008502x480 S38a00464x490 M523x518S1f540478x491S2a408498x482 M511x514S1a520490x486
        number
        1. seventeen.
        ORIGIN
        a compound of ten and seven.
        Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d7\udc21\ud8fc\udc61\u00d8\ud8cf\ude01.mov"} wwr33_)!)frost2021/01/07 03:43:002026/10/10 20:36:16AS1f540S2fe00S10006S1bb20M511x528S1f540491x473S1bb20490x500M522x520S1bb10478x492S2e008501x480 S38a00464x490 M523x518S1f540478x491S2a408498x482 M511x514S1bb20490x486
        number
        1. eighteen.
        ORIGIN
        a compound of ten and eight.
        Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\u00d8\ud8d1\ude41.mov"} pp s33_7!)frost2021/01/07 03:47:542026/10/10 20:36:26AS1f540S2fe00S10006S1ce20M511x529S1f540490x472S1ce20489x499M522x522S1ce10478x492S2e008501x478 S38a00464x490 M523x518S1f540478x491S2a408498x482 M511x515S1ce20489x485
        number
        1. nineteen.
        ORIGIN
        a compound of ten and nine.
        Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\u00d8\ud8d3\udd61.mov"} *K*yv 33u g!}frost2021/01/07 15:31:002026/09/25 20:26:33AS1f701S38517S1f709S38511S21100S28804S2881cM5.u 33 O!)frost2021/01/07 03:57:222026/09/25 20:24:38AS1f540S2fe00S10006S2a408M523x518S1f540478x491S2a408498x482
        number
        1. equivalent to the product of five and two; one more than nine: the last ten years | the house comfortably sleeps ten | a ten-foot shrub.
        Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\u00d8\ud8e7\udd89.mov"}1t 33 U!)frost2021/03/03 21:01:202026/09/25 20:23:41AS10020S2fe00S10006S2ed09M512x519S10020488x489S2ed09493x481
        adverb
        1. and no one or nothing more besides; solely or exclusively: there are only a limited number of tickets available | only their faith sustained them.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ee\udcea.mov"} oneself with the means of subsistence: they live by hunting and fishing.
      2. to survive in someone's mind; to be remembered: only the name lived on.
      3. to have an exciting or fulfilling life: he couldn't wait to get out of school and really start living.
      4. [with adverbial] to make one's home in a particular place or with a particular person: I've lived in New England all my life | they lived with his grandparents.
      noun
      1. the condition that distinguishes animals and plants from inorganic matter, including the capacity for growth, reproduction, functional activity, and continual change preceding death: the origins of life.
        • living things and their activity: lower forms of life | the ice-cream vendors were the only signs of life | some sort of life existed on Mars.
      2. the existence of an individual human being or animal: a dis00464x496 M513x524S10000491x494S2ea06488x476 S38800464x496 S38a00464x490 S38b00470x493 M517x522S10008502x479S27112484x482 S38b04470x493pronoun
        1. an unknown or unspecified person: there's someone at the door | someone from the audience shouted out.
        2. a person of importance or authority: a small-time lawyer keen to be someone.
        determiner used to refer to someone or something that is unknown or unspecified: I was talking to some journalist the other day | there must be some mistake | he's in some kind of trouble.
        adjective having no one else present: she was alone in the room.
        adverb
        1. on one's own: he lives alone.
        2. always.

        PHONOLOGICAL VARIANTS
        someone left-handedAdam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8fc\udc61\u00d8\ud8e2\ude67.mov"}=adverb251> adverb [usually interrogative adverb]
        1. in what way or manner; by what means: how does it work? | he did not know how he ought to behave | [with infinitive] : he showed me how to adjust the focus.
        2. used to ask about the condition or quality of something: how was your vacation? | how did they play?.
          • used to ask about someone's physical or mental state: how are the children? | I asked how he was doing.
        3. [relative adverb] the way in which; that: she told us how she had lived out of a suitcase for a week.
          • in any way in which; however: I'll do business how I want.
        4. used to ask about the measurable quality of something: how long will it be? | I wasn't sure how fast I should go.
      Adam Frost{"video":"dominance: right;\\n\ud8d7\udcb1\ud8fc\udc61\ud8d7\udcb9\ud8fc\udc61\ud8d9\udf87\ud8d9\ude61\ud8ea\udd21.mov"}omething: what is your name? | I'm not sure what you mean..
      • asking for repetition of something not heard or confirmation of something not understood: what? I can't hear you | he said what?.
    2. [relative pronoun] the thing or things that (used in specifying something): take what you need.
      • (referring to the whole of an amount) whatever: I want to do what I can to make a difference.
    interrogative determiner
    1. asking for information specifying something: what time does class start? | do you know what excuse he gave me?.
    SIGN VARIATIONS
    what right-handed with 20-hand
    Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcb2\ud8fc\udc61\ud8c7\udcba\ud8fc\udc61\ud8fc\udc07\ud8e2\ude63\ud8e2\ude77.mov"} Zw33uM!}frost2021/01/07 15:40:182026/09/30 17:45:12AS1f702S38517S1f70aS38511S21100S22a00S22a10M527x519S1f70a474x499S1f702512x499S21100494x491S22a00513x481S22a10475x481M531x519S1f70a474x499S1f702511x499S20e00494x492S22f00506x482S22f10469x482
    verb [no object]
    1. to remain alive: I'll never forget it as long as I live | both cats lived to a ripe old age.
      • to be alive at a specified time: he lived four centuries ago.
      • to spend one's life in a particular way or under particular circumstances: people are living in fear in the wake of the shootings | [with object and adverbial] : he was living a life of luxury in Australia.
      • to supply ""Zx 33u a!}frost2021/01/07 15:45:542026/09/25 20:50:18AS1f704S38517S1f70cS38511S21100S22a04S22a14M529x518S1f70c472x483S1f704509x483S21100494x494S22a04515x503S22a14473x503
        noun
        1. a knitted garment typically with long sleeves, worn over the upper body: a close-knit wool sweater for icy weather.
        2. a loose, warm, long-sleeved top made of thick cotton, typically worn as leisurewear or sportswear.
        verb
        1. to put on or pull down a piece of clothing to cover the upper body.
        Adam Frost{"video":"dominance: equal;\\n\ud8d7\udca5\ud8fc\uddf8\ud8d7\udcad\ud8fc\uddf2\ud8d9\ude61\ud8db\udfc5\ud8db\udfd5.mov"} ;2y33[!frost2021/03/03 21:17:412026/09/25 20:51:34AS14c51S2fe00S20348S2fe00S21400S20e00S26a00M516x536S20348495x521S14c51485x496S20e00496x481S26a00489x465M514x537S20348497x522S14c51487x497S20e00498x482S26500497x464
        determiner, pronoun, adverb [in isolation]
        1. enough.
        Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udcd2\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc1.mov"} { 33A !}frost2021/01/07 15:58:252026/09/26 15:52:42AS1f710S2fe00S1f718S2fe00S21406S21100S2c300M522x521S1f710502x506S1f718479x506S2c300496x479
        pronoun
        1. [interrogative pronoun] what or which person or people: who is that woman? | I wonder who that letter was from.
        2. [relative pronoun] used to introduce a clause giving further information about a person or people previously mentioned: Joan Fontaine plays the mouse who married the playboy.
        Adam Frost{"video":"dominance: right;\\n\ud8d5\udc72\ud8f0\udc05\u00d8\ud8d8\udde1\ud8da\udd01.mov"}ion: where do you live? | [with preposition] : where do you come from? | where is she going?.
        • in what direction or respect: where does the argument lead?.
        • in or from what source: where did you read that?.
        • in or to what situation or condition: just where is all this leading us?.
    relative adverb
    1. at, in, or to which (used after reference to a place or situation): I first saw him in Paris, where I lived in the early sixties.
    2. the place or situation in which: this is where I live.
      • in or to a place or situation in which: sit where I can see you | where people were concerned, his threshold of boredom was low.
      • in or to any place in which; wherever: he was free to go where he liked.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8e2\ude67.mov"}S1f748479x493S1f740501x493
    preposition
    1. accompanied by (another person or thing): a nice steak with a bottle of red wine.
    2. possessing (something) as a feature or accompaniment: a flower-sprigged blouse with a white collar.
      • marked by or wearing: a small man with thick glasses | a tall dark man with a scar on one cheek.
    3. indicating the instrument used to perform an action: treatment with acid before analysis.
      • indicating the material used for some purpose: fill the bowl with water.
    4. indicating responsibility: leave it with me.
    5. in relation to: my father will be angry with me.
      • affected by (a particular fact or condition): with no hope | in bed with lumbago.
      • indicating the cause of an action or condition: trembling with fear | the paper was yellow with age.
      • because of (something) and as it T1| 33[Qe!}frost2021/01/07 16:03:052026/09/26 16:01:20AS14c31S2fe00S14c39S2fe00S38006S27102S27116M535x535S14c31509x465S14c39465x465S27102520x495S27116465x495M511x521S1f437489x491S22113492x479
        pronoun
        1. [interrogative pronoun] asking for information specifying s T;~ 33 i!)frost2021/01/07 16:11:352026/09/26 17:46:49AS10020S2fe00S10006S27106M517x522S10020484x479S27106502x482
          adverb
          1. in or to what place or posit(} 33] !frost2021/01/07 16:06:562026/09/26 16:11:54AS1f720S2fe00S10006M510x508S1f720490x493
            noun
            1. the first letter of the fingerspelling alphabet.
              • denoting the first in a set of items, categories, sizes, etc.
              • the highest class of academic mark: she got an A in biology.
              • the human blood type (in the ABO system) containing the A agglutinogen and lacking the B.
              • a playing card with a single spot on it, ranked as the highest card in its suit in most card games: the ace of diamonds.
            Adam Frost{"video":"dominance: right;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8.mov"} happens: wisdom comes with age.
    6. in the same direction as: marine mammals generally swim with the current.
    adverb
    1. with or in proximity to another person or people: together they climbed the dark stairs | they stood together in the kitchen.
      • in combination; collectively: they presented together.
    2. into companionship or close association: the experience has brought us together.
      • (of two people) married or in a sexual relationship with each other: they split up after ten years together.
      • so as to be united or in agreement: he won the confidence of the government and the rebels, but could not bring the two sides together.
    Adam Frost{"video":"dominance: equal;\\n\ud8d7\udce1\ud8fc\udc61\ud8d7\udce9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1.mov"} UU' 33[ !}frost2021/01/07 18:41:392026/09/26 17:48:27AS1f720S2fe00S1f728S2fe00S38006S29904S2991cM525x525S1f720505x475S1f728476x475S29904511x493S2991c476x493
    noun
    1. the external form, contours, or outline of someone or something: she liked the shape of his nose | houseplants come in all shapes and sizes | chest freezers are square or rectangular in shape.
      • a carved or cast figure of a person or animal, especially one that is life-size or larger.
    Adam Frost{"video":"dominance: equal;\\n\ud8d7\udcc1\ud8fc\udc61\ud8d7\udcc9\ud8fc\udc61\ud8fc\udc07\ud8e6\udd65\ud8e6\udd7d.mov"} 55G 33) !}frost2021/01/07 18:44:462026/09/26 17:49:24AS1f720S2fe00S10006S20320S1dc20M512x534S1f720492x466S20320497x485S1dc20488x504
    proper noun
    1. a sign language used primarily by Deaf communities in the United States and in much of Canada, excluding Quebec.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8d8\udd41\ud8d4\udea1.mov"} KK 33 [!efrost2021/01/07 18:49:192026/09/26 17:55:31AS1f740S2fe00S1f748S2fe00S21406S20500M521x508@33)c!frost2021/01/07 18:46:502026/09/26 17:51:41AS1f720S2fe00S10006S1dc20S26506M534x515S1f720467x500S1dc20491x485S26506519x501M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M512x542S1f720492x459S1dc20488x478S1dc20488x512 S38800464x496
    You might be looking for all.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\nvisible: sign;"}ond the rest of the body, such as the flexible extension of the backbone in a vertebrate, the feathers at the hind end of a bird, or a terminal appendage in an insect: the dog's tail began to wag frantically.
  • a thing resembling an animal's tail in its shape or position, typically something extending downward or outward at the end of something.
    • the rear part of an airplane, with the horizontal stabilizer and rudder: the fuselage tapers sharply toward the tail.
    • the luminous trail of particles following a comet.
  • informal a person secretly following another to observe their movements: I can't put a tail on him, I don't know where he's gone.
  • (tails) the reverse side of a coin (used when tossing a coin): the chances of heads and tails in the long run are equal.
    • Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d7\ude41\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8cd\udee1\ud8d4\udea1.mov"} everyone    .
  • employed by: it was a good firm to work for.
  • having (the thing mentioned) as a purpose or function: the necessary tools for making a picture frame | she is searching for enlightenment.
  • having (the thing mentioned) as a reason or cause: Aileen is proud of her family for their support | I could dance and sing for joy.
  • having (the place mentioned) as a destination: they are leaving for Swampscott tomorrow.
  • charged as (a price): copies are available for only a buck.
  • in relation to the expected norm of (something): she was tall for her age | warm weather for this time of year.
  • indicating the length of (a period of time): he was in prison for 12 years.
  • indicating the extent of (a distance): the camcorder failed for the third time.
    • Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f0\udc08\u00d8\ud8d8\udde1\ud8e4\udc69.mov"} q 33[ )!}frost2021/01/07 18:50:432026/09/26 17:57:40AS1f740S2fe00S1f748S2fe00S21406S20e00S22a00M521x525S1f740501x510S1f748479x499S20e00502x494S22a00502x476
    predeterminer
    1. greatest in amount, quantity, or degree; majority of a set: they've had the most success | most of my oranges are sweeter than these.
    pronoun
    1. the greatest amount or quantity: we had the most to lose | it's the most I can expect to accomplish in one day.
    adverb
    1. to the greatest extent: the things he enjoyed most | what she wanted most of all.
    Adam Frost{"video":"dominance: right;\\n\ud8d7\udce1\ud8fc\udc61\ud8d7\udce9\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8db\udfc1.mov"} nnz 33] '!frost2021/01/07 19:15:132026/09/27 15:59:03AS1fb20S2fe00S10006M508x510S1fb20493x491
    noun
    1. the twentieth letter of the fingerspelling alphabet.
      • denoting the next after S in a set of items, categories, sizes, etc.
    Adam Frost{"video":"dominance: right;\\n\ud8d7\ude41\ud8fc\udc61\u00d8.mov"} 33 a!Efrost2021/01/07 19:10:032026/09/27 15:57:15AS1f750S2fe00S1f738S2fe00S21400S20500S21800S21800S2a228S20500M528x523S1f738473x498S1f750481x487S21800485x477S21800475x515S2a228505x477
    verb
    1. to squeeze (something, typically paper or cloth) into a compact mass: he crumpled up the paper bag.
    Adam Frost{"video":"dominance: right;\\n\ud8d7\udcf1\ud8fc\udc61\ud8d7\udcd9\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8da\udd01\ud8da\udd01\ud8e7\udce9\ud8d8\udde1.mov"} MWM~ 33O E!frost2021/01/07 19:21:372026/09/30 17:37:56AS1fb20S2fe00S10006S1f720S19220S1dc20M515x548S1fb20494x453S1f720489x476S19220494x495S1dc20485x518
    noun
    1. the hindmost part of an animal, especially when prolonged bey% 33 !Wfrost2021/01/07 19:20:052026/09/27 16:01:10AS1fb20S2fe00S10006S10e20M508x527S1fb20493x474S10e20493x497
      noun
      1. a device that receives broadcast or streamed signals and reproduces them on a screen: a flat-screen TV | she turned the TV off.
      2. a system for transmitting visual images and sound that are reproduced on screens, chiefly used to broadcast programs for entertainment, information, and education: the days before TV | [as modifier] : a TV camera.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d7\ude41\ud8fc\udc61\u00d8\ud8c1\udd61.mov"}state in the northern central US; capital, Pierre.
    2. an industrial city and naval port on the Pacific coast of southern California, just north of the US-Mexico border.
    adjective
    1. relating to or characteristic of the US state of South Dakota or its inhabitants: South Dakotan news | [person implied] : a better future with more opportunities for every South Dakotan.
    2. relating to or characteristic of the US city of San Diego or its inhabitants: San Diegan lifestyle | [person implied] : as a San Diegan, he’s used to mild weather and ocean breezes.
    ORIGIN
    based on the fingerspelling of S and D.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8c0\udc81.mov"} ??= 33A [!}frost2021/01/07 19:24:262026/09/27 16:05:25AS20340S2fe00S20348S2fe00S21400S21100S2ea32M516x516S20340501x484S20348492x501S21100484x484
    noun
    1. a hot drink made from the roasted and ground seeds (coffee beans) of a tropical shrub: a cup of coffee | [as modifier] : a coffee pot.
      • a cup of coffee: she'll buy you a coffee.
      • coffee seeds raw, roasted and ground, or processed into a powder that dissolves in hot water: a jar of instant coffee.
    Adam Frost{"video":"dominance: right;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8ed\udff3.mov"} hX 33)k!A frost2021/01/07 19:28:202026/09/27 16:08:52AS20310S30004S10006S20500S21800M518x538S2ff00482x483S20310492x513S21800491x530M518x538S2ff00482x483S20310492x513S21600496x530
    noun
    1. a round juicy citrus fruit with a tough bright reddish-yellow rind: eat plenty of oranges | [mass noun] : a slice of orange.
    2. a bright reddish-yellow color like that of the skin of a ripe orange: tones of golden brown and orange | [count noun] : the most shocking of pinks and oranges.
    adjective [in isolation]
    1. of the color orange.
    Adam Frost{"video":"dominance: right;\\n\ud8d8\udd31\ud8f0\udc05\u00d8\ud8d8\udde1\ud8da\udd01.mov"}5S11a20492x495
    conjunction
    1. used to link alternatives: a cup of tea or coffee | are you coming or not? | I either take taxis or walk everywhere.
    2. introducing a synonym or explanation of a preceding word or phrase: the espionage novel, or, as it is known in the trade, the thriller.
    3. otherwise (used to introduce the consequences of something not being done or not being the case): hurry up, or you'll miss it all.
    4. introducing an afterthought, usually in the form of a question: John's indifference—or was it?—left her unsettled.
    noun
    1. a room in a hospital specially equipped for surgical operations.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: full (conjunction);\\nfingerspelled: abbreviated (noun);\\n\ud8cb\udc61\ud8fc\udc61\u00d8\ud8c2\udde1.mov"} <! 33) w!A frost2021/03/03 21:35:292026/09/27 16:11:46AS10011S30007S10006S20500S28108M537x521S2ff00482x483S10011516x491S28108516x463
    preposition
    1. in support of or in favor of (a person or policy): they voted for independence in a referendum.
    2. affecting, with regard to, or in respect of (someone or something): she is responsible for the efficient running of their department.
    3. on behalf of or to the benefit of (someone or something): these parents aren't speaking for  { 33] )! frost2021/01/07 19:34:452026/09/27 16:15:59AS20320S2fe00S10006M508x508S20320493x493
      noun
      1. the nineteenth letter of the fingerspelling alphabet.
        • denoting the next after R in a set of items, categories, sizes, etc.
      Adam Frost{"video":"dominance: right;\\n\ud8d8\udd41\ud8fc\udc61\u00d8.mov"}q 33)k!c frost2021/01/07 19:33:242026/09/27 16:14:38AS20310S2fe00S10006S26500S10040M508x534S20310493x519S26500494x500S10040493x466M508x535S20310493x520S26500494x501S11540493x466
      verb [center to front loci]
      1. a phonological variant (index hand) of throw.
      Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d8\udd31\ud8fc\udc61\u00d8\ud8e1\udde1\ud8c0\udc41.mov"}734505x482
      noun
      1. the time taken by the earth to make one revolution around the sun.
      2. (also calendar year or civil year) the period of 365 days (or 366 days in leap years) starting from the first of January, used for reckoning time in ordinary affairs.
        • a period of 365 days starting from any date: the year starting July 1.
        • [with adjective] a year regarded in terms of the quality of produce, typically wine: single-vineyard wine of a good year.
        • a period used for reckoning time according to other calendars: the Muslim year.
      3. a set of students grouped together as being of roughly similar ages, mostly entering a school or college in the same academic year: most of the girls in my year were leaving school at the end of the term.
      Adam Frost{"video":"dominance: right;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8ed\uded5\ud8d8\udde1.mov"} U 33c !e frost2021/01/07 19:37:332026/10/10 20:36:45AS20320S2fe00S10006S10120M508x525S20320492x476S10120492x495M508x508S20320493x493 M508x515S10120492x485
      proper noun
      1. a   33c_!efrost2021/01/07 19:49:462026/10/10 20:36:58AS20320S2fe00S10006S1ce20M511x525S20320490x476S1ce20489x495M508x508S20320493x493 M511x515S1ce20489x485
        proper noun
        1. a city and seaport in western California, on the coast, on a peninsula between the Pacific Ocean and San Francisco Bay.
        2. the capital of New Mexico, in the north central part of the state.
        ORIGIN
        based on the fingerspelling of S and F.
        Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8d3\udd61.mov"} A1 33[kK!}frost2021/01/07 20:02:562026/09/27 18:32:07AS20320S2fe00S20328S2fe00S38006S26a00S26a10M538x517S20320517x502S20328469x502S26a00511x484S26a10462x484M518x534S1f000483x466S19a20490x485S18d20492x509
        verb
        1. to engage in physical activity to sustain or improve health and fitness: they regularly walked, danced, ran and worked out at the gym | she still exercised every day.
        noun
        1. a session of vigorous physical exercise or training: John does daily workouts in the gym.
        2. a gym.
        Adam Frost{"video":"dominance: equal;\\n\ud8d8\udd41\ud8fc\udc61\ud8d8\udd49\ud8fc\udc61\ud8fc\udc07\ud8e1\udfc1\ud8e1\udfd1.mov"} ! 33 !)frost2021/01/07 20:05:462026/09/27 18:34:27AS20350S2fe00S10006S23004M513x519S20350493x482S23004488x501
        exclamation
        1. used to give an affirmative response: “Do you understand?” “Yes.”.
          • expressing agreement with a positive statement just made: “That was a grand evening.” “Yes, it was.”.
          • expressing contradiction of a negative statement: “You don't want to go.” “Yes, I do.”.
        noun
        1. an affirmative answer or decision, especially in voting: answering with assured and ardent yeses.
        Adam Frost{"video":"dominance: right;\\n\ud8d8\udd71\ud8fc\udc61\u00d8\ud8dc\ude05.mov"} OO- 33) !Afrost2021/01/07 20:13:352026/09/27 18:53:35AS20320S2fe00S10006S26500S14c20M512x535S20320493x520S26500493x501S14c20489x466
        verb [center to front loci]
        1. to cause to go or be taken to a particular destination; arrange for the delivery of, especially by mail: we sent a reminder letter but received no reply | [with two objects] : he sent her a nice little note.
        2. to propel (something) with force through air to a particular location by a movement of the arm and hand: I threw a brick through the window.
        3. to take something or someone to a designated place to be left there, typically temporarily: I need to drop off my clothes at the dry cleaners before work | I dropped the kids off at school this morning.
        Adam Frost{"video":"dominance: right;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8e1\udde1\ud8c7\udca1.mov"}r to achieve a result: she has been working so hard | an engineer who was working on a design for a more efficient wing | new contracts force employees to work longer hours.
        • to work in a specified job or field: he worked as a waiter in a rather shabby restaurant | Taylor has worked in education for 17 years | I work for Ford.
      noun
      1. a job or specific task involving effort or responsibility: he finished his work before the deadline.
        • mental or physical activity as a means of earning income: I'm still looking for work.
        • the place where one is employed: I was returning home from work on a packed subway.
        • the period of time one spends in paid employment: he was going to the theater after work.
      Adam Frost{"video":"dominance: right;\\n\ud8d8\udd41\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} hh 33'Um!ifrost2021/01/07 20:27:502026/09/28 14:57:27AS20330S2fe00S20338S2fe00S38006S22a00S22a10S21b00S21b00M533x523S20330518x508S20338468x508S22a00519x489S22a10469x489S21b00521x478S21b00471x478M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M538x534S20330518x519S20338468x519S22a00519x500S22a10469x500S14c30514x466S14c38463x466 S38800464x496
      You might be looking for how many.
      Adam Frost{"video":"dominance: equal;\\nvisible: sign;"} 33A m!}frost2021/01/07 20:26:162026/09/30 17:38:33AS20340S2fe00S20348S2fe00S21400S2e734S20500M521x518S20340487x487S20348480x503S2e!! 33 !!=frost2021/03/03 21:51:252026/09/30 17:42:55AS17620S2fe00S10006S11a20M508x525S17620492x47n id=noun285> noun
      1. a large public green area in a town, used for recreation: a walk around the park.
        • a large area of land kept in its natural state for public recreational use.
        • a large enclosed piece of ground, typically with woodland and pasture, attached to a large country house: the house is set in its own park.
        • (also wildlife park) a large enclosed area of land used to accommodate wild animals in captivity: penguin chicks are reared regularly at the park | a panda cub is drawing the crowds at a wildlife park.
        • a stadium or enclosed area used for sports.
        • (in the western US) a broad, flat, mostly open area in a mountainous region.
      2. [with adjective or noun modifier] an area devoted to a specified purpose: an industrial park.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udc52\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8c2\udde1\ud8c6\udc21.mov"} /# 33 9!)frost2021/01/07 20:30:422026/09/30 17:43:15AS20340S2fe00S10006S21800M509x514S20340493x499S21800491x486
    noun
    1. an opaque white fluid rich in fat and protein, secreted by female mammals for the nourishment of their young: a healthy mother will produce enough milk for her baby.
      • the milk from cows (or goats or sheep) as consumed by humans: a glass of milk.
    Adam Frost{"video":"dominance: right;\\n\ud8d8\udd61\ud8fc\udc61\u00d8\ud8da\udd01.mov"} v 335 q!efrost2021/01/07 20:31:482026/09/28 15:00:52AS20350S2fe00S20358S2fe00S21406S20600M516x515S20358484x500S20350501x500S20600489x486
    noun
    1. covering for the feet, typically made of leather, having a sturdy sole and not reaching above the ankle.
      • a single item of such covering: I lost a shoe.
    Adam Frost{"video":"dominance: equal;\\n\ud8d8\udd71\ud8fc\udc61\ud8d8\udd79\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"} E9Eh 335 U!efrost2021/01/07 20:40:292026/09/30 03:04:07AS20320S2fe00S2035aS2fe00S21400S20600M521x516S20320480x485S2035a490x501S20600499x486
    verb
    1. to be engaged in physical or mental activity in orde'C 33[ M!}frost2021/01/07 20:34:082026/09/28 15:10:55AS20350S2fe00S20358S2fe00S38006S2ea00S2ea4cM522x522S20350505x478S20358478x478S2ea00507x497S2ea4c480x497
      noun
      1. a vehicle composed of two wheels held in a frame one behind the other, propelled by pedals and steered with handlebars attached to the front wheel: the terrain is perfect for biking | a bike ride.
      verb
      1. to ride a bicycle: they had spent the day bicycling around the island.
      Adam Frost{"video":"dominance: right;\\n\ud8d8\udd71\ud8fc\udc61\ud8d8\udd79\ud8fc\udc61\ud8fc\udc07\ud8ed\udfc1\ud8ee\udc0d.mov"}2s direction: a bitter wind blew from the north | Mount Kenya is to the north of Nairobi.
      • the compass point corresponding to north: he drew a circle and marked north, south, east, and west.
      • a direction in space parallel to the earth's axis of rotation and toward the point on the celestial sphere around which the stars appear to turn counterclockwise.
    2. the northern part of the world or of a specified country, region, or town: cuisine from the north of Spain | limber pine in the central Rockies, and whitebark pine and alpine larch in the north.
      • (usually the North) the northern part of the US, especially the northeastern states that fought to preserve the Union during the Civil War: delegates from Virginia voted to join the North.
    adjective [attributive]
    1. lying toward, near, or facing the north: the north bank of the river | t YF 33 !)frost2021/01/07 21:53:342026/09/30 15:54:25AS14c50S2fe00S10006S2e732M513x526S14c50489x474S2e732488x510
      noun [at center locus]
      1. a region or part of a town, a country, or the world: rural areas of New Jersey | people living in the area are at risk.
        • [with modifier] a space allocated for a specific purpose: the dining area.
        • an area of land which is not occupied by buildings: she had a love of open spaces.
      adverb [at center locus]
      1. near or in the area around a place: there is little natural water hereabouts.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd1\ud8fc\udc61\u00d8\ud8ed\uded3.mov"} WWNs 33u q!frost2021/01/07 21:55:202026/09/30 15:55:08AS11502S2fe00S10006S19220S1dc20S1dc20S20320M518x563S11502482x438S19220497x457S1dc20488x480S1dc20488x514S20320497x548
      noun
      1. many naturally raised areas of land, not as high or craggy as a mountain: the road winds through the hills.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c1\udfe3\ud8fc\udc61\u00d8\ud8cd\udee1\ud8d4\udea1\ud8d4\udea1\ud8d8\udd41.mov"}. 335 a!efrost2021/01/07 21:59:052026/09/30 15:56:02AS18210S2fe00S18218S2fe00S38000S2b900M518x524S18218483x509S18210495x503S2b900491x476
      noun
      1. a terrain of low, smoothly rounded rises extending into the distance, not as high or rugged as a mountain.
      Adam Frost{"video":"dominance: right;\\n\ud8cc\udcd1\ud8fc\udc61\ud8cc\udcd9\ud8fc\udc61\ud8fc\udc01\ud8e9\udd61.mov"} ] 33W u! frost2021/01/07 22:02:452026/09/30 17:06:26AS1f751S2fe00S1f759S2fe00S21400S20500S14c20S2fe00S14c28S2fe00S38006S22a00S22a10M527x542S1f759489x509S1f751487x521S14c20504x477S14c28473x477S22a00509x459S22a10478x459
      noun
      1. a large natural elevation of the earth's surface rising abruptly from the surrounding level: the village is backed by awe-inspiring mountains | we set off down the mountain | [as modifier] : the ice and snow of a mountain peak.
        • a mountainous region characterized by remoteness and inaccessibility: they sought refuge in the mountains | (mountain as adjective) : his attempt to picture the mountain folk in ridiculous attire.
      Adam Frost{"video":"dominance: right;\\n\ud8d7\udcf2\ud8fc\udc61\ud8d7\udcfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8c7\udca1\ud8fc\udc61\ud8c7\udca9\ud8fc\udc61\ud8fc\udc07\ud8db\udfc1\ud8db\udfd1.mov"}  33O !frost2021/01/07 22:10:152026/09/30 17:39:27AS14051S2fe00S10006S1f720S11a20S14020M516x556S14051485x445S1f720493x473S11a20498x492S14020484x526 noun
      1. a shopping mall.
      2. a sheltered walk or promenade.
        • a section of a street, typically in the downtown area of a city, from which vehicular traffic is excluded.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cd\udd01\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8d4\udea1\ud8d4\udea1.mov"}he north door.
    • (of a wind) blowing from the north: they were sheltering from the north winds.
  • of or denoting the northern part of a specified area, city, or country or its inhabitants: North African.
  • situated in the north, or directed toward or facing the north: the northern slopes | northern Europe.
    • (of a wind) blowing from the northern region: the cliff protects the bay from the northern winds.
  • living in or originating from the north: northern breeds of cattle.
    • relating to or characteristic of the north or its inhabitants: an unmistakable northern accent.
    • adverb
    1. to or towards the north: the landscape became more dramatic as we drove north | my window faced north.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udd81\ud8fc\udc61\u00d8\ud8db\udfc1.mov"}4ection id=noun288> noun (usually the south)
    1. the direction toward the point of the horizon 90° clockwise from east, or the point on the horizon itself: the breeze came from the south | they trade with the countries to the south.
      • the compass point corresponding to south.
    2. the southern part of the world or of a specified country, region, or town: he was staying in the south of France.
      • (usually the South) the southern states of the US, especially the eleven states of the Confederacy during the Civil War (Alabama, Arkansas, Florida, Georgia, Louisiana, Mississippi, North Carolina, South Carolina, Tennessee, Texas, and Virginia): Paul grew up in the South in a Southern Baptist church.
    adjective [attributive]
    1. lying toward, near, or facing the south: the south coast.
      • (of a wind) blowing from the south.
    2. of or denoting the southern part of a specified area, city, or country or its inhabitants: Telegraph Hill in South Boston.
    3. situated in the south, or lying toward, near, or facing the south: the southern hemisphere.
      • (of a wind) blowing from the south: the warm southern wind.
    4. living in or originating from the south: the southern rural poor.
      • relating to or characteristic of the south or its inhabitants: a faintly southern accent.
    adverb
    1. to or toward the south: they journeyed south along the valley | it is handily located ten miles south of Baltimore.
    PHONOLOGICAL VARIANTS
    south with palm facing forward
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d8\udd22\ud8fc\udc61\u00d8\ud8db\udfc5.mov"} BT 33 o!Ufrost2021/01/07 22:21:302026/09/30 17:59:04AS11920S2fe00S10006S22a00M511x521S11920490x495S22a00497x479
    noun (usually the north)
    1. the direction in which a compass needle normally points, toward the horizon on the left-hand side of a person facing east, or the part of the horizon lying in thi-). 33 %!U frost2021/01/07 22:28:172026/09/30 17:59:14AS20301S2fe00S10006S22a04M511x520S20301490x481S22a04494x505S38b00470x493 M508x517S20320493x483S22a04494x502 S38b04470x493.
      • the western part of the United States, especially the states west of the Mississippi.
      • Europe and its culture seen in contrast to other civilizations: Aboriginal religion is closer to the Orient than the West.
      • [historical] the non-Communist states of Europe and North America, contrasted with the former Communist states of eastern Europe: Mr. Yeltsin was seen by the West as the driving force behind market reforms.
    2. a film, television drama, or novel about cowboys in western North America, set especially in the late 19th and early 20th centuries.
    adjective
    1. [attributive] lying toward, near, or facing the west: the west coast.
      • (of a wind) blowing from the west: the formation is caused by the prevalent west winds.
    2. of or denoting the western part of a specified area, city, or country or its inhabitants: West Africa.
    3. [attributive] situated in the west, or directed toward or facing the west: there will be showers in some western areas.
      • (of a wind) blowing from the western region.
    4. (usually Western) living in or originating from the West, in particular Europe or the United States: Western society.
      • relating to or characteristic of the West or its inhabitants: the history of Western art.
      • [historical] of or originating from the non-Communist states of Europe and North America in contrast to the Eastern bloc: the President threatened to end Western aid for an oil pipeline in Siberia.
    adverb
    1. to or toward the west: he faced west and watched the sunset | the accident happened a mile west of Bowes.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8e1\udde7.mov"}9son facing north, or the point on the horizon itself: a gale was blowing from the east | the Atlantic Ocean is to the east of Florida.
    • the compass point corresponding to east.
  • the eastern part of the world or of a specified country, region, or town: a factory in the east of the city.
    • (the East) the regions or countries lying to the east of Europe, especially China, Japan, and India: the protection of trade routes to the East.
    • (usually the East) the eastern part of the US from the Alleghenies on the west and north of the Mason–Dixon line: Pittsburgh beat up on the bottom three teams in the East.
    • (the East) [historical] the former communist states of eastern Europe: the centrally planned system of the East.
    • adjective
    1. lying toward, near, or facing the east: the hospital's east wing.
      • (of a wind) blowing from the east: a biting east wind.
    2. (often East) of or denoting the eastern part of a specified area, city, or country or its inhabitants: East Texas | East African.
    3. [attributive] situated in, directed towards, or facing the east: the eastern slopes of the mountain | eastern Long Island.
      • (of a wind) blowing from the eastern region.
    4. (usually Eastern) living in or originating from the east, in particular the regions or countries lying to the east of Europe: an Eastern monk.
      • relating to or characteristic of the East or its inhabitants: an eastern religion.
    adverb
    1. to or toward the east: traveling east, he met two men | the river rises east of the city.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udfe1\ud8fc\udc61\u00d8\ud8e1\udde7.mov"} uu{! 33 =!U!frost2021/01/07 22:35:412026/09/30 17:59:24AS18720S2fe00S10006S26506M518x515S18720482x486S26506503x501
    noun (usually the west)
    1. the direction toward the point of the horizon where the sun sets at the equinoxes, on the left-hand side of a person facing north, or the part of the horizon lying in this direction: the evening sun glowed from the west | a patrol aimed to create a diversion to the west of the city.
      • the compass point corresponding to west.
    2. the western part of the world or of a specified country, region, or town: it will becom6 5_$# 33 !U#frost2021/01/07 22:39:142026/10/01 17:17:03AS14a20S2fe00S10006S26506M517x508S14a20483x493S26506502x494
      noun (usually the east)
      1. the direction toward the point of the horizon where the sun rises at the equinoxes, on the right-hand side of a per8G" 33Q!U"frost2021/01/07 22:36:382026/09/30 18:01:01AS18700S2fe00S10006S26502M518x515S18700500x486S26502483x501M518x515S18720482x486S26506503x501
        adverb [right to left loci]
        1. to this direction to or towards the west.
        Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cc\udea1\ud8fc\udc61\u00d8\ud8e1\udde3.mov"}=noun293> noun
        1. a piece of furniture with a flat top and one or more legs, providing a level surface on which objects may be placed, and that can be used for such purposes as eating, writing, working, or playing games: she put the plate on the table.
          • (the table) a meeting place or forum for formal discussions held to settle an issue or dispute: the negotiating table.
        2. a piece of furniture with a flat or sloped surface and typically with drawers, at which one can read, write, or do other work.
          • a counter in a hotel, bank, or airport at which a customer may check in or obtain information: the reception desk.
          • [with modifier] a specified section of a news organization, especially a newspaper: he landed a job on the sports desk.
        3. the working surface of a desk.
          • (also desktop computer) a computer suitable for use at an ordinary desk: a new low-end desktop.
          • the working area of a computer screen regarded as a representation of a notional desktop and containing icons representing items such as files and a wastebasket: you can now have multiple, overlapping windows on the desktop.
        4. a small temporary tent or structure at a market, fair, or exhibition, used for selling goods, providing information, or staging shows: several dozen booths offered a wide variety of foods, craft items, and business information.
          • a small room where a vendor sits separated from customers by a window: a ticket booth.
        5. [usually in singular] the declared policy of a political party or group: seeking election on a platform of low taxes.
          • an opportunity to voice one's views or initiate action: the forum will provide a platform for discussion of communication issues.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd3\ud8fc\ude61\ud8c8\udddb\ud8fc\ude67\ud8d8\ude41.mov"} % 33C A!M%frost2021/01/07 22:52:082026/10/01 17:22:32AS15a12S38620S15a1aS38626S20600M539x513S15a1a512x501S15a12482x487S37806487x501S20600462x496
      You might be looking for floor/shelf.
      Adam Frost{"video":"dominance: equal;\\nvisible: sign;"}
      1. a small bowl-shaped container for drinking from, typically having a handle.
        • the contents of a cup: a strong cup of tea.
        • a measure of capacity used in cooking, equal to half a pint—that is, 8 ounces (0.237 l): one cup of butter.
        • (in church use) a chalice used at the Eucharist: Latin was replaced by the vernacular, and the cup was offered to the laity.
      2. a small steel or aluminum container in which food or drink is hermetically sealed for storage over long periods: soup cans.
      3. an ornamental trophy in the form of a cup, usually made of gold or silver and having a stem and two handles, awarded as a prize in a contest.
        • (Cup) a contest in which an ornamental trophy in the form of a cup is awarded: playing in the World Cup is the best thing ever.
    Adam Frost{"video":"dominance: right;\\n\ud8ca\udd21\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"}D1501x477S15a19476x477S23804520x498S2381c463x498
    noun
    1. a building for human habitation, especially one that is lived in by a family or small group of people: my wife and I are moving to a new house | [as modifier] : house prices.
      • the people living in a house; a household: do you want the whole house woken up?.
      • [with modifier] a building in which animals live or in which things are kept: a reptile house.
    2. a building in which people meet for a particular activity: a house of prayer.
      • a business or institution: a publishing house.
      • a restaurant or inn: [as modifier] : I ordered a bottle of their house wine.
      • a theater: a hundred musicians performed in front of a full house.
    3. a legislative or deliberative assembly: the sixty-member National Council, the country's upper house.
      • (the House) the House o Y& 33g!m!i&frost2021/01/07 23:00:152026/10/01 17:24:17AS15a50S2fe00S15a58S2fe00S21406S20600S2450aS24512M533x525S15a58486x476S15a50501x476S2450a502x507S24512467x507M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M533x522S14750501x478S14758484x478S2450a502x504S24512467x504 S38800464x496
        You might be looking for shelves.
        Adam Frost{"video":"dominance: equal;\\nvisible: sign;"} ' 33u I!}'frost2021/01/07 23:12:382026/10/02 06:00:25AS10010S38621S2035aS2fe00S20500S26502S20500M526x521S37806479x494S2035a511x488S10010489x491S26502487x480S20500475x481
        noun
        1. matter thrown away or rejected as worthless: the subway entrance was blocked with trash | these types of bulbs should not be thrown in the trash.
          • cultural items, ideas, or objects of poor quality: if they read at all, they read trash.
        2. derogatory a person or people regarded as being of very low social standing: she would have been considered trash.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc11\ud8fc\ude62\ud8d8\udd7b\ud8fc\udc61\ud8d8\udde1\ud8e1\udde3\ud8d8\udde1.mov"} ~m( 33[ !!}(frost2021/01/07 23:34:272026/10/02 06:01:48AS15a40S2fe00S15a48S2fe00S38005S26902S26916M524x526S15a40512x499S15a48476x474S26902491x507S26916491x482
        noun
        1. an object or space with typically four vertical flat surfaces.
        2. a part or division of a building enclosed by walls, floor, and ceiling: he wandered from room to room.
          • the people present in a room: the whole room burst into an uproar of approval.
        3. a container with a flat base and sides, typically square or rectangular and having a lid: a cereal box | a hat box.
          • the contents of a box: she ate a whole box of chocolates that night.
        Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc06\ud8e1\udf63\ud8e1\udf77.mov"}f Representatives: the government commanded an overall majority in the House.
    4. Astrology any of the twelve divisions of the celestial sphere, based on the positions of the ascendant and midheaven at a given time and place, and determined by any of a number of methods.
      • a celestial division represented as a sector on an astrological chart, used in allocating elements of character and circumstance to different spheres of human life.
    adjective [attributive]
    1. (of an animal or plant) kept in, frequenting, or infesting buildings.
    2. relating to a business, institution, or society: a house journal.
      • (of a band or group) resident or regularly performing in a club or other venue: the house band.
    Adam Frost{"video":"dominance: equal;\\n\ud8c8\uddd2\ud8fc\udc61\ud8c8\uddda\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8dd\udd05\ud8dd\udd1d.mov"} MNM}*33i!*frost2021/01/08 15:27:162026/10/02 06:09:22AS16d10S38507S16d18S38501S20600S20600M532x520S36d00479x501S16d10515x481S20600510x509S16d18468x481S20600468x509M533x517S16d0a470x483S16d02510x483S20e00494x499S22f04508x503S22f14467x503
    noun
    1. a backpack.
    Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8ca\udcf1\ud8fc\udde8\ud8ca\udcf9\ud8fc\udde2\ud8d8\ude41\ud8d8\ude41.mov"}&) 335 Q!e)frost2021/01/08 15:22:492026/10/02 06:06:34AS16d40S2fe00S15a39S2fe00S21400S20600M517x520S15a39494x480S16d40484x487S20600485x509
    noun? }+33i!+frost2021/01/08 15:27:412026/10/02 06:11:06AS15411S38507S15419S38501S20600S20600M538x518S36d00479x499S15411514x483S20600512x507S15419462x483S20600467x507M533x517S16d0a470x483S16d02510x483S20e00494x499S22f04508x503S22f14467x503
    noun
    1. a backpack.
    Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8c7\udf92\ud8fc\udde8\ud8c7\udf9a\ud8fc\udde2\ud8d8\ude41\ud8d8\ude41.mov"} O@,33u3!},frost2021/01/08 15:40:082026/10/02 06:15:08AS16d02S38517S16d0aS38511S20e00S22f04S22f14M533x517S16d0a470x483S16d02510x483S20e00494x499S22f04508x503S22f14467x503M532x520S36d00479x501S16d10515x481S20600510x509S16d18468x481S20600468x509 M538x518S36d00479x499S15411514x483S20600512x507S15419462x483S20600467x507
    noun
    1. a bag with shoulder straps that allow it to be carried on one's back.
    SIGN VARIATIONS
    backpack on shoulders
    backpack with claw-hands
    Adam Frost{"video":"dominance: equal;\\n\ud8ca\udce3\ud8fc\uddf8\ud8ca\udceb\ud8fc\uddf2\ud8d9\udd41\ud8dc\udda5\ud8dc\uddb5.mov"} XX$- 33Q;!K-frost2021/01/08 15:48:322026/10/03 18:55:47AS19a02S30006S10006S20600M533x529S2ff00482x483S19a02513x490S20600505x518M533x518S2ff00482x483S19a02513x490
    noun [in isolation]
    1. a phone.
    Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8ce\uddc3\ud8f0\udc07\u00d8\ud8d8\ude41.mov"} P>.33C_C!A.frost2021/01/08 15:56:162026/10/03 19:11:51AS11500S30004S10006S20e00S22f04M532x546S2ff00482x483S11500489x510S20e00513x517S22f04507x532M523x546S2ff00482x483S11500489x510S20e00510x516S22a04510x531 M561x538S2ff00482x483S10011516x508S2c400521x490 M532x546S2ff00482x483S15a00494x510S20e00513x517S22f04507x532
    adjective [in isolation]
    1. cute.
    noun [regional]
    1. candy.
      • sugar (noun sense 1).
    Adam Frost{"video":"dominance: right;\\n\ud8c1\udfe1\ud8f0\udc05\u00d8\ud8d9\udd41\ud8dc\udda5.mov"} cT/33[u!}/frost2021/01/08 16:01:322026/10/03 19:18:03AS1eb50S2fe00S15a39S2fe00S21400S20e00S26a07M527x523S15a39473x484S1eb50486x504S20e00498x493S26a07506x478M525x522S15a39475x483S1eb50488x503S20e00500x492S26507512x479
    verb [frequentative]
    1. to write.
    noun
    1. an instrument for writing.
    Adam Frost{"video":"dominance: right;\\n\ud8d6\udc71\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc8.mov"} p1 33g !1frost2021/01/08 16:12:252026/10/03 19:24:49AS15a11S2fe00S15a19S2fe00S21406S20500S23804S2381cM537x523S15a1@x033=1!)0frost2021/01/08 16:07:082026/10/03 19:20:39AS18527S2fe00S10006S2b700M511x526S18527492x499S2b700490x475S38b00470x493 M525x526S18527506x499S1852f475x499S2b700504x475S2b711478x475 S38b04470x493
    verb [center to front loci]
    1. to move to or place (something) in a location: watch where you're putting your feet!.
    PHONOLOGICAL VARIANTS
    put two-handed
    Adam Frost{"video":"dominance: right;\\n\ud8cc\ude08\ud8fc\udc61\u00d8\ud8e9\udca1.mov"}Mt that metal rail thing over there     | there are lots of things I'd like to buy | she was wearing this pink thing.
    • (things) personal belongings or clothing: she began to unpack her things.
    • (things) [with adjective or noun modifier] equipment, utensils, or other objects used for a particular purpose: they cleared away the lunch things.
  • an inanimate material object as distinct from a living sentient being: I'm not a thing, not a work of art to be cherished.
    • [with adjective] a living creature or plant: the sea is the primal source of all living things on earth.
  • an action, activity, event, thought, or utterance: she said the first thing that came into her head | the only thing I could do well was cook.
    • (things) circumstances, conditions, or matters that are unspecified: things haven't gone entirely according to plan | how are things with you?.
    • an abstract entity, quality, or concept: mourning and depression are not the same thing | they had one thing in common—they were men of action.
    • an example or type of something: the game is the latest thing in family fun.
    • [with adjective or noun modifier] informal a situation or activity of a specified type or quality: your being here is just a friendship thing, OK?.
  • (one's thing) informal one's special interest or concern: reading isn't my thing.
  • (the thing) informal used to introduce or emphasize an important point: the thing is, I am going to sell this house | here's the thing: this is a story, not a piece of hard news | that's the thing about style—no two people are completely alike.
    • Adam Frost{"video":"dominance: right;\\n\ud8c8\uddf2\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e5\udecb.mov"} //M2 33) ?!Q2frost2021/01/08 16:15:262026/10/03 19:28:21AS1f720S2fe00S10006S14051S1fb20M516x533S1f720493x467S14051485x486S1fb20498x514
    noun
    1. a suite of rooms forming one residence, typically in a building containing a number of these.
      • a large building containing residential suites; an apartment building.
    adjective
    1. appropriate or suitable in the circumstances: an apt description of her nature.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated (noun);\\nfingerspelled: full (adjective);\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8c6\udc52\ud8d7\ude41.mov"} FF63 33O 7!3frost2021/01/08 16:18:112026/10/03 19:30:01AS10110S30005S10006S20500S26504S20500M544x528S2ff00482x483S10110511x493S26504530x499S20500532x517
    noun
    1. a large bedroom for a number of people in a school or institution: he visited the boarders in their dormitory.
      • a university or college hall of residence or hostel: many students opt to drive home rather than stay in the dorms on weekends | [as modifier] : his dorm room was right next to mine.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c0\udc71\ud8f0\udc06\u00d8\ud8d8\udde1\ud8e1\udde5\ud8d8\udde1.mov"}number of quantities: the average temperature in May was 64°F.
    • of the usual or ordinary standard, level, or quantity: a woman of average height.
    • having qualities that are seen as typical of a particular person or thing: the average teenager prefers comfort to high fashion.
    • not very good: a very average director who made very average movies.
    noun
    1. a number expressing the central or typical value in a set of data, in particular the mode, median, or (most commonly) the mean, which is calculated by dividing the sum of the values in the set by their number: the housing prices there are twice the national average.
      • an amount, standard, level, or rate regarded as usual or ordinary: the month's snowfall is below average.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd1\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8d9\udf95\ud8d8\ude41.mov"}e hands of various writers    .
  • to acknowledge the existence, validity, or legality of: the defense is recognized in Mexican law | he was recognized as an international authority | [with clause] : it is important to recognize that a variety of indirect forms of discrimination operate.
    • to show official appreciation of; reward formally: his work was recognized by an honorary degree from Georgetown University.
    • to officially regard (a qualification) as valid or proper: these qualifications are recognized by the Department of Education.
    • to grant diplomatic recognition to (a country or government): they were refusing to recognize the puppet regime.
    • (of a person presiding at a meeting or debate) to call on (someone) to speak.
    • Adam Frost{"video":"dominance: right;\\n\ud8c0\ude42\ud8f1\udf91\ud8c8\uddfa\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8c0\ude91\ud8d9\udf81\ud8d8\udde1.mov"} 00+5 33)QG!A5frost2021/03/03 22:13:572026/10/03 19:38:49AS10601S30005S10006S20500S21800M541x534S2ff00482x483S10601513x506S21800523x498M536x534S2ff00482x483S10601513x506
    adverb [in isolation]
    1. recently.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\ude42\ud8f0\udc06\u00d8\ud8d8\udde1\ud8da\udd01.mov"}4 33A !}4frost2021/03/03 22:11:092026/10/03 19:36:50AS15a31S2fe00S15a39S2fe00S21400S20500S2920aM532x516S15a39468x484S15a31483x493S2920a501x485
    noun
    1. something that one need not, cannot, or does not wish to give a specific name to: look aL35x541S14c30509x459S14c38467x459S22a04514x492S22a14473x492S14e30509x510S14e38465x510 S38b04470x493 S38a00464x490 M535x521S14e30509x490S14e38465x490S21800511x480S21800472x480
      verb [with object]
      1. to feel a preference or need to have or do (something): I want an apple | [with infinitive] : we want to go to the beach | [with object and infinitive] : she wanted me to go to her room | [no object] : I'll give you a lift into town if you want.
      PHONOLOGICAL VARIANTS
      want with downward movement
      INFLECTED FORMS
      want [continuative]
      Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcb1\ud8fc\udc61\ud8c7\udcb9\ud8fc\udc61\ud8fc\udc07\ud8e1\udde5\ud8e1\uddf5\ud8c7\udd71\ud8c7\udd79.mov"} gg 6 335 !e6frost2021/01/08 16:43:462026/10/03 19:48:41AS15a10S2fe00S15a1aS2fe00S21414S20600M520x518S15a1a481x497S15a10487x491S20600498x483
      adjective
      1. about halfway between two extreme qualities: John is six feet tall, moderate build.
      2. constituting the result obtained by adding together several quantities and then dividing this total by the PX532x517S15a16505x505S1821d503x492S20e00491x495S2880f468x484M532x522S15a16505x510S1821d503x497S20e00491x500S2880f468x501S2880f468x479
        adjective
        1. not existing before; made, introduced, or discovered recently or now for the first time: new crop varieties | this tendency is not new | (the new as noun) : a fascinating mix of the old and the new.
          • not previously used or owned: a secondhand bus cost a fraction of a new one.
          • of recent origin or arrival: a new baby.
        2. already existing but seen, experienced, or acquired recently or now for the first time: her new bike.
          • (new to) [predicative] unfamiliar or strange to (someone): a way of living that was new to me.
          • (new to/at) [predicative] (of a person) inexperienced at or unaccustomed to doing (something): I'm quite new to gardening.
          • different from a recent previous one TT 7 33 %!-7frost2021/03/03 22:24:452026/10/06 18:34:03AS10601S31410S15a39S2fe00S20500S22a03S10650S21400S20500M527x561S2ff00482x483S10601504x496S22a03505x525S15a39478x524S10650486x535
            verb [with object]
            1. to become aware of: he noticed the youths behaving suspiciously | [with clause] : I noticed that she was looking tired.
            2. to identify (someone or something) from having encountered them before; to know again: Julia hardly recognized Jill when they met | one of the librarians recognized her from the photograph.
              • to identify from knowledge of appearance or character: Pat is very good at recognizing wildflowers.
              • (of a computer or other machine) to automatically identify and respond correctly to (a sound, printed character, etc.): Dr. Friedman is programming his computer to recognize the shapes of strokes in thQ T933'w!-9frost2021/03/03 22:28:242026/10/06 19:29:36AS14c30S2fe00S14c38S2fe00S38006S26504S26514S14e30S14e38M535x541S14c30509x459S14c38467x459S26504514x492S26514472x492S14e30509x510S14e38465x510S38b00470x493 M5S[8 33[ }!}8frost2021/01/08 17:08:142026/10/06 19:26:27AS15a10S2fe00S15a18S2fe00S38006S26502S26516M545x514S15a10514x487S15a18474x487S26502530x495S26516455x495
                adjective
                1. of a size that is less than normal or usual: the room was small and quiet | the small hill that sheltered the house.
                  • not great in amount, number, strength, or power: a rather small amount of money.
                Adam Frost{"video":"dominance: equal;\\n\ud8c8\uddd1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8fc\udc07\ud8e1\udde3\ud8e1\uddf7.mov"}: I have a new assistant | this would be her new home.
              • in addition to another or others already existing: recruiting new pilots overseas.
            3. just beginning or beginning anew and regarded as better than what went before: starting a new life | the new South Africa.
              • (of a person) reinvigorated or restored: a bottle of pills would make him a new man.
              • superseding another or others of the same kind, and advanced in method or theory: the new architecture.
              • reviving another or others of the same kind: the New Bohemians.
            INFLECTED FORMS
            new [in isolation]
            Adam Frost{"video":"dominance: right;\\n\ud8cc\udcde\ud8fc\udc61\ud8c8\uddd7\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e4\udf10.mov"} &G&1; 33 -!);frost2021/03/03 22:50:282026/10/06 22:09:49AS10620S2fe00S10006S21800M514x519S10620493x493S21800487x482
            exclamation
            1. used in questions to invite agreement or to express a lack of understanding: pretty devastating, huh?.
            interrogative particle
            1. used to mark a binary question: are you ok?.
            Adam Frost{"video":"dominance: right;\\n\ud8c0\ude61\ud8fc\udc61\u00d8\ud8da\udd01.mov"}5: 33) !A:frost2021/03/03 22:34:102026/10/06 21:49:47AS11010S30005S10006S20500S22f00M545x537S2ff00482x483S11010510x510S22f00520x495
            noun
            1. a soft, flavored candy for chewing, typically sold in packets of individually wrapped thin strips: I always have gum in my pocket.
            Adam Frost{"video":"dominance: right;\\n\ud8c1\ude11\ud8f0\udc06\u00d8\ud8d8\udde1\ud8dc\udda1.mov"} 7.<33gc!7 noun
            1. a phonological variant (extended thumb) of rabbit.
        Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c4\udd12\ud8fc\udc61\ud8c4\udd1a\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1\ud8db\udc75\ud8db\udc75.mov"} hht >33[M!}>frost2021/01/08 17:37:412026/10/07 16:04:48AS1821dS2fe00S15a16S2fe00S21400S20e00S2880fMU%=33[u!=frost2021/01/08 17:26:172026/10/07 15:57:10AS1e140S2fe00S1e148S2fe00S38006S2880aS28812M559x513S1e140511x487S1e148465x487S2880a537x494S28812441x494M536x525S1e140512x475S1e148466x475S28805516x505S2881d465x505
        adjective
        1. a phonological variant (upward movement) of big.
        Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8d5\udca1\ud8fc\udc61\ud8d5\udca9\ud8fc\udc61\ud8fc\udc07\ud8e4\udf0b\ud8e4\udf13.mov"}tely sent to the battlefront        .
        • [often in names] an organized political group: the Palestinian Liberation Front.
        • Meteorology the forward edge of an advancing mass of air. See cold front, occluded front, warm front.
      3. [in singular] an appearance or form of behavior assumed by a person to conceal their genuine feelings: she put on a brave front.
        • a person or organization serving as a cover for subversive or illegal activities: the CIA identified the company as a front for a terrorist group.
      adjective [attributive]
      1. of or at the front: the front cover of the magazine | she was in the front yard.
      2. Phonetics (of a vowel sound) formed by raising the tongue, excluding the blade and tip, toward the hard palate.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8ef\udfa1\u00d8\ud8db\udfc5.mov"}| computers first appeared in offices in the late 1970s.
      • the local center of a large business: a company that has four U.S. and four European offices.
      • a room, department, or building used to provide a particular service: a ticket office.
      • the consulting room of a professional person: a patient walks in to a doctor's office.
    2. a position of authority or service, typically one of a public nature: the office of attorney general.
      • tenure of an official position, especially a government position: a year ago, when the President took office | he was ejected from office in 1988.
    SIGN VARIATIONS
    office with O-hands
    Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cb\udc61\ud8fc\udc61\u00d8\ud8d3\udd61\ud8d3\udd61\ud8cd\udee1\ud8ca\udd01\ud8c6\udfe1.mov"} 3)? 33A 3!}?frost2021/03/17 16:50:332026/10/07 16:10:16AS10012S2fe00S15a18S2fe00S21406S20500S26a20M521x525S15a18480x493S10012491x510S26a20484x475
    noun
    1. a thing characteristic of its kind or illustrating a general rule: it's a good example of how European action can produce results | some of these carpets are among the finest examples of the period.
    2. a person or thing regarded in terms of their fitness to be imitated or the likelihood of their being imitated: it is vitally important that parents should set an example | she followed her brother's example and deserted her family.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\udfe1.mov"}    A 33) I!AAfrost2021/03/28 18:07:222026/10/08 06:08:56AS10011S30007S10006S20600S28208M537x521S2ff00482x483S10011516x491S28208516x462
    interrogative adverb
    1. for what reason or purpose; what for: why did he do it?.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f0\udc08\u00d8\ud8d8\ude41\ud8e4\udcc9.mov"}L@ 33O!k!i@frost2021/01/08 17:49:172026/10/07 16:11:55AS20310S30004S10006S20500S21600S22a04M518x556S2ff00482x483S20310492x513S21600496x530S22a04494x541M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M518x572S2ff00482x483S15410494x510S22a04495x539S20310494x557 S38800464x496
    You might be looking for old/age.
    Adam Frost{"video":"dominance: right;\\nvisible: sign;"} LL0B 33[ '!}Bfrost2021/07/13 16:00:162026/10/08 17:54:58AS1f540S2fe00S1f548S2fe00S38006S23600S23614M542x522S1f540515x478S1f548470x478S23600503x505S23614458x504
    interrogative pronoun, determiner
    1. asking for information specifying one or more people or things from a definite set: [as pronoun] : which are the best varieties of grapes for long keeping? | which of the suspects murdered him? | [as determiner] : which book is your favorite?.
    Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8d7\udc29\ud8fc\udc61\ud8fc\udc07\ud8dd\udc41\ud8dd\udc55.mov"} uu"D 33A !}Dfrost2021/03/28 19:01:012026/05/02 18:55:00AS18210S2fe00S18218S2fe00S21400S20500S22a00M520x520S18218481x505S18210497x499S22a00503x480Adam Frost{"video":"dominance: right;\\n\ud8cc\udcd1\ud8fc\udc61\ud8cc\udcd9\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8db\udfc1.mov"}nC 33O %!Cfrost2021/03/28 18:57:582026/10/08 18:00:50AS1ce20S2fe00S10006S14a20S14a20S1fb20M511x546S1ce20489x455S14a20490x489S14a20490x508S1fb20490x527
    noun
    1. the lower extremities of the legs below the ankle, on which a person stands or walks.
      • the corresponding parts of the legs in vertebrate animals.
    2. a unit of linear measure in multiples of 12 inches: the water was only a few feet deep.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d3\udd61\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8c6\udfe1\ud8d7\ude41.mov"} , E 33[ !}Efrost2021/03/28 19:04:002026/10/08 18:02:45AS15a40S2fe00S15a48S2fe00S38006S26506S26512M538x514S15a48482x487S15a40506x487S26506523x494S26512462x494
    adjective
    1. of great or more than average width: a wide road.
      • (after a measurement and in questions) from side to side: it measures 15 cm long by 12 cm wide.
    Adam Frost{"video":"dominance: equal;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc07\ud8e1\udde7\ud8e1\uddf3.mov"} mF 33 !iFfrost2021/01/08 18:53:482026/10/08 18:04:19AS1fb20S2fe00S10006S27106M517x520S1fb20483x488S27106502x480
    noun
    1. a room containing a toilet and sink and typically also a bathtub or shower.
      • a set of matching fixtures to be fitted in a bathroom, especially as sold together: we're doing the whole place out and I've just bought a new bathroom and kitchen.
      • a public room or compartment with a toilet and washbasin: I have to go to the bathroom.
    2. a toilet.
    Adam Frost{"video":"dominance: right;\\nletter: integrated (sense 2);\\n\ud8d7\ude41\ud8fc\udc61\u00d8\ud8e2\ude67.mov"}icals, and online resources for people to read, borrow, or refer to: a school library | [as modifier] : a library book.
    • a collection of books and periodicals held in a library: the Institute houses an outstanding library of 35,000 volumes on the fine arts.
    • a room in a private house where books are kept: there was a library that Uncle Hilbert used as his study.
    • a series of books, recordings, etc., issued by the same company and similar in appearance.
    • a collection of films, recorded music, genetic material, etc., organized systematically and kept for research or borrowing: a record library.
    • Computing (also software library) a collection of programs and software packages made generally available: download any of thousands of programs from our software libraries.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8ed\uddef.mov"} `G 33 !)Gfrost2021/01/08 19:02:412026/10/08 18:47:45AS15a02S2ff00S10006S22a04M518x527S2ff00482x483S15a02485x497S22a04494x512
    noun
    1. the side or part of an object that presents itself to view or that is normally seen or used first; the most forward part of something: he sealed the envelope and wrote on the front.
      • [in singular] the position directly ahead of someone or something; the most forward position or place: she quickly turned her head to face the front.
      • the forward-facing part of a person's body, on the opposite side to their back: she rolled over onto her front.
    2. the foremost line or part of an armed force; the furthest position that an army has reached and where the enemy is or may be engaged: [with modifier] : his regiment was immedia\li>the components of a machine: the movement of the machinery.
    adjective
    1. working or produced by machines or machinery: a mechanical device.
      • relating to machines or machinery: a mechanical genius | mechanical failure.
    2. (of a person or action) not having or showing thought or spontaneity; automatic: she stopped the mechanical brushing of her hair.
    adverb
    1. by means of a machine or machinery: the rice is harvested mechanically | a mechanically propelled vehicle.
      • in a way that relates to machines or machinery: the car is almost guaranteed not to fail mechanically | I'm mechanically inclined and I know how to work things.
    Adam Frost{"video":"dominance: left;\\n\ud8c7\udd43\ud8fc\udc61\ud8c7\udd4b\ud8fc\udc61\ud8d9\udf87\ud8d8\udea1\ud8dd\udc65.mov"} ]>]UI 33 q!UIfrost2021/01/08 19:11:442026/10/08 21:28:38AS1dc20S2fe00S10006S2e50eM528x515S1dc20473x485S2e50e501x489
    noun
    1. a building or room containing collections of books, periodd6H33?!7Hfrost2021/01/08 19:08:252026/10/08 21:24:41AS17620S2fe00S10006S1ce20S1ce20S19220S16d20S14a20M511x575S17620490x425S1ce20489x445S1ce20489x479S19220490x513S16d20489x536S14a20490x560M528x521S17640512x505S17648473x480S26902491x505S26916491x480
      noun
      1. a room, set of rooms, or building used as a place for commercial, professional, or bureaucratic work: [as modifier] : an office job ]15x563S1dc20485x437S17620494x471S14720495x491S14720495x517S19a20487x543
        noun
        1. a room providing a space out of which one or more other rooms or corridors lead, typically one near the entrance of a public building: they went into the hotel lobby.
        2. a group of people seeking to influence politicians or public officials on a particular issue: contact an anti-traffic lobby for advice and information | [as modifier] : lobby groups.
        verb [with object]
        1. to seek to influence (a politician or public official) on an issue: it is recommending that booksellers lobby their representatives | [no object] : a group lobbying for better rail services.
        Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8cb\udc61\ud8c6\udec1\ud8c6\udec1\ud8ce\udde1.mov"} 1(J33[!}Jfrost2021/01/08 19:14:432026/10/08 21:35:51AS18521S2fe00S18529S2fe00S38006S2d300S2d311M543x523S18521510x504S18529464x504S2d300504x477S2d311458x477M537x523S18521510x504S18529464x504S2d200502x477S2d211473x477
        noun
        1. a retail establishment selling items to the public: a health-food store.
        Adam Frost{"video":"dominance: equal;\\n\ud8cc\ude02\ud8fc\udc61\ud8cc\ude0a\ud8fc\udc61\ud8fc\udc07\ud8eb\udf21\ud8eb\udf32.mov"}70x475S2d50a511x510S2d512470x510M525x518S1f550501x482S1f558475x482S2d50a506x502S2d512475x502
        noun
        1. a particular position or point in space: the monastery was a peaceful place | there were still some remote places in the world | that street was no place for a lady.
          • a particular point on a larger surface or in a larger object or area: I cut my hand in three places.
          • a building or area used for a specified purpose or activity: the town has many excellent eating places.
          • informal a person's home: what about dinner at my place?.
        SIGN VARIATIONS
        place (noun sense 2) with A-hands
        Adam Frost{"video":"dominance: equal;\\nletter: integrated;\\n\ud8c6\udc41\ud8fc\udc61\ud8c6\udc49\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8eb\udfeb\ud8eb\udff3\ud8d8\udde1.mov"} ``K 33A !{Kfrost2021/01/08 19:21:462026/10/09 00:24:26AS14e02S2fe00S14e0aS2fe00S21406S20700S23624M530x526S14e02499x481S14e0a470x475S23624480x509
        noun
        1. a piece of technical equipment using or transmitting power and having several parts, each with a definite function and together performing a particular task: a fax machine | a shredding machine.
          • [with modifier] a coin-operated dispenser: a candy machine.
          • technical any device that transmits a force or directs its application.
          • an efficient and well-organized group of powerful people: his campaign illustrated the continuing strength of a powerful political machine.
          • a person who acts with the robotic efficiency of a machine: comedians are more than just laugh machines.
        2. machines collectively: farm machinery.
            <f Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx))**++,,--..//00112233445566778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^__``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~ D;L 33) }!oLfrost2021/01/08 19:28:372026/10/09 16:38:41AS1f720S2fe00S10006S1fb20S18d20M510x534S1f720490x467S1fb20495x486S18d20490x509
            noun
            1. a machine that dispenses cash or performs other banking services when an account holder inserts a bank card: they tried to withdraw cash from an ATM using the stolen cards | [as modifier] : he took out $200 from an ATM machine.
            Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8d7\ude41\ud8cd\udd01.mov"} CHC O33sm!YOfrost2021/03/30 16:51:552026/10/09 16:47:59AS14040S2fe00S14048S2fe00S21406S20500S2d50aS2d512S20500M530x526S14040501x475S140484j,N 33u c!Nfrost2021/01/08 19:32:092026/10/09 16:42:47AS1dc20S2fe00S10006S17620S14720S14720S19a20M5h4M 33) o!oMfrost2021/01/08 19:29:522026/10/09 16:40:06AS1dc20S2fe00S10006S1f720S14720M512x538S1dc20488x463S1f720492x497S14720498x516
            noun
            1. a room or building equipped for scientific experiments, research, teaching, or for the manufacture of drugs or chemicals: pepsin can be extracted in the lab | a science lab | [as modifier] : a lab technician.
              • [as modifier] (of an animal) bred for or used in experiments in laboratories: studies on lab rats.
            Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8c6\udec1.mov"}never entered my head.
          • to penetrate (something): the bullet entered his stomach.
        3. to begin to be involved in: in 1941 America entered the war | in recent years banks and insurance companies have entered the market
          • to begin attending (an educational establishment): she will start school today.
          • to become a member of (an institution): that autumn, he entered college.
          • to register as a competitor or participant in (a tournament, race, or exam): they won every race they entered.
          • to start or reach (a stage or period of time) in an activity or situation: the election campaign entered its final phase.
        noun
        1. an opening, such as a door, passage, or gate, that allows access to a place.
        Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\ud8c8\ude1b\ud8fc\udc61\ud8d9\udf85\ud8d9\ude61\ud8ea\ude41.mov"}ndants of a common ancestor: the house has been owned by the same family for 300 years.
        • a race or group of peoples from a common stock.
      2. a group of related things: all manuscripts that share this reading constitute a family.
        • Biology a principal taxonomic category that ranks above genus and below order, usually ending in -idae (in zoology) or -aceae (in botany): the cabbage family.
        • all the languages ultimately derived from a particular early language, regarded as a group: the Austronesian language family.
        • Mathematics a group of curves or surfaces obtained by varying the value of a constant in the equation generating them.
      adjective [attributive] designed to be suitable for children as well as adults: a family newspaper.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d3\udd61\ud8fc\udc61\ud8d3\udd69\ud8fc\udc61\ud8fc\udc07\ud8ec\udfa7\ud8ec\udfbf.mov"} }P 33 m!)Pfrost2021/03/28 19:10:582026/10/09 16:51:44AS14c20S2fe00S10006S2e300M512x531S14c20489x470S2e300489x504
      adverb
      1. used to show that something is almost, but not completely, accurate or exact; roughly: a journey of approximately two hours.
        • [at front locus] near or in the area around a location on a vertical surface: his name is around there on the chart.
      adjective
      1. close to the actual, but not completely accurate or exact: you can enter an approximate date if you are unsure when it happened.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8ed\udd21.mov"}22114M532x518S2ff00482x483S11500510x461S11508474x462S22114506x454S22114467x454S38b00470x493 M532x518S2ff00482x483S11500510x461S22114506x454 M518x518S2ff00482x483S11508474x462S22114467x454 M533x518S2ff00482x483S12d00510x462S12d08467x462S22114506x454S22114467x454 S38b04470x493noun a burrowing, gregarious, plant-eating mammal with long ears, long hind legs, and a short tail, especially indicating the long ears on the head.

      PHONOLOGICAL VARIANTS
      rabbit right-handed
      rabbit left-handed
      rabbit with extended thumbAdam Frost{"video":"dominance: equal;\\n\ud8c1\udfe1\ud8f0\udc08\ud8c1\udfe9\ud8f0\udc02\ud8d8\udde1\ud8d8\udde1\ud8db\udc75\ud8db\udc75.mov"} +c+N4R 33g !Rfrost2021/01/08 19:53:502026/05/02 20:43:06AS14c13S2fe00S16d48S2fe00S21406S20500S2880aS18517M541x520S16d48459x499S14c13471x490S2880a497x481S18517522x493Adam Frost{"video":"dominance: right;\\n\ud8c7\udc94\ud8fc\udc61\ud8ca\udd29\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e4\udf0b\ud8cc\uddf8.mov"}Q 33[ i!}Qfrost2021/01/08 19:44:432026/10/09 16:54:30AS15a50S2fe00S15a5aS2fe00S21404S21100S2c600M525x523S15a50509x496S15a5a498x485S21100493x502S2c600476x477
      verb
      1. [center to front loci] to go into (a place): she entered the kitchen | [no object] : the door opened and Karl entered.
        • to come or be introduced into: the thought o rr S 33 !)Sfrost2021/01/08 19:58:062026/10/09 16:58:45AS15a48S2fe00S10006S26a06M516x514S15a48485x487S26a06502x487
          adverb
          1. on the right-hand side: the drawer is on the right side of the desk.
          preposition
          1. on or against (the right-hand side): the picture is on the wall.
          verb
          1. to be moved on or against (the right-hand side): put the chair against the tree.
          Adam Frost{"video":"dominance: right;\\n\ud8c8\ude09\ud8fc\udc61\u00d8\ud8e1\udfc7.mov"} qqU 33[ y!}Ufrost2021/01/08 20:02:102026/05/02 20:44:12AS15a10S2fe00S15a18S2fe00S38006S26500S26510M523x524S15a10510x497S15a18479x497S26500509x476S26510478x476noun a passage in a building from which doors lead into rooms: his room lay at the very end of the hall.Adam Frost{"video":"dominance: equal;\\n\ud8c8\uddd1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8fc\udc07\ud8e1\udde1\ud8e1\uddf1.mov"}lT 33 K!)Tfrost2021/01/08 20:00:452026/05/02 20:43:52AS15a40S2fe00S10006S26a02M516x514S15a40504x487S26a02485x487adverb on the left-hand side: the book is on the left side of the shelf.
          preposition on or against (the left-hand side): the picture is on the wall.
          verb to be moved on or against (the left-hand side): put the chair against the tree.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\u00d8\ud8e1\udfc3.mov"} NW 33) Q!AWfrost2021/01/08 20:09:452026/05/02 20:45:15AS11050S2fe00S10006S22510S25504M511x534S11050492x482S22510489x466S25504496x512verb to move downward to a lower level or floor: I went downstairs into the kitchen.Adam Frost{"video":"dominance: right;\\n\ud8c1\ude51\ud8fc\udc61\u00d8\ud8db\uddf1\ud8df\udfe5.mov"}V 33) 7!AVfrost2021/01/08 20:08:182026/05/02 20:45:03AS11050S2fe00S10006S22510S25500M511x534S11050492x507S22510489x491S25500494x466noun (usually stairs) a set of steps leading to a different floor or level: he sat on the stairs.
          verb to move upward to a higher level or floor: he went upstairs.
          adverb to an upper floor of a building: I tiptoed upstairs.Adam Frost{"video":"dominance: right;\\n\ud8c1\ude51\ud8fc\udc61\u00d8\ud8db\uddf1\ud8df\udfe1.mov"} Y 33 +!)Yfrost2021/01/08 20:14:002026/05/02 20:45:45AS10040S2fe00S10006S2d50fM510x527S10040492x497S2d50f490x473verb to shift course to the right: at the intersection, go right.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc41\ud8fc\udc61\u00d8\ud8eb\udff0.mov"}X 33 1!)Xfrost2021/01/08 20:11:582026/05/02 20:45:32AS10040S2fe00S10006S2d507M510x527S10040492x497S2d507490x473verb to shift course to the left: at the end of the hall, turn left.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc41\ud8fc\udc61\u00d8\ud8eb\udfe8.mov"} ))SZ33sk!mZfrost2021/03/30 16:48:002026/10/09 16:47:24AS1f550S2fe00S1f558S2fe00S21406S20500S2d50aS2d512S20500M525x518S1f550501x482S1f558475x482S2d50a506x502S2d512475x502M530x526S14040501x475S14048470x475S2d50a511x510S2d512470x510noun
          1. the measurement of a surface: the area of a triangle.
            • [with modifier] a space allocated for a specific purpose: the dining area.
          2. a place or location; compare place.
          Adam Frost{"video":"dominance: equal;\\nletter: integrated (sense 1);\\n\ud8d7\udc31\ud8fc\udc61\ud8d7\udc39\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8eb\udfeb\ud8eb\udff3\ud8d8\udde1.mov"} ww[ 33[ Q!}[frost2021/04/07 15:03:022026/05/02 20:49:01AS1f740S2fe00S1f748S2fe00S21406S20e00S22a04M521x524S1f740501x476S1f748479x485S20e00503x494S22a04502x509determiner used to refer to every one of two or more people or things, regarded and identified separately: each battery is in a separate compartment | each one of us was asked what went on.
          adverb to, for, or by every one of a group (used after a noun or an amount): they cost $11 each | Paul and Bill have a glass each.Adam Frost{"video":"dominance: right;\\n\ud8d7\udce1\ud8fc\udc61\ud8d7\udce9\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8db\udfc5.mov"} ^\33A!\frost2021/01/08 20:22:072026/06/27 18:12:56AS10e04S2fe00S15a3aS2fe00S21400S20500S22f20M514x526S15a3a486x514S10e04494x492S22f20489x475M514x526S15a3a487x514S10e04495x492S22a20496x474 S38a00464x490 M527x525S15a18474x494S14a20486x510S21100488x493S23600488x476verb [frequentative] to lift.
          noun an elevator.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c1\udd45\ud8fc\udc61\ud8c8\uddfb\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8dc\uddc1.mov"}offlrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|K1N2O3R5T6V7W9Y;Z<[>^?_A`BaDbEcFeGgIiJkKmLnOqPsRtSuUvWwYxZy[z\|]}_~`aceghjklmoqstvwx|}    !$'*,ƒ-Ã/Ń0ƃ1ǃ2ȃ3Ƀ4ʃ5˃6σ8у9҃:Ӄ<Ճ>փ?׃A؃BڃCۃD܃GރHIKMNOPQRTU OO-] 33[k!)]frost2021/01/08 20:23:472026/06/27 18:11:46AS14a20S2fe00S15a18S2fe00S21406S21100S23600M527x525S15a18474x494S14a20486x510S21100488x493S23600488x476M514x526S15a3a486x514S10e04494x492S22f20489x475noun a platform or compartment housed in a shaft for raising and lowering people or things to different floors or levels: in the elevator she pressed the button for the lobby.

          SIGN VARIATIONS
          elevator V-hand on flat-handAdam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udfe1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d9\ude61\ud8dd\udc41.mov"} ) _ 33 I!i_frost2021/01/08 21:15:192026/05/02 20:50:59AS18510S30007S10006S22104S10651S2fe00S1063aS2fe00S21400S20900S2c300S2c314M557x564S2ff00482x483S18510514x487S22104517x477S10651496x536S1063a475x542S20900489x527S2c300531x533S2c314444x540noun a regular male companion with whom a person has a romantic or sexual relationship.Adam Frost{"video":"dominance: right;\\n\ud8cc\uddf1\ud8f0\udc08\u00d8\ud8db\udc65\ud8c0\ude92\ud8fc\udc61\ud8c0\ude7b\ud8fc\udc61\ud8d9\udf81\ud8d8\udf61\ud8ea\udd21\ud8ea\udd35.mov"}S^ 335 -!c^frost2021/01/08 21:03:482026/05/02 20:50:38AS14e02S2fe00S14e0aS2fe00S21406S20710M531x523S14e0a470x492S14e02500x498S20710484x477noun
          1. a person occupying the same room or housing as another.
          2. a person or animal with whom one spends a lot of time or with whom one travels: his traveling companion.
          Adam Frost{"video":"dominance: left;\\n\ud8c7\udd43\ud8fc\udc61\ud8c7\udd4b\ud8fc\udc61\ud8d9\udf87\ud8d8\udeb1.mov"} B` 33 !`frost2021/01/08 21:21:512026/05/02 20:51:21AS1f540S30005S10006S20e00S22a03S10651S2fe00S1063aS2fe00S21400S20900S2c300S2c314M553x591S2ff00482x483S1f540505x512S22a03493x535S10651492x563S1063a471x569S20900485x554S2c300527x560S2c314440x567noun a regular female companion with whom a person has a romantic or sexual relationship: his girlfriend is Australian.Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8f0\udc06\u00d8\ud8d9\udd41\ud8db\udfc4\ud8c0\ude92\ud8fc\udc61\ud8c0\ude7b\ud8fc\udc61\ud8d9\udf81\ud8d8\udf61\ud8ea\udd21\ud8ea\udd35.mov"}1485x467S14a20498x495S1fb20498x514M524x518S2035a476x482S15a50483x491S20e00505x491S22114498x506noun a domestic or tamed animal kept for companionship or pleasure: the pony was a family pet | they don't let us keep pets | [as modifier] : a pet shop.
          • sometimes derogatory a person treated with special favor, sometimes in a way that others regard as unfair: I was always the teacher's pet in school | his reputation as a teacher's pet made him a target of bullies.
          adjective [attributive] (of an animal) kept as a pet: a pet cat.

          SIGN VARIATIONS
          pet (noun, adjective) with flat-hand stroking over fistAdam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udc52\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8d7\ude41.mov"} ]a 33[ U!)afrost2021/01/08 21:27:052026/05/17 18:31:57AS1ce20S2fe00S1ce28S2fe00S38006S2df06S2df1eM524x529S1ce20502x499S1ce28477x499S2df06502x471S2df1e479x471noun
          1. a group of one or two parents and their child or children living together as a unit: the family lived in a large house with a lot of land | [as modifier] : the family home.
            • a group of people related to one another by blood or marriage: friends and family can provide support | I could not turn him away, for he was family.
            • the children of a person or couple: she has the sole responsibility for a large family.
            • informal a group of people united in criminal activity.
          2. all the descep 44zc 33 M!)cfrost2021/01/08 21:38:062026/05/02 20:53:48AS14c27S30004S10006S20600M530x535S2ff00482x483S14c27504x508S20600479x520noun a woman in relation to her child or children: my mom gave us each a slice of pizza | [as name] : I'm waiting for Richard and Mom to get home.Adam Frost{"video":"dominance: right;\\n\ud8c7\udca8\ud8f0\udc05\u00d8\ud8d8\ude41.mov"}Jb 33 m!)bfrost2021/01/08 21:34:562026/05/02 20:53:21AS14c20S30007S10006S20600M538x518S2ff00482x483S14c20515x472S20600490x471noun a man in relation to his child or children: his dad was with him | what are you making, Dad?.Adam Frost{"video":"dominance: right;\\n\ud8c7\udca1\ud8f0\udc08\u00d8\ud8d8\ude41.mov"} ^/^Me 33' e!-efrost2021/01/08 21:54:012026/05/02 20:54:28AS16d20S30005S16d39S2fe00S20500S22a03S16d51S21400S20800M523x573S2ff00482x483S16d20506x506S22a03502x528S16d39496x550S16d51487x553S20800493x541noun a married woman considered in relation to her spouse: he and his wife are keen gardeners.Adam Frost{"video":"dominance: right;\\n\ud8ca\udd01\ud8f0\udc06\ud8ca\udd1a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8ca\udd32\ud8d9\udf81\ud8d8\udf01.mov"}Md 33' e!-dfrost2021/01/08 21:49:092026/05/02 20:54:05AS16d21S30007S16d39S2fe00S20500S22a03S16d51S21400S20800M533x554S2ff00482x483S16d21513x487S22a03512x512S16d39498x531S16d51489x534S20800495x522noun a married man considered in relation to his spouse: she and her husband are both retired.Adam Frost{"video":"dominance: right;\\n\ud8ca\udd02\ud8f0\udc08\ud8ca\udd1a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8ca\udd32\ud8d9\udf81\ud8d8\udf01.mov"} U*g 33' !-gfrost2021/01/08 22:10:472026/05/02 20:55:26AS15a10S30005S15a3aS2fe00S20500S22a03S15a32S38622S20500M527x566S2ff00482x483S15a10506x508S37806475x559S15a3a500x554S15a32472x542S22a03490x524noun a girl or woman in relation to either or both of her parents.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd1\ud8f0\udc06\ud8c8\uddfb\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8c8\uddf3\ud8fc\ude63\ud8d8\udde1.mov"}'f 33' !-ffrost2021/01/08 22:04:352026/05/02 20:55:11AS15a11S30007S15a3aS2fe00S20500S22a03S15a32S38622S20500M533x551S2ff00482x483S15a11510x488S37806477x544S15a3a502x539S15a32474x527S22a03508x516noun a boy or man in relation to either or both of his parents.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8f0\udc08\ud8c8\uddfb\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8c8\uddf3\ud8fc\ude63\ud8d8\udde1.mov"} }}h 33C !Ahfrost2021/01/18 16:58:212026/05/02 20:55:45AS1f540S38404S10006S20e00S26500M533x543S2ff00482x483S1f540493x519S20e00520x524S26500519x505adverb
            1. used to negate a statement or predicate: he would not say | she isn't there | didn't you tell me?.
            2. used as a short substitute for a negative clause: maybe I'll regret it, but I hope not | “Don't you keep in touch?” “I'm afraid not.” | they wouldn't know if I was telling the truth or not.
            3. used to express the negative of other words: not a single attempt was made | treating the symptoms and not the cause | “How was it?” “Not so bad.”.
              • used with a quantifier to exclude a person or part of a group: not all the poems are serious.
            Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udd85\u00d8\ud8d9\udd41\ud8e1\udde1.mov"} --$j 33[ c!)jfrost2021/01/27 15:59:072026/05/08 23:21:32AS14020S2fe00S14028S2fe00S38006S2ea30S2ea1cM532x536S14020503x464S14028468x476S2ea30515x499S2ea1c468x511noun human beings in general or considered collectively: the earthquake killed 30,000 people.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc21\ud8fc\udc61\ud8c6\udc29\ud8fc\udc61\ud8fc\udc07\ud8ed\udff1\ud8ed\udfdd.mov"}$i 33[ !}ifrost2021/01/27 15:51:162026/08/08 23:04:32AS15a50S2fe00S15a58S2fe00S38006S2920aS29212M552x514S15a50505x487S15a58484x487S2920a521x498S29212449x498noun more than one child: the film is not suitable for children.
            • sons and daughters of any age: when children leave home, parents can feel somewhat redundant.
            Adam Frost{"video":"dominance: equal;\\n\ud8c8\ude11\ud8fc\udc61\ud8c8\ude19\ud8fc\udc61\ud8fc\udc07\ud8e5\udecb\ud8e5\uded3.mov"} uuk 33C )!Akfrost2021/01/27 16:03:192026/05/02 20:58:12AS1ce10S30005S10006S20e00S26a06M563x521S2ff00482x483S1ce10513x484S26a06549x494S20e00534x501noun a small domesticated carnivorous mammal with soft fur, a short snout, and retractable claws: The cat chased after the mice.Adam Frost{"video":"dominance: right;\\n\ud8d3\udd51\ud8f0\udc06\u00d8\ud8d9\udd41\ud8e1\udfc7.mov"} il 33[ !}lfrost2021/04/07 15:10:592026/05/17 18:34:49AS10030S2fe00S10038S2fe00S38006S2a200S2a218M528x529S10030509x499S10038477x499S2a200505x472S2a218473x472verb [no object]
            1. to take place; occur: two hours had passed and still nothing had happened | the accident happened at 7:40 a.m | the afternoon when the disturbance happened.
            2. to ensue as an effect or result of an action or event: this is what happens when the mechanism goes wrong.
            3. [with clause] to come about by chance: it just so happened that she turned up that afternoon.
            Adam Frost{"video":"dominance: equal;\\n\ud8c0\udc31\ud8fc\udc61\ud8c0\udc39\ud8fc\udc61\ud8fc\udc07\ud8e7\udcc1\ud8e7\udcd9.mov"} >6m 33) !!Amfrost2021/01/27 16:23:082026/05/02 20:58:53AS1f420S30004S10006S20500S22114M518x528S2ff00482x483S1f420479x513S22114454x506noun a warm-blooded egg-laying vertebrate distinguished by the possession of feathers, wings, and a beak and (typically) by being able to fly: The bird flew majestically across the sky.
            • a domestic fowl kept for its eggs or meat, especially a young one: rationing was still in force and most people kept chickens.
            • the flesh of chickens and other domestic fowl as food: I haven't eaten red meat for 19 years and poultry for 12 years | raw or cooked meat and poultry | anyone handling raw poultry should wash their hands thoroughly.
            Adam Frost{"video":"dominance: right;\\n\ud8d6\udfa1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8db\udc75.mov"} ]]o 33A !}ofrost2021/01/27 16:39:192026/05/11 22:50:26AS1f740S2fe00S18218S2fe00S21404S20500S21800M526x510S18218475x490S1f740485x495S21800508x498noun a slow-moving reptile, enclosed in a scaly or leathery domed shell into which it can retract its head and thick legs.Adam Frost{"video":"dominance: right;\\n\ud8d7\udce1\ud8fc\udc61\ud8cc\udcd9\ud8fc\udc61\ud8d9\udf85\ud8d8\udde1\ud8da\udd01.mov"}n 33A i!}nfrost2021/01/27 16:35:342026/05/02 20:59:07AS15a40S2fe00S15a48S2fe00S21410S20500S26b02M511x540S15a48490x513S15a40497x491S26b02493x461noun
            1. a limbless cold-blooded vertebrate animal with gills and fins and living wholly in water: the sea is thick with fish.
            2. the flesh of fish as food: hot crab appetizers stuffed with fish.
            Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf91\ud8d8\udde1\ud8e2\udc23.mov"} q33g=y!qfrost2021/01/27 16:47:462026/05/23 18:33:43AS11531S2fe00S11539S2fe00S21414S20500S22114S22114M530x518S22114504x483S11539496x491S22114471x483S11531479x491S38b00470x493 M529x518S12d39496x491S12d31479x491S22114471x483S22114503x483 S38b04470x493noun a burrowing, gregarious, plant-eating mammal with long ears, long hind legs, and a short tail.

            PHONOLOGICAL VARIANTS
            rabbit with extended thumbAdam Frost{"video":"dominance: right;\\n\ud8c2\udc12\ud8fc\udc61\ud8c2\udc1a\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1\ud8db\udc75\ud8db\udc75.mov"}bp 33C _!Apfrost2021/01/27 16:42:522026/05/02 21:14:37AS10011S33200S10006S20e00S26a02M523x540S33100482x483S10011502x505S20e00488x520S26a02472x513noun a rodent that typically has a pointed snout, relatively large ears and eyes, and a long tail.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f4\udec1\u00d8\ud8d9\udd41\ud8e1\udfc3.mov"}519x487S28812476x487verb to change the place or position of: she moved everything.
            • [left to right loci] to change the location of something from one place to another: she moved the tray to the side table.
            • to change one's place of residence or work: his family moved to London when he was a child.
            • (of a player) to change the position of a piece in a board game: White has forced his opponent to move | [with object] : if Black moves his bishop, he loses a pawn.
            noun a change of place or position: she made a sudden move | his eyes followed her every move.
            • a change of position of a piece in a board game: that move will put your king in check.

            INFLECTED FORMS
            move [right to center loci]Adam Frost{"video":"dominance: equal;\\n\ud8cc\ude02\ud8fc\udc61\ud8cc\ude0a\ud8fc\udc61\ud8fc\udc07\ud8e4\udf0b\ud8e4\udf1b.mov"} js 33)k+!Asfrost2021/04/07 15:19:492026/09/11 05:12:04AS16d10S31410S10006S20500S22a07M536x518S2ff00482x483S16d10507x482S22a07523x470M511x540S20320496x461S11520496x480S11920490x514
            noun
            1. (the sun or the Sun) the star around which the earth orbits: the sun shone from a cloudless sky | he watched the sun go down over the sea.
              • any star in the universe that is similar to the sun, with or without planets.
            SIGN VARIATIONS
            sun fingerspelled
            Adam Frost{"video":"dominance: right;\\n\ud8ca\udcf1\ud8f1\udf91\u00d8\ud8d8\udde1\ud8db\udfc8.mov"}er33G!rfrost2021/01/27 16:52:052026/05/23 18:31:37AS11500S30007S11508S30001S20500S20500S22114Sr UU't 33g A!Etfrost2021/01/27 16:58:592026/05/02 21:17:25AS18241S38517S18249S38511S20500S20500S2f900S2f900S26a02S26a16M552x519S18241510x481S18249466x481S20500485x501S20500506x501S2f900506x514S2f900484x514S26a02538x483S26a16449x483noun a living organism that feeds on organic matter, typically having specialized sense organs and nervous system and able to respond rapidly to stimuli: wild animals adapt badly to a caged life | humans are the only animals who weep | animals such as spiders.
            • an animal as opposed to a human being: are humans superior to animals, or just different?.
            • a mammal, as opposed to a bird, reptile, fish, or insect: the snowfall seemed to have chased all birds, animals, and men indoors.
            Adam Frost{"video":"dominance: equal;\\n\ud8cc\udd02\ud8fc\uddf8\ud8cc\udd0a\ud8fc\uddf2\ud8d8\udde1\ud8d8\udde1\ud8ef\udd61\ud8ef\udd61\ud8e1\udfc3\ud8e1\udfd7.mov"}9S22e04492x503pronoun
            1. [at center locus] used to identify a specific person or thing observed by the speaker: that's his wife over there.
            2. referring to a specific thing previously mentioned, known, or understood: that's a good idea | what are we going to do about that?.
            determiner
            1. [at center locus] used to identify a specific person or thing observed or heard by the speaker: look at that man there.
            2. referring to a specific thing previously mentioned, known, or understood: seven people died in that incident.
            adverb [as submodifier] to such a degree; so: I have run that far before.
            conjunction used to explicitly mark a relationship between clauses: it is possible that we have misunderstood.Adam Frost{"video":"dominance: right;\\n\ud8ce\ude11\ud8fc\udc61\u00d8\ud8dc\udd45.mov"} 4v 335km!vfrost2021/04/07 15:34:072026/05/20 21:09:57AS16d10S2fe00S15a1aS2fe00S38000S22a00M521x518S16d10483x498S15a1a479x484S22a00508x483M525x519S1ce12476x497S15a1a482x483S22a00512x482noun a phonological variant (C-hand) of sunrise.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8ca\udcf1\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8fc\udc01\ud8db\udfc1.mov"}hu33)]!oufrost2021/01/27 17:07:032026/09/20 16:36:11AS14051S2fe00S10006S14a20S1fb20M516x533S1405 %w335#!!ewfrost2021/04/07 15:34:482026/06/02 21:30:37AS1ce12S2fe00S15a1aS2fe00S38000S22a00M525x519S1ce12476x497S15a1a482x483S22a00512x482S38b00470x493 M521x518S16d10483x498S15a1a479x484S22a00508x483 S38b04470x493noun the time in the morning when the sun appears or full daylight arrives: an hour before sunrise.
            • the colors and light visible in the sky on an occasion of the sun's first appearance in the morning, considered as a view or spectacle: a spectacular sunrise over the summit of the mountain.

            PHONOLOGICAL VARIANTS
            sunrise with C-handAdam Frost{"video":"dominance: right;\\n\ud8d3\udd53\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8fc\udc01\ud8db\udfc1.mov"} %%Wx 33 !!)xfrost2021/04/09 19:31:172026/05/02 21:24:00AS1f550S2fe00S10006S2a208M524x520S1f550477x505S2a208501x480adjective denoting a person or thing that is different or distinct from one already mentioned or known about: this is our last resort—there's no other way of reaching an agreement.
            pronoun
            1. a person or thing that is different or distinct from one already mentioned or known about: a language unrelated to any other.
            2. a further or additional person or thing of the type already mentioned: he is the author of five books and collaborated on three others.
            Adam Frost{"video":"dominance: right;\\n\ud8d7\udc31\ud8fc\udc61\u00d8\ud8e7\udcc9.mov"} )$R)|| 33 !)|frost2021/04/10 16:18:522026/06/14 18:35:31AS19a50S2fe00S10006S22e04M514x521S19a50486x476{ 33E _!m{frost2021/11/23 15:39:352026/05/31 01:46:45AS33e00M518x518S33e00482x483affix used to mark happy emotions.Adam Frost{"video":"dominance: equal;\\n\ud8f5\udf41.mov"}Fz33[Y!}zfrost2021/04/10 15:59:362026/08/15 20:02:30AS18521S2fe00S18529S2fe00S38006S2880aS2881aM541x514S18521494x495S18529459x495S2880a519x487S2881a476x487M541x514S18521494x495S18529459x495S28802Xy 335k5!yfrost2021/04/10 15:53:032026/05/18 06:41:23AS18220S2fe00S15a1aS2fe00S21414S20600M525x514S15a1a480x502S18220475x486S20600503x491M526x516S2031a485x501S18220474x485S20600504x496noun, adverb [in isolation] a phonological variant (flat base hand) of night.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8cc\udce1\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8d9\udf95\ud8d8\ude41.mov"}: the inside of the car was like an oven.
            • the area or space inside a building: the rain makes indoors feel so warm and safe.
          3. the inner side or surface of something: she ran a finger around the inside of the bowl.
          adjective [attributive] situated in or enclosed by something: an inner courtyard.
          • close to the center: the inner solar system.
          • close to the center of power: the inner cabinet.
          • in the body: internal bleeding.
          • existing or occurring in an organization: an internal telephone system.
          • relating to affairs and activities in a country rather than with other countries; domestic: the government's internal policies | internal flights.
          • situated, conducted, or used in a building or under cover: indoor sports.
          Adam Frost{"video":"dominance: right;\\n\ud8cc\ude32\ud8fc\udc61\ud8cb\udc89\ud8fc\udc61\ud8d9\udf81\ud8d8\udeb1.mov"}0519x505 M524x523S10018476x478S10041491x481S26501511x510 M523x523S15a40510x478S15a48478x478S22a04510x508S22a14477x508 S38a04464x490 M517x522S10000484x479S27106502x482 M520x519S10057480x489S26507507x481 M528x516S14720489x485S14728473x485S2e004507x488 S38800464x496 M517x522S10000484x479S27106502x482 M536x534S10028464x466S10041480x469S26505498x496S10641513x506 M531x525S14e00506x494S14e08469x494S26500511x475S26510475x475 M536x536S2ff00482x483S14e00499x505S26500522x498 S38800464x496 S38a00464x490 M508x515S10e00493x485 S38800464x496 M523x528S1ce40501x473S1ce48478x473S28800510x506S28818479x506 M523x523S15a40510x478S15a48478x478S22a04510x508S22a14477x508 M508x525S17620492x475S11a20492x495 M523x523S15a40510x478S15a48478x478S22a04510x508S22a14477x508 M520x527S1f540481x473S1f548481x503S28801500x483 S38a04464x490 M526x517S18210503x483S18218474x483S22a04507x502S22a14480x502 M524x544S15a18478x465S1dc40491x456S15a40511x499S15a48478x499S22a04511x529S22a14477x529 M542x530S15a40501x503S15a48487x503S21100493x487S27100502x47 %} 33 =!)}frost2021/04/10 17:26:292026/05/26 03:30:03AS10047S2fe00S10006S26507M520x521S10047481x500S26507507x480pronoun [at right front locus] used to refer to a person or thing: everyone liked my father—he was the perfect gentleman | my sister told me that she was not happy | ask someone if they can help.
          determiner [at right front locus] used to indicate to a person or thing: do you see that man?.
          adverb [at right front locus] in, at, or to a place or position: the car is over there.
          preposition [at right front locus] expressing location or arrival in a place or position: I saw a woman at the house.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc48\ud8fc\udc61\u00d8\ud8e1\udde8.mov"}1S27114458x471 M517x526S15a09494x475S15a21493x475S21100484x494S2df24496x505 M517x522S10000484x479S27106502x482 S38800464x496 S38a00464x490 M519x544S1f720493x456S10120498x475S19220498x525S2a20c482x509 S38a00464x490 M521x508S1f748479x493S1f740501x493 M540x508S17620505x492S17628480x492S26506525x492S26512461x492 M524x520S1f550477x505S2a208501x480 M523x523S15a40510x478S15a48478x478S22a04510x508S22a14477x508 S38a04464x490 M520x521S10047481x500S26507507x480 M517x522S10000484x479S27106502x482 M518x515S17648482x499S18551491x486 M524x526S15a40512x499S15a48476x474S26902491x507S26916491x482 S38800464x496 S38a00464x490 M511x542S1f720490x459S10120495x478S10e20495x512 S38a00464x490 M508x515S10000493x485 S38800464x496 M512x519S10020488x489S2ed09493x481 M523x523S15a40510x478S15a48478x478S22a04510x508S22a14477x508 S38a04464x490 M520x521S10047481x500S26507507x480 M527x519S1f70a474x499S1f702512x499S21100494x491S22a00513x481S22a10475x481 M517x522S10000484x479S27106502x482 S38800464x496 S38a00464x490 M508x515S10e00493x485 S388 D33?G!)frost2021/05/01 15:57:082026/08/03 17:19:11AS10000S2fe00S10006S27106M517x522S10000484x479S27106502x482M516x596S14051485x404S11a20498x432S17620498x466S11920492x486S17620498x516S11520498x536S11920492x570 S38a00464x490 M508x515S10000493x485 S38800464x496 M523x523S15a40510x478S15a48478x478S22a04510x508S22a14477x508 M549x518S2ff00482x483S15a11510x487S28109527x469 M508x525S17620492x475S11a20492x495 M533x543S2ff00482x483S1f540493x519S20e00520x524S2650>~ 335Q=!e~frost2021/04/10 17:52:362026/06/16 19:22:48AS18551S2fe00S17648S2fe00S21400S20710M529x517S17648493x501S18551502x488S20710471x483M518x515S17648482x499S18551491x486noun [frequentative]
          1. the part that is in or enclosed by somethingeam played well | my mother could never cook this good.
            • in a way that is appropriate to the facts or circumstances: you did well to come and tell me | [as submodifier, in combination] : a well-timed exit.
            • so as to have a fortunate outcome: his campaign did not go well.
            • in a kind way: the animals will remain loyal to humans if treated well.
            • with praise or approval: people spoke well of him | the film was quite well reviewed at the time.
            • with equanimity: she took it very well, all things considered.
            • profitably; advantageously: she would marry well or not at all.
            • in a condition of prosperity or comfort: they lived well and were generous with their money.

            PHONOLOGICAL VARIANTS
            good with forward movementAdam Frost{"video":"dominance: right;\\n\ud8c8\uddc2\ud8f0\udc05\u00d8\ud8d8\udde1\ud8db\udfc5.mov"}be familiar or friendly with: he knew and respected Laura.
          2. to have a good command of (a subject or language).
          3. to recognize (someone or something): Isabel couldn't hear the words clearly but she knew the voice.
          4. to be familiar or acquainted with (something): a little restaurant she knew near Times Square.
          5. to have personal experience of (an emotion or situation): a man who had known better times.
          6. (usually be known as) to regard or perceive as having a specified characteristic: he is also known as an amateur painter.
          7. (usually be known as) give (someone or something) a particular name or title: the doctor was universally known as “Hubert.”.
          8. (know someone/something from) to be able to distinguish one person or thing from (another): you are convinced you know your own baby from any other in the world.
          Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8f0\udc08\u00d8\ud8d8\udde1.mov"}531x525S14e00506x494S14e08469x494S26500511x475S26510475x475M532x525S14e50506x476S14e58469x476S26504513x510S26514474x510noun [at front locus, facing center] the assembled spectators or listeners at a public event, such as a play, movie, concert, or meeting: the orchestra was given an enthusiastic ovation from the audience.
          • the people who watch or listen to a television or radio program: the program attracted an audience of almost twenty million.
          • the readership of a book, magazine, or newspaper: the newspaper has a sophisticated audience.
          • the people giving or likely to give attention to something: there will always be an audience for romantic literature.

          INFLECTED FORMS
          audience [front to center loci, facing front]Adam Frost{"video":"dominance: equal;\\n\ud8c7\udd41\ud8fc\udc61\ud8c7\udd49\ud8fc\udc61\ud8fc\udc07\ud8e1\udde1\ud8e1\uddf1.mov"}a469x493S26506535x493S26512450x493adjective
          1. [from left and right loci] having a position on the other or further side of something; facing something, especially something of the same type: a crowd gathered on the opposite side of the street.
          2. diametrically different; of a contrary kind: a word that is opposite in meaning to another | currents flowing in opposite directions.
            • being the other of a contrasted pair: the opposite ends of the price range.
          adverb [from left and right loci] in a position facing a specified or implied subject: they are sitting almost opposite.
          noun a person or thing that is totally different from or the reverse of someone or something else: we were opposites in temperament | the literal is the opposite of the figurative.Adam Frost{"video":"dominance: equal;\\n\ud8c0\udc03\ud8fc\udc61\ud8c0\udc0b\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\udde7\ud8e1\uddf3.mov"} aI 33 !)frost2021/05/01 16:57:192026/05/17 18:37:38AS15a11S30007S10006S20500M533x518S2ff00482x483S15a11510x487verb
          1. [with clause] to be aware of through observation, inquiry, or information: most people know that CFCs can damage the ozone layer | I know what I'm doing.
          2. [with object] to have knowledge or information concerning: I would write to him if I knew his address | I know a local who shot himself.
          3. [with clause] to have developed a relationship with (someone) through meeting and spending time with them;  22J 33) I!Afrost2021/05/01 17:00:352026/05/02 21:36:56AS15a11S30007S10006S20500S28109M549x518S2ff00482x483S15a11510x487S28109527x469adjective not known or familiar: exploration into unknown territory | his whereabouts are unknown to his family.
            verb to be unaware (of something): they really don't know what will happen.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8f0\udc08\u00d8\ud8d8\udde1\ud8e4\udc6a.mov"} YY#335W!efrost2021/05/01 17:12:272026/09/24 00:07:16AS10041S2fe00S10018S2fe00S38005S26501M524x523S10018476x478S10041491x481S26501511x510S38b00470x493 M537x521S2ff00482x483S10011516x491S26501512x474S10041493x446S10018478x438 S38b04470x493adjective
            1. clearly defined or identified: increasing the electricity supply only until it met specific development needs.
            2. precise and clear in making statements or issuing instructions: when ordering goods be specific.
            noun the object of a person's ambition or effort; an aim or desired result: going to law school has become the most important goal in his life.

            PHONOLOGICAL VARIANTS
            goal with contact on foreheadAdam Frost{"video":"dominance: right;\\n\ud8c0\udc42\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8fc\udc06\ud8e1\udde2.mov"} d 33g k!frost2021/05/01 17:14:112026/06/14 18:42:39AS1ce40S2fe00S1ce48S2fe00S21406S28800S28818S20500M523x528S1ce40501x473S1ce48478x473S28800510x506S28818479x506adjective of great significance or value; likely to have a profound effect on success, survival, or well-being: important habitats for wildlife | it is important to avoid monosyllabic answers.
            • (of a person) having high rank or status: an important senator.
            Adam Frost{"video":"dominance: equal;\\n\ud8d3\udd81\ud8fc\udc61\ud8d3\udd89\ud8fc\udc61\ud8d9\udf87\ud8e4\udf01\ud8e4\udf19\ud8d8\udde1.mov"} qz`33[ !}frost2021/05/01 17:24:082026/06/19 02:49:23AS14e00S2fe00S14e08S2fe00S38006S26500S26510M  33g 9!frost2021/05/01 17:20:122026/05/02 21:38:35AS10041S2fe00S10028S2fe00S21414S20500S26505S10641M536x534S10028464x466S10041480x469S26505498x496S10641513x506preposition
            1. indicating the point in space at which a journey, motion, or action starts: I leapt from my bed.
            2. indicating the source or provenance of someone or something: I'm from Hartford.
            3. indicating the point at which an observer is placed: you can see the island from here.
            Adam Frost{"video":"dominance: right;\\n\ud8c0\udc42\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1\ud8e1\udde6\ud8c0\ude82.mov"}2a04M519x535S14c01493x476S15a0a486x491S22511482x465S20e00507x505S22a04506x520noun
            1. the red liquid that circulates in the arteries and veins of humans and other vertebrate animals, carrying oxygen to and carbon dioxide from the tissues of the body: drops of blood.
              • an internal bodily fluid, not necessarily red, that performs a similar function in invertebrates.
            2. violence involving bloodshed: a commando operation full of blood and danger.
            3. [with modifier] family background; descent or lineage: she must have Irish blood in her.
            verb to lose blood from the body as a result of injury or illness: the cut is bleeding | some casualties were left to bleed to death | [as noun] : the bleeding has stopped now.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc82\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf91\ud8d9\udd41\ud8db\uddf2\ud8db\udfc5.mov"} / 33O !frost2021/05/02 15:04:572026/05/02 21:45:32AS1f720S2fe00S10006S10120S19220S2a20cM519x544S1f720493x456S10120498x475S19220498x525S2a20c482x509noun Grammar a word or phrase naming an attribute, added to or grammatically related to a noun to modify or describe it.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8c0\udc81\ud8cd\udee1\ud8e7\udccd.mov"}J 33) I!Afrost2021/05/01 17:28:212026/05/17 18:38:04AS14e00S30005S10006S20500S26500M536x536S2ff00482x483S14e00499x505S26500522x498verb [no object] to make a loud call or cry: you heard me yelling at her.Adam Frost{"video":"dominance: right;\\n\ud8c7\udd41\ud8f0\udc06\u00d8\ud8d8\udde1\ud8e1\udde1.mov"} %%Z 33O }!frost2021/05/02 15:07:452026/05/02 21:45:53AS11920S2fe00S10006S17620S11520S11920M511x555S11920489x445S17620495x475S11520495x495S11920489x529noun Grammar a word (other than a pronoun) used to identify any of a class of people, places, or things (common noun), or to name a particular one of these (proper noun).Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c2\udd81\ud8fc\udc61\u00d8\ud8cb\udc61\ud8c2\udc01\ud8c2\udd81.mov"}y 33) k!}frost2021/05/02 15:05:292026/05/02 21:45:42AS1f720S2fe00S10006S10120S10e20M511x542S1f720490x459S10120495x478S10e20495x512noun Grammar a word or phrase that modifies or qualifies an adjective, verb, or other adverb or a word group, expressing a relation of place, time, circumstance, manner, cause, degree, etc. (e.g., gently, quite, then, there).Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8c0\udc81\ud8c1\udd61.mov"} //M 33O c!frost2021/05/02 15:09:012026/05/02 21:46:03AS10e20S2fe00S10006S14a20S11a20S14720M508x555S10e20493x445S14a20493x480S11a20493x499S14720494x533noun Grammar a word used to describe an action, state, or occurrence, and forming the main part of the predicate of a sentence, such as hear, become, happen.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c1\udd61\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8c2\udde1\ud8c6\udec1.mov"} " 33[ !}frost2021/05/02 15:42:072026/05/02 21:41:15AS18210S2fe00S18218S2fe00S38006S22a04S22a14M526x517S18210503x483S18218474x483S22a04507x502S22a14480x502Adam Frost{"video":"dominance: equal;\\n\ud8cc\udcd1\ud8fc\udc61\ud8cc\udcd9\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"}O 335 #!efrost2021/05/02 15:25:512026/06/19 18:14:27AS1f540S2fe00S1f548S2fe00S37f06S28801M520x527S1f540481x473S1f548481x503S28801500x483adjective higher than or above another in characteristic or quality: humans are the dominant species on Earth | the soldier reported the incident to a superior officer.
            • above all others: most people write with their dominant hand | the Supreme Court ruled that the law was unconstitutional.
            Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8d7\udc29\ud8fc\udc61\ud8fb\udfa7\ud8e4\udf02.mov"}  33[ Y!}frost2021/05/02 15:46:322026/05/29 18:25:39AS15a21S2fe00S15a09S2fe00S21414S21100S2df24M517x526S15a09494x475S15a21493x475S21100484x494S2df24496x505verb [no object, with complement] to begin to beSTART BE SOMETHING: it is becoming clear that we are in a totally new situation | they became angry.
            • to grow to beDEVELOPE BECOME SOMETHING: the child will become an adult.
            • (of a person) to qualify or be accepted as; acquire the status of: she wanted to become a doctor.
            Adam Frost{"video":"dominance: right;\\n\ud8c8\udde2\ud8fc\udc61\ud8c8\uddca\ud8fc\udc61\ud8d9\udf95\ud8d9\ude61\ud8ec\udfc5.mov"} XX$ 33 Q!frost2021/05/02 15:53:572026/06/20 23:19:27AS15a40S2fe00S15a48S2fe00S21406S21100S27100S27114M542x530S15a40501x503S15a48487x503S21100493x487S27100502x471S27114458x471adjective having or showing strong interest or desire: he was primarily motivated by the desire for profit.
            verb to stimulate (someone's) interest in or desire for doing something: I'm going to motivate kids to exercise.
            noun a strong interest or desire: escape can be a strong motivation for travel.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d9\ude61\ud8e2\ude61\ud8e2\ude75.mov"} {s 33W u!9frost2021/05/02 15:56:012026/05/08 23:22:33AS1dc40S2fe00S15a18S2fe00S21406S20500S15a40S2fe00S15a48S2fe00S38006S22a04S22a14M524x544S15a18478x465S1dc40491x456S15a40511x499S15a48478x499S22a04511x529S22a14477x529noun a person who practices or studies law.
            • a person who offers legal services.
            • a person who is qualified in law but not necessarily practicing.
            Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d4\udec1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"} 2 33g!A!Gfrost2021/05/03 17:17:492026/06/16 18:45:20AS18551S2fe00S17648S2fe00S21400S28802S22105S20700M528x519S17648473x503S18551482x490S28802506x482S22105478x489M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M541x522S17648460x506S18551469x493S28802493x485S14c10518x479 S38800464x496You might be looking for include.Adam Frost{"video":"dominance: right;"} /& 33g !gfrost2021/05/03 17:19:052026/05/02 22:13:34AS20320S2fe00S10006S11520S14720S19220S2a20cS14a20S16d20S1fb20M519x590S20320498x410S11520498x429S14720499x463S19220498x505S2a20c482x489S14a20498x528S16d20497x547S1fb20498x571noun
            1. a topic.
            2. a citizen or member of a state other than its supreme ruler: the legislation is applicable only to British subjects.
            3. Grammar a noun phrase functioning as one of the main components of a clause, being the element about which the rest of the clause is predicated.
            Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8c2\udc01\ud8c6\udec1\ud8cd\udee1\ud8e7\udccd\ud8c6\udfe1\ud8ca\udd01\ud8d7\ude41.mov"} v 33A {!Ofrost2021/05/03 17:20:572026/05/02 22:14:34AS17620S2fe00S10006S14720S19220S2a20cS14a20S16d20S1fb20M519x574S17620498x427S14720499x447S19220498x489S2a20c482x473S14a20498x512S16d20497x531S1fb20498x555noun
            1. a thing.
            2. a person or thing to which a specified action or feeling is directed: disease became the object of investigation.
              • a goal or purpose: the Institute was opened with the object of promoting scientific study.
            3. Grammar a noun or noun phrase governed by an active transitive verb or by a preposition: in Gaelic the word order is verb, subject, object.
            Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cb\udc61\ud8fc\udc61\u00d8\ud8c6\udec1\ud8cd\udee1\ud8e7\udccd\ud8c6\udfe1\ud8ca\udd01\ud8d7\ude41.mov"}  33[ !}frost2021/05/03 20:44:152026/05/07 17:21:58AS15a10S2fe00S15a1aS2fe00S21414S20e00S27102M524x520S15a1a497x508S15a10509x486S20e00495x494S27102477x480noun the area of variation between upper and lower limits on a particular scale: it's outside my price range.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd1\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8e2\ude63.mov"}B 33A e!}frost2021/05/03 20:38:322025/02/15 02:21:03AS14402S2fe00S14409S2fe00S21407S20500S2880bM543x519S14402488x481S14409458x490S2880b523x486noun an arch of colors formed in the sky in certain circumstances, caused by the refraction and dispersion of the sun's light by rain or other water droplets in the atmosphere: all the colors of the rainbow.
            adjective multi-colored a big rainbow packet of felt pens.Adam Frost{"video":"dominance: right;\\n\ud8c6\udd83\ud8fc\udc61\ud8c6\udd8a\ud8fc\udc61\ud8d9\udf88\ud8d8\udde1\ud8e4\udf0c.mov"} wsw| 33 G!frost2021/05/03 20:59:012026/05/07 18:14:48AS14c01S2fe00S15a0aS2fe00S21410S20e00S22511S2 33g %!frost2021/05/03 20:52:042026/05/26 02:53:26AS10002S2fe00S1000aS2fe00S21406S20500S26506S26512M550x508S10002501x493S1000  33A s!}frost2021/05/03 20:48:192026/05/26 02:53:03AS15a40S2fe00S15a48S2fe00S21400S20500S2880aM523x522S15a48477x495S15a40485x478S2880a501x488preposition in or into a position immediately to one side of: I sat next to him.
            • [center to right loci] in or into the specific position immediately to one side of: the table is next to him on his right.
            adjective next to or adjoining something else: the adjacent room | the area adjacent to the fire station.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e4\udf0b.mov"}>
          4. (of hair or fur) of a reddish-brown or orange-brown color: her long, red hair | his hair was red.
          5. offensive, dated (of a people) having or regarded as having reddish skin.
          6. of or denoting the suits hearts and diamonds in a deck of cards: a red queen.
          7. (of wine) made from dark grapes and colored by their skins: a glass of red wine.
          8. denoting a red light or flag used as a signal to stop.
          9. used to denote something forbidden, dangerous, or urgent: the force went on red alert.
      2. informal, mainly derogatory (Red) communist or socialist (used especially during the Cold War with reference to the Soviet Union): the era of nuclear anxiety, the red scare and covert CIA plots.
      noun
      1. red color or pigment: their work is marked in red by the teacher | colors range from yellow to deep red | the reds and browns of wood.
        • red clothes or material: she could not wear red.
      2. a red thing: which dress - the black or the red?.
        • a red wine: good Italian reds at affordable prices | [mass noun] : a bottle of red.
        • a red light.
      3. informal, mainly derogatory (also Red) a communist or socialist.
      4. (the red) the situation of owing money to a bank or making a loss in a business operation: the company was $4 million in the red | small declines in revenue can soon send an airline plunging into the red | they would have been struggling to keep their businesses out of the red. [from the conventional use of red ink to indicate debt items]

      PHONOLOGICAL VARIANTS
      red left-handed

      INFLECTED FORMS
      red [in isolation]Adam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8f0\udc05\u00d8\ud8d9\udd41\ud8db\udfc5\ud8da\udc41.mov"} n 33' '!-frost2021/05/03 21:02:242026/05/17 18:40:04AS14c00S2fe00S14c08S2fe00S38006S22510S22510S23600S23614M542x533S14c00511x483S14c08468x483S22510512x468S22510468x468S23600503x516S23614459x516noun combustion or burning, in which substances combine chemically with oxygen from the air and typically give out bright light, heat, and smoke: his house was destroyed by fire.
      • a destructive burning of something: a fire at a hotel.
      • one of the four elements in ancient and medieval philosophy and in astrology: [as modifier] : a fire sign.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udc81\ud8fc\udc61\ud8c7\udc89\ud8fc\udc61\ud8fc\udc07\ud8db\uddf1\ud8db\uddf1\ud8dd\udc41\ud8dd\udc55.mov"} } 33) !ofrost2021/05/03 21:03:182026/05/04 02:44:25AS20320S2fe00S10006S14020S19a20M518x537S20320497x464S14020483x483S19a20490x517noun the region of the atmosphere and outer space seen from the earth: hundreds of stars shining in the sky.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8c6\udc21\ud8ce\udde1.mov"} ]] 33C Y!Afrost2021/05/03 21:06:292026/05/17 18:40:56AS14c00S30006S10006S26a00S18501M550x518S2ff00482x483S14c00525x482S26a00523x466S18501523x444noun the area beyond the boundaries or confines of a place: the dog was still barking outside | it was warm enough to eat outdoors.
      adjective [attributive]
      1. done, situated, or used in the area beyond the boundaries or confines of a place: put the outside lights on | a huge outdoor concert.
        • (of a person) fond of the open air or open-air activities: a rugged, outdoor type.
      2. not belonging to or coming from within a particular group: I have some outside help.
        • beyond one's own immediate personal concerns: I was able to face the outside world again.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udc81\ud8f0\udc07\u00d8\ud8e1\udfc1\ud8cc\udde2.mov"}7S1f759502x484S1f751500x496S20600477x494M538x540S2ff00482x483S20310492x519S20e00518x528S26a00511x512noun
      1. a naturally occuring solid mineral object: the crowd threw a few rocks and dispersed.
        • [often in combination] a valuable stone.
      2. the solid mineral material forming part of the surface of the earth and other similar planets, exposed on the surface or underlying the soil or oceans: the beds of rock are slightly tilted | [as modifier] : a spectacular rock arch.
        • a mass of rock projecting above the earth's surface or out of the sea: there are dangerous rocks around the island.

      SIGN VARIATIONS
      stone (sense 1) with fist under the chinAdam Frost{"video":"dominance: right;\\n\ud8d7\udcf2\ud8fc\udc61\ud8d7\udcfa\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} they have made Provence their home.
    2. a place where something flourishes, is most typically found, or from which it originates: Piedmont is the home of Italy's finest red wines.
    3. an institution for people needing professional care or supervision: an old people's home.
    adjective
    1. relating to the place where one lives: I don't have your home address.
    2. relating to one's own country and its domestic affairs: Japanese competitors are selling cars for lower prices in the US than in their home market.

    PHONOLOGICAL VARIANTS
    home with no displacement
    home with single movement
    home left-handedAdam Frost{"video":"dominance: right;\\n\ud8cc\uddf8\ud8f0\udc06\u00d8\ud8d8\udde1\ud8e1\udde5\ud8d8\udde1.mov"} I 335K!efrost2021/05/07 17:58:092026/09/20 16:37:31AS1f751S2fe00S1f759S2fe00S21400S20600M524x51'33i/!Yfrost2021/05/07 17:29:122026/06/05 17:15:31AS10000S30004S10006S20e00S22a04S21600M527x553S2ff00482x483S10000487x511S20e00514x514S22a04514x528S21600516x545S38b00470x493 M518x553S2ff00482x483S10008498x511S20e00474x514S22a14473x528S21600476x545 S38b04470x493 S38a00464x490 M533x553S2ff00482x483S10000487x511S20e00514x514S22f04508x528S21800511x545adjective
    1. of a color at the end of the spectrum next to orange and opposite violet, as of blood, fire, or rubies: her red lips | the sky was turning red outside.
      • (of a person's eyes) bloodshot or having pink rims, especially with tiredness or crying: her eyes were red and swollen.used to mark a question that seeks confirmation or expresses stance.
        • with a polar question: do you like my dress?.
        • with a polite or socially softened request: hello, what's your name? | how are you?.
        • with a question expressing challenge, warning, or disapproval: where do you think you're going?.
        • with a question expressing shock or surprise: who told you that?.
      • used to mark a clause or phrase that introduces or elaborates information.
        • with a conditional clause: if you’re hungry, there’s food in the kitchen.
        • with a relative clause: the woman who works at the front desk is very helpful.
        • with a topicalized phrase: that teacher, everyone loves her.
        • with a rhetorical clause: why did I quit my job—the pay was lousy.
    Adam Frost{"video":"dominance: equal;\\n\ud8f0\udfc1.mov"} 8/8h33Oco!Yfrost2021/05/08 17:24:002026/05/24 18:10:12AS18517S30005S10006S20500S26504S20500M553x536S2ff00482x483S18517512x509S20600531x504S26504535x518S38b00470x493 M548x536S2ff00482x483S18517512x509S20600526x506 M531x536S2ff00482x483S18517512x509 M518x536S2ff00482x483S1851f467x509S20600445x504S26514449x518 S38b04470x493noun
    1. the place where one lives permanently, especially as a member of a family or household: I was nineteen when I left home and went to college |M 33O c!frost2021/05/07 18:03:482026/05/28 19:50:22AS11a20S2fe00S10006S11520S14720S19a20M514x557S11a20493x443S11520493x477S14720494x511S19a20486x537noun a precious stone consisting of corundum in color varieties varying from deep crimson or purple to pale rose.
      • an intense purplish-red color.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c2\udde1\ud8fc\udc61\u00d8\ud8c2\udc01\ud8c6\udec1\ud8ce\udde1.mov"}f technology) producing relatively few or no net emissions of greenhouse gases: significant policy measures to boost clean energy were lacking | the global push for clean power sources | clean and renewable energy resources.
    2. relating to a diet consisting primarily of unprocessed and unrefined food: you have to eat clean foods to change your physique.
    3. free from or producing relatively little radioactive contamination.
    4. morally uncontaminated; pure; innocent: clean living.
      • not sexually offensive or obscene: it's all good clean fun | even when clean, his verses are very funny.
      • showing or having no record of offenses or crimes: a clean driving license is essential for the job.
      • played or done according to the rules: it was a good clean fight.
      • [predicative] informal not possessing or containing anything illegal, especially drugs or stolen goods: I searched him and his luggage, and h[h}! 33E k!mfrost2021/07/13 16:24:252026/05/25 22:07:01AS30c00M518x518S30c00482x483affix used to mark a question seeking specific content information.
        • with an overt interrogative: where is next week's meeting?.
        • seeking explanatory or elaborative information: you like him?
        Adam Frost{"video":"dominance: equal;\\n\ud8f1\udc81.mov"}" 33E 5!mfrost2021/07/13 16:09:402026/05/25 22:28:57AS30a00M518x518S30a00482x483affix
          <! 33 !)frost2021/06/17 17:15:332026/04/26 20:45:25AS11010S30006S10006S27100M552x518S11010523x485S2ff00482x483S27100512x465noun a passenger vehicle powered by electricity obtained from an overhead cable by means of a trolley wheel.
          • a bus.
          Adam Frost{"video":"dominance: right;\\n\ud8c1\ude11\ud8f0\udc07\u00d8\ud8e2\ude61.mov"}he was clean.
        1. [predicative] informal (of a person) not taking or having taken drugs or alcohol.
        2. free from ceremonial defilement, according to Mosaic Law and similar religious codes.
    5. (of a taste, sound, or smell) giving a clear and distinctive impression to the senses; sharp and fresh: clean, fresh, natural flavors.
    adverb so as to be free from dirt, marks, or unwanted matter: the room had been washed clean.
    • in a way that involves the consumption of unprocessed, unrefined, and nutrient-rich food: plain oatmeal is a staple for anyone who's eating clean.
    verb [with object] to make (something or someone) free of dirt, marks, or mess, especially by washing, wiping, or brushing: clean your teeth properly after meals | chair covers should be easy to clean.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde8.mov"}  #< 5-$ 33E K!mfrost2021/07/13 17:11:422026/05/31 01:54:35AS36100M518x518S36100482x483affix
    1. used to mark something as extreme, intense, hard, or stressed.
    2. used to mark something as extremely close in distance.
    Adam Frost{"video":"dominance: equal;\\n\ud8f9\udc61.mov"}c# 33E 7!mfrost2021/07/13 16:51:182026/05/31 01:52:14AS34700M518x518S34700482x483affix used to mark something as more than normal, regular, average, or medium.Adam Frost{"video":"dominance: equal;\\n\ud8f6\udea1.mov"}Y" 33E #!mfrost2021/07/13 16:48:322026/05/31 01:45:27AS33b00M518x518S33b00482x483affix used to mark something as normal, regular, average, or medium.Adam Frost{"video":"dominance: equal;\\n\ud8f5\ude21.mov"}  ' 33E !mfrost2021/07/13 17:31:502026/05/31 01:44:08AS30126M518x524S30126482x476exclamation used to give a negative response: “Is anything wrong?” “No.”.
    affix used to mark negation.Adam Frost{"video":"dominance: equal;\\n\ud8f0\udc87.mov"}& 33E )!mfrost2021/07/13 17:25:452026/05/31 01:50:39AS34400M518x518S34400482x483affix
    1. used to mark something as smooth, easy, or elegant.
    2. used to mark something as small or tiny in size.
    Adam Frost{"video":"dominance: equal;\\n\ud8f6\udd81.mov"}x% 33 !frost2021/07/13 17:18:372026/05/31 01:55:09AS36100S34700M518x529S36100482x471S34710493x516S2ff10482x500affix used to mark something as big or large in size.Adam Frost{"video":"dominance: equal;\\n\ud8f9\udc61\ud8f6\udea1.mov"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx A AE* 33 !frost2021/07/15 00:33:302026/06/12 18:55:35AS33b00S34700M518x530S33b00482x471S34710493x517S2ff10482x501affix used to mark something as occurring at last, typically after difficulty or delay: [with adverb] : I finally met your favorite teacher | [with verb] : he finally arrived to join us.Adam Frost{"video":"dominance: equal;\\n\ud8f5\ude21\ud8f6\udea1.mov"}O) 33E !mfrost2021/07/15 00:07:172026/05/31 01:44:57AS32a00M518x518S32a00482x483affix used to mark something as full or filled to the max.Adam Frost{"video":"dominance: equal;\\n\ud8f3\udfc1.mov"}( 33E -!mfrost2021/07/13 17:40:222026/05/31 01:44:19AS30120M518x523S30120482x477exclamation used to give a affirmative response: “Do you understand?” “Yes.”.
    affix used to mark affirmation.Adam Frost{"video":"dominance: equal;\\n\ud8f0\udc81.mov"} 0.0z, 33O k!Yfrost2021/10/09 23:13:032025/10/26 23:07:16AS1f527S30005S10006S20500S26504S20500M554x538S2ff00482x483S1f527510x512S20600532x509S26504536x523adverb on the day before, typically the day before today: he returned to a hero's welcome yesterday.
    • used in reference to a particular time period on the day before today: my wife had a baby boy yesterday morning | the decision was the result of a meeting late yesterday afternoon.
    • in the recent past: everything seems to have been built yesterday.
    noun the day before, typically the day before today: yesterday was Tuesday.Adam Frost{"video":"dominance: right;\\n\ud8d7\udc08\ud8f0\udc06\u00d8\ud8d8\udde1\ud8e1\udde5\ud8d8\udde1.mov"}N+ 33E !mfrost2021/07/23 17:49:592026/05/31 01:52:47AS35000M518x518S35000482x483affix used to mark something as serious, strong, or deep.Adam Frost{"video":"dominance: equal;\\n\ud8f7\ude01.mov"}ore sells hi-fis, TVs, videos, and other electrical goods    .
  • [no object] to be purchased in specified amounts or for a specified price: the album sold 6 million copies in the United States | this magazine of yours won't sell | these antiques of the future sell for about $375.
    • noun
    1. the exchange of a commodity for money; the action of selling something: we withdrew it from sale | the sale has fallen through.
      • (sales) a quantity or amount sold: price cuts failed to boost sales.
      • (sales) the activity or business of selling products: director of sales and marketing.
    DERIVATIVES
    store noun
    Adam Frost{"video":"dominance: equal;\\n\ud8cc\ude02\ud8fc\udc61\ud8cc\ude0a\ud8fc\udc61\ud8fc\udc07\ud8eb\udec1\ud8eb\uded2.mov"}ich is good | [as exclamation] : Good! The more people the better!.
  • having the qualities required for a particular role: the schools here are good.
  • possessing or displaying moral virtue: I've met many good people who made me feel ashamed of my own shortcomings.
    • auxiliary verb
    1. indicates an action has been completed, finalized, or is no longer ongoing: I have asked her | they fixed the problem.
    adjective
    1. having been completed or brought to an end: a finished product | the work is all done.
      • (of a person) having completed an activity: I’m through with my homework.
      • [predicative] having no prospect of any future relationship, dealings, or success: she told him she was through with him | you and I are through.
    adverb
    1. before or by now or the time in question: she is already here.
    Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcb1\ud8fc\udc61\ud8c7\udcb9\ud8fc\udc61\ud8fc\udc07\ud8e7\udcc5\ud8e7\udcdd.mov"} L1C33[_U!}frost2021/10/30 19:56:542026/06/15 17:43:05AS10020S2fe00S10028S2fe00S38006S2b700S2b711M522x528S10020507x498S10028479x498S2b700502x472S2b711480x472S38b00470x493 M522x532S10020507x495S10028479x502S2b700502x469S2b711480x476 M510x528S10020495x498S2b700490x472 M510x528S10028490x498S2b711491x472 S3 ==?D33[I!}frost2021/10/30 19:57:532026/05/26 02:59:17AS10000S2fe00S10008S2fe00S38006S2b704S2b715M519x529S10000504x472S10008482x472S2b704502x505S2b715485x505S38b00470x493 M519x533S10000504x476S10008482x467S2b704502x509S2b715485x500 M509x529S10000494x472S2b704492x505 M509x529S10008492x472S2b715495x505 S38b04470x493verb [front to center loci] a derivative of go to: Jessica came to my school | when are you coming home?

    PHONOLOGICAL VARIANTS
    come with right hand closer to body
    come right-handed
    come left-handedAdam Frost{"video":"dominance: equal;\\n\ud8c0\udc01\ud8fc\udc61\ud8c0\udc09\ud8fc\udc61\ud8fc\udc07\ud8e9\udca5\ud8e9\udcb6.mov"} FQFpG33AI!}frost2021/10/30 20:05:372026/05/21 01:31:25AS10010S2fe00S15a18S2fe00S21406S20500S2c300M515x538S15a18ԃ F 33[ ]!}frost2021/10/30 20:02:082025/11/02 16:58:37AS10041S2fe00S15a39S2fe00S21400S20e00S2ea00M528x521S15a39473x479S10041482x491S20e00497x490S2ea00513x483adverb occasionally, rather than all of the time: sometimes I want to do things on my own.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc42\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8ed\udfc1.mov"}+E 33 I!)frost2021/10/30 20:01:062025/12/29 19:33:48AS15a50S2fe00S10006S23f03M519x517S15a50481x483S23f03496x496adverb
    1. at no time in the past or future; on no occasion; not ever: they had never been camping in their lives | I will never ever forget it.
    2. not at all: he never turned up.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\u00d8\ud8dd\udfa4.mov"}s) not to be shared with or revealed to others: she felt awkward intruding on private grief.
  • (of a person) not choosing to share thoughts and feelings with others: he was a very private man.
  • (of a meeting or discussion) involving only a small number of people and dealing with matters that are not to be disclosed to others: this is a private conversation.
  • (of a place) quiet and free from people who can interrupt: can we go somewhere a little more private?.
  • (of a person) having no official or public role or position: the paintings were sold to a private collector.
    • not connected with one's work or official position: he would continue to represent her in a private capacity as advisor and confidant.
  • (of a service or industry) provided or owned by an individual or an independent, commercial company rather than by the government: research projects carried out by private industry | more than 1,400 s eH 33 9!frost2021/10/30 20:17:322026/05/03 21:20:22AS1c501S38517S1c509S38511S21100S21100S22a04S22a14M533x530S1c501508x470S1c509468x470S21100503x498S21100485x498S22a04503x515S22a14485x515adjective (of a person) in a state of general unhappiness or despondency.
    • (of a person) suffering from clinical depression.
    Adam Frost{"video":"dominance: equal;\\n\ud8d2\udde2\ud8fc\uddf8\ud8d2\uddea\ud8fc\uddf2\ud8d9\ude61\ud8d9\ude61\ud8db\udfc5\ud8db\udfd5.mov"}tate enterprises that were about to go private.
    • relating to a system of education or medical treatment conducted outside the system of government and charging fees to the individuals who make use of it: private education | if I could afford it I'd go private.
    • relating to or denoting a transaction between individuals and not involving commercial organizations: it was a private sale—no agent's commission.
    noun something that is kept or meant to be kept unknown or unseen by others: a state secret | at first I tried to keep it a secret from my wife.
    • something that is not properly understood; a mystery: I'm not trying to explain the secrets of the universe in this book.
    • a valid but not commonly known or recognized method of achieving or maintaining something: the secret of a happy marriage is compromise.
    Adam Frost{"video":"dominance: right;\\n\ud8d7\udcb2\ud8f5\udee1\u00d8\ud8d8\ude41.mov"} UUI 33[ !}frost2021/10/30 20:19:412026/10/07 00:20:33AS14c30S2fe00S14c38S2fe00S38006S2a204S2a21cM531x531S14c30506x469S14c38470x469S2a204508x503S2a21c470x503
    verb
    1. to bring (a task or activity) to an end: they were straining to finish the job | [with present participle] : we finished eating our meal.
      • [no object] to reach the end of one activity before proceeding to another: the student studied at the library, then went to class.
      • to consume or get through the final amount or portion of (something, especially food or drink): finish your fajita while it's still hot.
      • [no object] (of an activity) to come to an end: the war has finished but nothing has changed.
      • to reach the end of a race or other sporting competition, typically in a particular position: [with complement] : she fini2S33b00482x483S1f711482x510S2c601515x503S18218520x479S1f741527x483verb to put or keep out of sight, or from the view or notice of others: he hid the money in the house | the sacred relic had been hidden away in a sealed cavern.
        • (of a thing) to prevent (someone or something) from being seen: clouds hid the moon.
        • to keep secret or unknown: Hal could hardly hide his dislike.
        • [no object] to conceal oneself: Juliet's first instinct was to hide under the blankets | he had a little money and could hide out until the end of the month.
        • (hide behind) [no object] to use (someone or something) to protect oneself from criticism or punishment, especially in a way considered cowardly or unethical: companies and manufacturers with poor security can hide behind the law.
        Adam Frost{"video":"dominance: right;\\n\ud8d7\udcb2\ud8f5\udee1\ud8cc\udcd9\ud8fc\udc61\ud8d8\udde1\ud8ea\ude42\ud8d7\udce2\ud8d9\udf85\ud8d8\udde1.mov"}[with object] : search our online archive for stories dating back to February 1996 | I must search the internet for one of his pictures.
    noun
    1. an act of searching for someone or something: the police did a thorough building search | he plans to go to the Himalayas in search of a yeti.
    2. an act or instance of looking for information on the internet or in a database using a search engine: internet searches.
      • Computing the systematic retrieval of information, or the facility for this: the advanced search includes options for sorting by date and specifying the news source | [as modifier] : users will abandon a site if the search function doesn't work well.
    3. Law an investigation of public records to find if a property is subject to any liabilities or encumbrances: banks will do a lien search before approving.
    Adam Frost{"video":"dominance: right;\\n\ud8ca\udcf1\ud8ef\udfa1\u00d8\ud8ed\udde1.mov"} cctK 33 M!-frost2021/10/30 20:24:522026/06/22 17:52:19AS1f711S33d00S18218S2fe00S20500S2c601S1f741S21404S20500M548x53 J 33 s!)frost2021/10/30 20:23:552026/06/22 17:28:53AS1f711S33d00S10006S20600M528x532S33b00482x483S1f711482x510S20600506x518adjective
    1. not known or seen or not meant to be known or seen by others: how did you guess I had a secret plan? | the relationship was kept secret from the world for five years.
      • [attributive] not meant to be known as such by others: a secret santa.
    2. belonging to or for the use of one particular person or group of people only: all bedrooms have private facilities | his private plane.
      • (of a situation, activity, or gathering) affecting or involving only a particular person or group of people: a small private service in the chapel.
      • (of thoughts and feeling a body had been found.
        • to discover (someone or something) after a deliberate search: in this climate it could be hard to find a buyer.
        • to ascertain (something) by study, calculation, or inquiry: a forum that attempts to find solutions for multimedia publishers.
        • (find oneself) to discover the fundamental truths about one's own character and identity: I did psychotherapy for years—I wanted to find myself.
        • (find oneself) to discover oneself to be in a surprising or unexpected situation: phobia sufferers often find themselves virtual prisoners in their own home.
        • to succeed in obtaining (something): she also found the time to raise five children.
      • to collect something or someone that has been left elsewhere: Wanda came over to pick up her things | will you pick the children up from school?.
    Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd1\ud8fc\udc61\u00d8\ud8dc\udd41\ud8d3\udd61.mov"}y.
  • to cause (someone) to have a strong urge to choose a particular career or way of life: he was called to the priesthood | I think teachers, really good teachers, are called to teach.
  • [with object] to announce or decide that (an event, especially a meeting or election) is to happen: there appeared to be no alternative but to call a general election | she intends to call a meeting of the committee early next week.
  • to move one's hand with gentle pressure over (a surface): he put his hand on her hair and stroked it.

    • PHONOLOGICAL VARIANTS
    summon/stroke with flat base hand

    INFLECTED FORMS
    pet (verb) [frequentative]Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udde5\ud8d7\udcc1.mov"} K(KQM 33) W!Afrost2021/10/30 20:31:542025/03/12 19:55:55AS14c50S2fe00S10006S22e00S1ce20M513x543S14c50487x512S22e00491x491S1ce20491x457verb
    1. to discover by chance or unexpectedly: the remains ofLL 33 q!)frost2021/10/30 20:29:002026/05/17 21:15:33AS16d10S2ff00S10006S2e500M538x531S2ff00482x483S16d10507x484S2e500515x504verb [no object]
      1. to try to find something by looking or otherwise seeking carefully and thoroughly: I searched among the rocks, but there was nothing | Hugh will be searching for the truth.
        • [with object] to examine (a place, vehicle, or person) thoroughly in order to find something or someone: she searched the house from top to bottom | the guards searched him for weapons.
      2. to look for information on the internet or in a database using a search engine: you can search for recipes by topic or by entering a keyword | | [no object] : Andrew couldn't see out of his left eye | I could see through the windows.
        • [with clause] to be or become aware of something from observation or from a written or other visual source: I see from your appraisal report that you have asked for training.
        • to be a spectator of (a film, game, or other entertainment); watch: I went to see King Lear at the Old Vic.
        • [in imperative] to refer to (a specified source) for further information (used as a direction in a text): elements are usually classified as metals or non-metals (see chapter 11).
      3. to discern or deduce mentally after reflection or from information; understand: I can't see any other way to treat it | [with clause] : I saw that perhaps he was right | she could see what Rhoda meant.
        • [with clause] to ascertain after inquiring, considering, or discovering an outcome: I'll go along to the club and see if I can get a game.
        • [with object and adverbial] to regard in a specified way: he saw himself as a good teacher | you and I see things differently.
        • to foresee; view or predict as a possibility: I can't see him earning any more anywhere else.
      4. to experience or witness (an event or situation): I shall not live to see it | [with object and complement] : I can't bear to see you so unhappy.
      5. to meet (someone one knows) socially or by chance: I saw Colin last night.
        • to visit (a person or place): I went to see Caroline | see Alaska in style.
        • to meet regularly as a boyfriend or girlfriend: some guy she was seeing was afraid of commitment.
        • to consult (a specialist or professional): you may need to see a solicitor.
        • to give an interview or consultation to: the doctor will see you now.
      Adam Frost{"video":"dominance: right;\\n\ud8c1\udd41\ud8f1\udf91\u00d8\ud8d8\udde1\ud8e1\udde1.mov"} S5N33gSE!frost2021/10/30 20:36:352026/09/20 16:39:33AS15a50S2fe00S2035aS2fe00S21400S20500S26504S1f720M510x536S2035a490x464S15a50497x473S26504496x503S1f720490x521S38b00470x493 M514x536S15a5a487x464S15a50497x473S26504496x503S1f720490x521 S38b04470x493 S38a00464x490 M524x518S2035a476x482S15a50483x491S20e00505x491S22114498x506verb
      1. [with object] to order or request the attendance of: representatives of all three teams have been called to appear before the stewards | I got a letter calling me for an interview.
        • to bring (a witness) into court to give evidence: four expert witnesses were called.
        • to draw critical attention to someone's unacceptable actions or behavior: she called him on his claim that the media were doing a bad job of covering the econom 77EO 33[ Q!}frost2021/10/30 20:37:552026/05/26 02:54:56AS15a30S2fe00S15a38S2fe00S38006S2880aS2881aM536x519S15a30503x492S15a38464x492S2880a514x481S2881a475x481verb [left to right loci] to take or go with (someone or something) to a place: she brought Luke home from the hospital | [with two objects] : wake up—I've brought you some coffee.
          • to bring and hand over (a letter, parcel, or ordered goods) to the proper recipient or address: the products should be delivered on time | [no object] : we'll deliver direct to your door.
          Adam Frost{"video":"dominance: right;\\n\ud8c8\uddf1\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8fc\udc07\ud8e4\udf0b\ud8e4\udf1b.mov"} SEP 33C %!Afrost2021/11/12 17:16:382025/03/04 19:38:11AS10011S33200S10006S20e00S26502M523x535S33100482x483S10011502x505S20e00488x520S26502470x519adjective
          1. not genuine; counterfeit: fake designer clothing | expressing fake emotions.
          2. (of a person) claiming to be something that one is not: a fake doctor.
          noun
          1. a thing that is not genuine; a forgery or sham: the painting was a fake.
          2. a person who appears or claims to be something that they are not: I felt sure that some of the nuns were fakes.
          combining form denoting a relationship resulting from a remarriage, especially one considered to be fake or false: stepmother.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f4\udec1\u00d8\ud8d9\udd41\ud8e1\udde3.mov"} Q 33 +!)frost2021/11/13 03:10:272026/05/30 16:52:13AS15a01S38510S10006S20500M513x514S15a01490x486S20500487x503possessive determiner [at center locus] belonging to or associated with a person or thing: my name is John | my friend.
          possessive pronoun [at center locus] used to refer to a thing or things belonging to or associated with a person or thing: their car is larger than mine | that's mine.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc2\ud8fc\uddf1\u00d8\ud8d8\udde1.mov"} bXR33!)frost2021/11/13 03:11:312026/07/31 18:14:32AS15a28S2fe00S10006S26500M507x523S15a28494x496S26500493x477M513x520S15a28488x493S26507500x481 M513x520S15a28501x493S26501488x481possessive determiner [at front locus] belonging to or associated with a person or thing: what is your name?.
          possessive pronoun [at front locus] used to refer to a thing or things belonging to or associated with a person or thing: my car is newer than yours | this is yours.

          INFLECTED FORMS
          his/her/its/their [at right front locus]
          his/hers/theirs [at left front locus]Adam Frost{"video":"dominance: right;\\n\ud8c8\udde9\ud8fc\udc61\u00d8\ud8e1\udde1.mov"}o be killed for (a cause): they were prepared to die for their country.
        • (die out) to become extinct: many species died out.
        • (die off) to die one after another until few or none are left: the original founders died off or retired.
        • informal (of a machine) to stop functioning or run out of electric charge: three toasters have died on me | my cell phone died while I was trying to contact him.
        adjective
        1. no longer alive: a dead body | he has been dead for many years | [as complement] : he was shot dead by a sniper.
          • (of a part of the body) having lost sensation; numb: I severed nerves in my leg so part of my foot is dead.
          • devoid of living things: a dead planet.
        2. (of a place or time) characterized by a lack of activity or excitement: Brussels isn't dead after dark, if you know where to look.
        3. (of a piece of equipment) no longer functioning, especially because of a fault: the phone had gone dead.
        4. (of an electric circuit or conductor) carrying or transmitting no current: the batteries are dead.
        5. Computing (of a link) pointing or connected to a destination that has been deleted or moved, or is no longer functioning: the original post was at this URL, which is now a dead link.
        noun the action or fact of dying or being killed; the end of the life of a person or organism: an increase in deaths from skin cancer | I don't believe in life after death | [as modifier] : a death sentence.
        • the state of being dead: even in death, she was beautiful.
        • the permanent ending of vital processes in a cell or tissue.

        PHONOLOGICAL VARIANTS
        die right-handedAdam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8fc\udc07\ud8e7\udcc9\ud8e7\udcd9.mov"} lT 33[ !}frost2021/11/13 22:16:162026/04/12 02:37:42AS10050S2fe00S15a36S2fe00S21400S20e00S2d506M529x519S15a36471x507S10050476x482S20e00496x497S2d506509x488noun the next period of seven days starting on Sunday: next week is my birthday.
        adverb during the next period of seven days starting on Sunday: they fly in next week.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc51\ud8fc\udc61\ud8c8\uddf7\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8eb\udfe7.mov"}pS 33) !Afrost2021/11/13 21:27:482026/05/17 23:09:12AS10e00S31410S10006S20500S26500M531x529S2ff00482x483S10e00510x499S26500517x480verb
        1. to perceive with the eyes; discern visually: in the distance she could see the blue sea S16d39495x493S16d51486x496S20800492x484verb to enter into a legal and/or formal union with someone as husband or wife: I was married in church | he was engaged to get married to Ginger | the priest who married us.
          • to take (someone) as one's wife or husband: Eric asked me to marry him.
          • [no object] to enter into a legal and/or formal union: they had no plans to marry.
          noun the legally or formally recognized union of two people as partners in a personal relationship (historically and in some jurisdictions specifically a union between a man and a woman): a happy marriage | the children from his first marriage | [as modifier] : marriage vows.
          • the state of being married: they were celebrating 50 years of marriage.
          Adam Frost{"video":"dominance: right;\\n\ud8ca\udd32\ud8fc\udc61\ud8ca\udd1a\ud8fc\udc61\ud8d9\udf81\ud8d8\udf01.mov"}ting children: Ryder's children did not go to school at all | [as modifier] : school supplies.
          • the buildings used by an institution for educating children: the cost of building a new school.
          • [treated as plural] the students and staff of a school: the principal was addressing the whole school.
          • a day's work at school: school started at 7 a.m.
        2. any institution at which instruction is given in a particular discipline: a dancing school | a police academy.
          • informal a university: Harvard is certainly not a loafer's school.
          • a department or faculty of a college concerned with a particular subject of study: the School of Dental Medicine.
        adjective relating to education and scholarship: academic achievement | he had no academic qualifications.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} ^^U33[ m!}frost2021/11/14 18:59:412026/06/17 16:58:00AS15a50S2fe00S15a38S2fe00S38006S2a208S2a218M528x530S15a50509x503S15a38478x503S2a208505x470S2a218473x470S38b00470x493 M518x522S15a50483x495S2a208495x478 S38b04470x493verb (of a person, animal, or plant) to stop living: [with object] : the king died a violent death | she died of cancer | the sheep died from the heat.
        • (die for) t L>V33[_!!Kfrost2021/11/18 01:15:372026/10/10 20:37:17AS17640S2fe00S17648S2fe00S38005S26902S26916M528x521S17640512x505S17648473x480S26902491x505S26916491x480M511x575S17620490x425S1ce20489x445S1ce20489x479S19220490x513S16d20489x536S14a20490x560 M524x526S15a40512x499S15a48476x474S26902491x507S26916491x482 M508x508S17620492x492
          noun
          1. an office.
          ORIGIN
          based on room with O hands.
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\nvisible: sign;\\n\ud8cb\udc81\ud8fc\udc61\ud8cb\udc89\ud8fc\udc61\ud8fc\udc06\ud8e1\udf63\ud8e1\udf77.mov"} W 33) S!Afrost2021/11/29 20:46:522025/02/18 18:12:48AS14c27S30004S10006S20500S22517M542x535S2ff00482x483S14c27504x508S22517524x498noun a woman in relation to her child or children, though might be viewed as slightly more traditional or formal than mom: his mother was a painter | a mother of three | she returned to Bristol to nurse her aging mother.Adam Frost{"video":"dominance: right;\\n\ud8c7\udca8\ud8f0\udc05\u00d8\ud8d8\udde1\ud8db\uddf8.mov"} sY 33M ;!}frost2021/11/29 20:57:312025/07/20 16:29:32AS14c27S30004S10006S20500S14c20S30007S10006S20500M530x535S2ff00482x483S14c27504x508S20500517x482noun a father or mother: the parents of the bride | his adoptive parents.Adam Frost{"video":"dominance: right;\\n\ud8c7\udca8\ud8f0\udc05\u00d8\ud8d8\udde1\ud8c7\udca1\ud8f0\udc08\u00d8\ud8d8\udde1.mov"}X 33) ?!Afrost2021/11/29 20:48:022025/02/18 23:58:17AS14c20S30007S10006S20500S22510M538x518S2ff00482x483S14c20515x472S22510515x456noun a man in relation to his child or children, though might be viewed as slightly more traditional or formal than dad: Margaret's father died at an early age | they assumed that I was the father of the child.Adam Frost{"video":"dominance: right;\\n\ud8c7\udca1\ud8f0\udc08\u00d8\ud8d8\udde1\ud8db\uddf1.mov"} [Z 33A s!!frost2021/11/29 21:03:492025/02/18 23:16:29AS10e10S30005S10006S20e00S22a04S26502S30003S20e00S22a04M519x573S2ff00482x483S10e10504x505S20e00484x539S22a04483x558S26502493x548S20e00506x539S22a04506x558noun a set of or one of two children or animals born at the same birth: experiments were carried out using sets of identical twins | the twins were approaching their third birthday | I thought you must have a double or be a twin.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd51\ud8f0\udc06\u00d8\ud8d9\udd41\ud8db\udfc5\ud8e1\udde3\ud8f0\udc04\ud8d9\udd41\ud8db\udfc5.mov"} --O[ 33 !-frost2021/11/29 21:09:212025/02/19 00:20:36AS1dc27S30005S1dc0aS2fe00S20500S22a03S1dc41S21400S20500M532x571S2ff00482x483S1dc27509x501S1dc0a493x547S22a03500x524S1dc41476x532noun a woman or girl in relation to other daughters and sons of her parents: I had nine brothers and sisters.Adam Frost{"video":"dominance: right;\\n\ud8d4\udea8\ud8f0\udc06\ud8d4\ude8b\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8d4\udec2\ud8d9\udf81\ud8d8\udde1.mov"} gg\ 33 !-frost2021/11/29 21:18:122025/02/19 00:18:27AS1dc20S30007S1dc0aS2fe00S20500S22a03S1dc41S21400S20500M535x560S2ff00482x483S1dc20511x471S22a03513x513S1dc0a505x536S1dc41488x521noun
          1. a man or boy in relation to other sons and daughters of his parents: he has three older brothers | she and her brother had travelled to Jordan | he considered them to be like brothers to him.
          2. a male associate or fellow member of an organization: fraternity brothers.
          Adam Frost{"video":"dominance: right;\\n\ud8d4\udea1\ud8f0\udc08\ud8d4\ude8b\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8d4\udec2\ud8d9\udf81\ud8d8\udde1.mov"} ..N] 33{ ;!frost2021/11/29 21:39:272026/05/31 17:36:39AS1dc20S30007S1dc0aS2fe00S20500S22a03S1dc41S21400S20500S1dc27S30005S1dc0aS2fe00S20500S22a03S1dc41S21400S20500M535x615S2ff00482x439S1dc20511x427S22a03513x469S1dc0a504x492S1dc41487x477S2ff00482x527S1dc27509x545S22a03500x568S1dc0a493x591S1dc41476x576noun a brother and sister, or brothers and sisters collectively: how many brothers and sisters do you have? | my father has always supported my siblings and me.
          • a child or offspring who shares one or both parents with another: she's my favorite sibling | [as modifier] : because his brother was ten years older, there was no question of sibling rivalry between them.
          Adam Frost{"video":"dominance: right;\\n\ud8d4\udea1\ud8f0\udc08\ud8d4\ude8b\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8d4\udec2\ud8d9\udf81\ud8d8\udde1\ud8d4\udea8\ud8f0\udc06\ud8d4\ude8b\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8d4\udec2\ud8d9\udf81\ud8d8\udde1.mov"} C^ 335 !efrost2021/12/20 17:46:352026/04/11 21:22:27AS17121S2fe00S20356S2fe00S21400S20800M511x521S17121491x491S20356490x506S20800495x479adjective relating to England or its people or language.Adam Frost{"video":"dominance: right;\\n\ud8ca\ude82\ud8fc\udc61\ud8d8\udd77\ud8fc\udc61\ud8d9\udf81\ud8d8\udf01.mov"} KK1_33[#!}frost2021/12/20 17:48:562026/05/06 16:44:30AS17121S2fe00S20356S2fe00S21400S20800S26a24M514x530S17121491x482S20356490x497S20800495x470S26a24487x516S38b00470x493 M511x521S17121491x491S20356490x506S20900489x479 S38b04470x493proper noun a European country that forms the largest and most southern part of Great Britain and of the United Kingdom, surrounded on three sides by water (Irish Sea on west, English Channel on south, North Sea on east); capital, London.
          noun (the English as plural noun) the people of England.Adam Frost{"video":"dominance: right;\\n\ud8ca\ude82\ud8fc\udc61\ud8d8\udd77\ud8fc\udc61\ud8d9\udf81\ud8d8\udf01\ud8e1\udfe5.mov"} ` 33Qg!)frost2022/01/06 20:52:012026/07/23 20:47:14AS11e40S2fe00S10006S2f900M512x519S11e40489x481S2f900491x514M514x519S15a3a487x507S11e40490x482affix used to represent the position or movement of a vehicular object (such as a car, truck, bus, or bike): the bike is there near the tree | the car sped past me.
          verb a phonological variant (right handed) of park.Adam Frost{"video":"dominance: right;\\n\ud8c2\udf81\ud8fc\udc61\u00d8\ud8ef\udd61.mov"} ZRa 33 !)frost2022/01/06 21:06:422026/01/14 19:40:54AS10020S2fe00S10006S2f900M508x519S10020493x481S2f900495x514affix
          1. used to represent the position or movement of an upright vertical entity (especially a person): a man stood there near the door | she walked up to the help desk.
          2. used to represent the position or movement a long, thin entity or object: the bird flew across the sky | a snake slithered along the ground | the pencil laid on the table.
          Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ef\udd61.mov"}  c 335 !efrost2022/02/01 18:03:192026/05/17 23:26:21AS16d51S2fe00S16d39S2fe00S21400S20800M515x516ob 33'UG!Gfrost2022/01/07 19:18:572026/05/03 21:21:15AS20300S2fe00S20308S2fe00S38006S26500S26510S21b00S21b00M533x523S20300518x508S20308468x508S26500518x489S26510468x489S21b00521x478S21b00471x478M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M537x534S20308468x519S20300518x519S26500518x500S26510468x500S14c30513x466S14c38463x466 S38800464x496You might be looking for many/a lot.Adam Frost{"video":"dominance: equal;"}0340M528x529S20348484x514S14c40504x485S2880f485x490S20e00473x500S20340484x471verb
          1. to be successful in (a contest or conflict): the Mets have won four games in a row | [no object] : a determination to win | [with complement] : the Pirates won 2–1.
          2. to acquire or secure as a result of a contest, conflict, bet, or other endeavor: there are hundreds of prizes to be won | [with two objects] : the sort of play that won them the World Cup.
            • to gain (a person's attention, support, or love), typically gradually or by effort: you will find it difficult to win back their attention.
          noun a successful result in a contest, conflict, bet, or other endeavor: a win against Norway.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcc1\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e4\udf10\ud8d8\udd61.mov"} [[7e 335 s!efrost2022/10/01 20:04:422026/05/17 23:28:42AS15a51S2fe00S15a39S2fe00S21400S20600M519x519S15a39496x482S15a51482x482S20600489x508noun
          1. an institution for educa]d 33 -!)frost2022/02/13 21:37:352026/06/28 21:24:41AS10050S2fe00S10006S26506M518x515S10050483x485S26506503x495preposition from and up to (a particular point in an ordered sequence): they will be in town from March 24 through May 7.
            noun a horizontal stroke in writing or printing to mark a pause or break in sense or to represent omitted letters or words.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc51\ud8fc\udc61\u00d8\ud8e1\udde7.mov"}528x519S15a36472x507S10050477x482S20e00497x497S26506513x496M528x519S15a36472x507S10050477x482S20e00499x497S26a06514x489noun a period of seven days: the course lasts sixteen weeks.
            • the period of seven days generally reckoned from and to midnight on Saturday night: she has an art class twice a week.
            • workdays as opposed to the weekend; the five days from Monday to Friday: I work during the week, so I can only get to this shop on Saturdays.
            • the time spent working in the workday period of five to seven days: she works a 48-hour week.
            • a period of five or seven days devoted to a specified purpose or beginning on a specified day: Super Bowl week | the week of June 23.

            DERIVATIVES
            weekly [frequentative]Adam Frost{"video":"dominance: right;\\n\ud8c0\udc51\ud8fc\udc61\ud8c8\uddf7\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde7.mov"} f 33 /!frost2022/10/26 18:53:332026/06/23 16:05:08AS10e00S2fe00S16d0aS2fe00S21414S21000S22a04S11500M521x535S10e00481x465S16d0a479x497S11500479x505S21000501x491S22a04504x508predeterminer, determiner, pronoun used to refer to two people or things, regarded and identified together: [as predeterminer] : both his parents indulged him | [as determiner] : I urge you to read both books | [as pronoun] : he looked at them both.
            adverb used with two alternatives to emphasize that the statement being made applies to each: it has won favor with both young and old | they all loved to play, boys and girls both.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd41\ud8fc\udc61\ud8ca\udceb\ud8fc\udc61\ud8d9\udf95\ud8d9\ude01\ud8db\udfc5\ud8c1\udfe1.mov"}   7h 33O e!Yfrost2022/10/30 17:02:552026/01/02 18:07:32AS14c02S38510S10006S20500S26500S1bb02M516x537S1bb02488x464S14c02485x506S26500499x488S20500503x526verb to find agreeable, enjoyable, or satisfactory: people who like reading books | I like to be the center of attention | I like all Angela Carter's stories.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc83\ud8fc\uddf1\u00d8\ud8d8\udde1\ud8e1\udde1\ud8d1\ude23.mov"}4g 33g !frost2022/10/30 17:00:082026/06/16 18:45:39AS14c10S2fe00S17648S2fe00S21400S28802S18551S20700M541x522S17648460x506S18551469x493S28802493x485S14c10518x479Adam Frost{"video":"dominance: right;\\n\ud8c7\udc91\ud8fc\udc61\ud8cb\udc89\ud8fc\udc61\ud8d9\udf81\ud8e4\udf03\ud8cc\ude32\ud8d8\udea1.mov"}  i 335 o!frost2022/10/30 17:22:482026/07/19 19:46:21AS1f010S31410S1f018S31420S26a06S26a12S1f410S1f418M586x518S2ff00482x483S1f010507x489S1f018464x489S26a06540x483S26a12445x483S1f410557x489S1f418413x489noun a pair of lenses set in a frame, especially an angular or square frame, that rests on the nose and ears, used to correct or assist poor eyesight or protect the eyes.Adam Frost{"video":"dominance: equal;\\n\ud8d6\ude11\ud8f1\udf91\ud8d6\ude19\ud8f1\udfa1\ud8e1\udfc7\ud8e1\udfd3\ud8d6\udf91\ud8d6\udf99.mov"}  j 33C #!Afrost2022/10/30 17:28:242026/05/07 17:09:14AS1f020S30007S10006S26504S1f420M546x518S2ff00482x483S1f020517x447S26504529x467S1f420517x486proper noun
            1. a federally chartered university in Washington, D.C., that is dedicated to the education of the deaf and hard of hearing community; Gallaudet University.
            2. Thomas Hopkins Gallaudet (1787-1851), a US educator for the deaf.
            Adam Frost{"video":"dominance: right;\\n\ud8d6\ude21\ud8f0\udc08\u00d8\ud8e1\udde5\ud8d6\udfa1.mov"} XX$k 33' !-frost2022/10/30 17:42:332026/06/23 16:20:53AS20300S2fe00S20308S2fe00S38006S26500S26510S14c30S14c38M537x534S20308468x519S20300518x519S26500518x500S26510468x500S14c30513x466S14c38463x466determiner, adjective a large number of: [as determiner] : many people agreed with her | [as adjective] : it was one of my many errors | the possibilities are many.
            pronoun a large number of people or things: it could be the solution to many of our problems | many think it is a new craze.Adam Frost{"video":"dominance: equal;\\n\ud8d8\udd21\ud8fc\udc61\ud8d8\udd29\ud8fc\udc61\ud8fc\udc07\ud8e1\udde1\ud8e1\uddf1\ud8c7\udcb1\ud8c7\udcb9.mov"} eepm 33 i!frost2022/10/30 17:58:422026/05/31 19:01:11AS14c40S2fe00S20348S2fe00S21400S20e00S2880fS2(l 33' !-frost2022/10/30 17:50:422026/05/03 21:21:50AS20330S2fe00S20338S2fe00S38006S22a00S22a10S14c30S14c38M538x534S20330518x519S20338468x519S22a00519x500S22a10469x500S14c30514x466S14c38463x466interrogative pronoun what number or quantity a countable item or set: how many books did you sell?.Adam Frost{"video":"dominance: equal;\\n\ud8d8\udd51\ud8fc\udc61\ud8d8\udd59\ud8fc\udc61\ud8fc\udc07\ud8db\udfc1\ud8db\udfd1\ud8c7\udcb1\ud8c7\udcb9.mov"}ronoun [at front locus] used to refer to the whole quantity or extent of a particular group or thing: [as predeterminer] : all the people I met | she left him all her money | [as determiner] : 10 percent of all cars sold | carry all of the blame | [as pronoun] : four bedrooms, all with balconies | the men are all bearded.
            • [determiner] any whatever: he denied all knowledge | assured beyond all doubt.
            • [pronoun, with clause] the only thing (used for emphasis): all I want is to be left alone.
            • [pronoun] (used to refer to surroundings or a situation in general) everything: all was well | it was all very strange.
            adverb [at front locus] used for emphasis.
            • completely: dressed all in black.
            • consisting entirely of: all leather varsity jacket.
            Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8d4\udea1\ud8d4\udea1.mov"} #n 33O!;!Gfrost2022/10/30 19:21:252026/05/03 23:48:35AS15702S38510S10006S20500S26500S18501M514x534S15702486x506S20500499x523S26500495x486S18501487x467M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M517x535S14c02484x503S20500502x524S26500498x485S18501490x466 S38800464x496You might be looking for white.Adam Frost{"video":"dominance: right;"} ~~~o333;!7frost2023/07/31 00:48:592026/05/23 18:35:20AS12d00S30007S12d08S30001S20500S20500S22114S22114M533x518S2ff00482x483S12d00510x462S12d08467x462S22114506x454S22114467x454M532x518S2ff00482x483S11500510x461S11508474x462S22114506x454S22114467x454 S38a00464x490 S38b00470x493 M533x518S2ff00482x483S12d00510x462S22114506x454 M518x518S2ff00482x483S12d08467x462S22114467x454 S38b04470x493noun a phonological variant (extended thumb) of rabbit.

            PHONOLOGICAL VARIANTS
            rabbit right-handed
            rabbit left-handedAdam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8c4\udce1\ud8f0\udc08\ud8c4\udce9\ud8f0\udc02\ud8d8\udde1\ud8d8\udde1\ud8db\udc75\ud8db\udc75.mov"} *@*q 33[ k!}frost2023/09/03 00:20:552026/01/02 18:41:54AS10050S2fe00S15a36S2fe00S21400S20e00S2d50aM529x519S15a36471x507S10050476x482S20e00496x497S2d50a510x503noun the previous period of seven days starting on Sunday: last week was hot.
            adverb during the previous period of seven days starting on Sunday: there was a fire last week | he'd cut the grass a week ago.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc51\ud8fc\udc61\ud8c8\uddf7\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8eb\udfeb.mov"}noun             a phonological variant (right handed) of rabbit.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c4\udce1\ud8f0\udc08\u00d8\ud8d8\udde1\ud8db\udc75.mov"}y old job back.
          2. dating from far back; long-established or known: we greet each other like old friends.
          3. (of a form of a language) as used in former or earliest times.
      INFLECTED FORMS
      older [comparative]
      noun the length of time that a person has lived or a thing has existed: his wife and Carla are the same age.
      • [with numeral] the number of years that a person or animal has lived: he died from a heart attack at the age of 51 | he was fourteen years old | young people between the ages of 11 and 18.
      • [with numeral] the length of time in a specified unit that someone or something has existed: a seven-month-old baby.
      • a particular stage in someone's life: children of elementary school age.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udf91\ud8f0\udc05\u00d8\ud8d9\udd41\ud8db\udfc5\ud8d8\udd31.mov"} OOF>s 33A ]!}frost2023/09/10 16:44:192026/04/19 21:26:29AS14720S2fe00S14728S2fe00S21406S20500S2df04M528x513S14720489x487S14728473x487S2df04507x492verb to open a hinge barrier: he opened the door | she opened the cupboard.
      • to pull a hinged barrier to an opened position: she cranked open the window | he pulled the gate open.
      noun a door.Adam Frost{"video":"dominance: right;\\n\ud8c6\udec1\ud8fc\udc61\ud8c6\udec9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ec\udfa5.mov"}Vr33[y!}frost2023/09/03 00:22:232026/06/04 19:46:08AS10050S2fe00S15a36S2fe00S21400S20e00S26506M ht 33A 1!}frost2023/09/10 16:47:262026/01/03 22:28:44AS14720S2fe00S14728S2fe00S21406S2df0cS20500M528x513S14720489x487S14728473x487S2df0c507x492verb to close a hinge barrier: she closed the door | he shut the gate.
      • to push a hinged barrier to a closed position: she pushed the door shut | he pushed the gate shut.
      Adam Frost{"video":"dominance: right;\\n\ud8c6\udec1\ud8fc\udc61\ud8c6\udec9\ud8fc\udc61\ud8d9\udf87\ud8ec\udfad\ud8d8\udde1.mov"} Hu33A#Y!}frost2023/09/10 16:49:512026/01/02 19:52:14AS14720S2fe00S14728S2fe00S21406S20600S2e004M528x516S14720489x485S14728473x485S2e004507x488S38b00470x493 M528x513S14720489x487S14728473x487S2df04507x492 S38b04470x493noun a hinged barrier at the entrance to a building, room, or vehicle, or in the framework of a cupboard: she looked for her key and opened the door.
      • a doorway: she walked through the door.
      Adam Frost{"video":"dominance: right;\\n\ud8c6\udec1\ud8fc\udc61\ud8c6\udec9\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41\ud8ed\udc05.mov"} pp#w 33) M!ofrost2023/09/16 20:33:492026/05/26 03:31:18AS1f720S2fe00S10006S1dc20S1dc20M512x542S1f720492x459S1dc20488x478S1dc20488x512predeterminer, determiner, p ]v 33 C!frost2023/09/11 18:48:012026/05/31 18:44:13AS1a011S2fe00S1a019S2fe00S21406S20500S23804S2381cM541x532S1a019471x481S1a011501x481S20500495x468S23804524x507S2381c459x507noun a portable shelter made of cloth, supported by one or more poles and stretched tight by cords or loops attached to pegs driven into the ground.Adam Frost{"video":"dominance: equal;\\n\ud8cf\udc12\ud8fc\udc61\ud8cf\udc1a\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8dd\udd05\ud8dd\udd1d.mov"}12485x491 M512x516S14c00489x485 S38904464x493 M508x515S10000493x485 M520x520S18218481x505S18210497x499S22a00503x480 M523x518S1f540478x491S2a408498x482 S38a04464x490 M524x526S15a40512x499S15a48476x474S26902491x507S26916491x482 M512x531S14c20489x470S2e300489x504 M509x521S10000491x491S21b00501x480 M511x546S1ce20489x455S14a20490x489S14a20490x508S1fb20490x527 M538x514S15a48482x487S15a40506x487S26506523x494S26512462x494 S38800464x496 S38a00464x490 S38b00470x493 M509x521S10008494x491S21b00491x480 S38b04470x493 S38a00464x490 M512x521S10000489x491S21d00494x480number equivalent to the sum of six and five; one more than ten: the room was about eleven feet wide.

      PHONOLOGICAL VARIANTS
      eleven left-handed

      INFLECTED FORMS
      eleven [in isolation]Adam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8fc\udc61\u00d8\ud8da\ude21.mov"} x 33A!Gfrost2023/09/21 17:57:512026/05/03 23:48:50AS11010S2fe02S10006S27100M552x527S11010523x493S36d00479x523S27100512x473M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M552x518S11010523x485S2ff00482x483S27100512x465 S38800464x496You might be looking for trolley.Adam Frost{"video":"dominance: right;"} y 33C!;!Gfrost2023/09/21 18:05:082026/05/03 23:49:09AS14c00S2fe02S10006S22a04S18507M521x540S36d00479x536S14c00488x460S22a04494x493S18507489x505M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M518x571S2ff00482x483S14c00488x499S22a04494x532S18507489x544 S38800464x496You might be looking for sleep.Adam Frost{"video":"dominance: right;"} ~z 33=!Gfrost2023/09/21 18:07:032026/05/03 23:49:17AS15a02S2fe02S10006S22a04M521x519S36d00479x515S15a02485x482S22a04494x497M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M518x527S2ff00482x483S15a02485x497S22a04494x512 S38800464x496You might be looking for front.Adam Frost{"video":"dominance: right;"} U{ 33u;_!Gfrost2023/09/21 18:08:282026/05/03 21:22:27AS15a10S2fe02S15a18S2fe02S38006S26500S26510M533x528S36d00479x524S15a10520x491S15a18468x491S26500519x473S26510467x473M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M533x518S2ff00482x483S15a10520x487S15a18468x487S26500519x469S26510467x469 S38800464x496You might be looking for focus on/pay attention.Adam Frost{"video":"dominance: equal;"} | 33?!Gfrost2023/09/21 18:10:362026/05/03 23:49:25AS16d10S2fe02S10006S2e500M538x527S36d00479x523S16d10507x474S2e500515x494M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M538x531S2ff00482x483S16d10507x484S2e500515x504 S38800464x496You might be looking for search.Adam Frost{"video":"dominance: right;"} dd} 33eoA!Gfrost2023/09/21 18:13:032026/05/04 02:43:11AS18510S2fe02S18518S2fe02S38006S15a10S2fe00S15a18S2fe00S38006S22a04S22a14M542x540S36d00479x487S18510517x460S18518458x460S15a10510x495S15a18478x495S22a04510x525S22a14477x525M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M542x566S2ff00482x483S18510517x486S18518458x486S15a10510x521S15a18478x521S22a04510x551S22a14477x551 S38800464x496You might be looking for teacher.Adam Frost{"video":"dominance: equal;"} D~ 33u;=!Gfrost2023/09/21 18:15:102026/05/03 21:23:16AS18510S2fe02S18518S2fe02S38006S26a00S26a10M543x529S36d00479x525S18510517x491S18518458x491S26a00516x472S26a10456x472M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M543x518S2ff00482x483S18510517x486S18518458x486S26a00516x467S26a10456x467 S38800464x496You might be looking for teach.Adam Frost{"video":"dominance: equal;"} H 33u;E!Gfrost2023/09/21 18:16:472026/05/03 21:23:35AS18551S2fe02S18559S2fe02S38006S22101S22107M549x524S36d00479x520S18551522x476S18559451x476S22101517x480S22107473x480M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M549x518S2ff00482x483S18551522x470S18559451x470S22101517x474S22107473x474 S38800464x496You might be looking for lights on.Adam Frost{"video":"dominance: equal;"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx            !!""##$$%%&&''(())**++,,--..//001122334455 G 33u;C!Gfrost2023/09/21 18:18:072026/05/03 21:23:48AS18551S2fe02S18559S2fe02S38006S22105S22103M549x523S36d00479x519S18551522x478S18559451x478S22105516x479S22103474x479M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M549x518S2ff00482x483S18551522x472S18559451x472S22105516x473S22103474x473 S38800464x496You might be looking for turn off.Adam Frost{"video":"dominance: equal;"} % 33O!?!Gfrost2023/09/21 18:20:112026/05/03 21:24:09AS1ed10S2fe02S1ed18S2fe02S38006S21800M547x521S36d00479x517S1ed10521x489S1ed18455x489S21800518x479M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M546x518S2ff00482x483S1ed10520x486S1ed18454x486S21800517x476 S38800464x496You might be looking for camera.Adam Frost{"video":"dominance: right;"} vv 33AoA!Gfrost2023/09/21 18:31:172026/05/03 21:25:13AS1f410S2fe02S1f418S2fe02S38006S26a06S26a12S22114S22114M570x519S36d00479x515S1f410541x492S1f418432x492S26a06523x486S26a12464x486S22114541x482S22114433x482M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M586x518S2ff00482x483S1f010507x489S1f018464x489S26a06540x483S26a12445x483S1f410557x489S1f418413x489 S38800464x496You might be looking for glasses.Adam Frost{"video":"dominance: equal;"} vv 33AoA!Gfrost2023/09/21 18:32:452026/05/03 21:25:25AS1f010S2fe02S1f018S2fe02S38006S26a06S26a12S1f410S1f418M587x518S36d00479x514S1f010508x489S1f018465x489S26a06541x483S26a12446x483S1f410558x489S1f418414x489M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M586x518S2ff00482x483S1f010507x489S1f018464x489S26a06540x483S26a12445x483S1f410557x489S1f418413x489 S38800464x496You might be looking for glasses.Adam Frost{"video":"dominance: equal;"} " 33C!E!Gfrost2023/09/21 18:34:252026/05/03 23:50:22AS1f420S2fe03S10006S26504S22104M546x530S36d00479x526S1f420517x498S26504526x470S22104519x489M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M546x518S2ff00482x483S1f020517x447S26504529x467S1f420517x486 S38800464x496You might be looking for Gallaudet.Adam Frost{"video":"dominance: right;"} " 33C!E!Gfrost2023/09/21 18:35:382026/05/03 23:50:30AS1f020S2fe03S10006S26504S1f420M546x536S36d00479x532S1f020517x465S26504529x485S1f420517x504M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M546x518S2ff00482x483S1f020517x447S26504529x467S1f420517x486 S38800464x496You might be looking for Gallaudet.Adam Frost{"video":"dominance: right;"} %33#{!)frost2024/02/17 01:19:272026/05/23 16:58:41AS19200S30000S10006S27102M538x549S2ff00482x483S19200517x488S27102522x509S38b00470x493 M546x539S2ff00482x483S19200517x488S2330a520x509 S38b04470x493noun a carbonated soft drink similar to Coke, sweetened and flavored with cola, produced by PepsiCo.

      PHONOLOGICAL VARIANTS
      Pepsi with cross movementAdam Frost{"video":"dominance: right;\\n\ud8cd\udec1\ud8f0\udc01\u00d8\ud8e2\ude63.mov"}rticular characteristic or categorization) to oneself; to describe oneself as belonging to (a particular category or group): she identifies as a feminist | 3.2% of the men identified as gay or bisexual.
    2. (identify someone/something with) to associate (someone) closely with; to regard (someone) as having strong links with: he was equivocal about being identified too closely with the peace movement.
      • to equate (someone or something) with: because of my upstate accent, people identified me with a homely farmer's wife.
      • (identify with) [no object] to regard oneself as sharing the same characteristics or thinking as someone else: I liked Fromm and identified with him.

    DERIVATIVES
    identity [frequentative]Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\udee1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1.mov"}  f33OI!Yfrost2023/09/21 18:44:342026/08/15 18:52:13AS15410S30004S10006S20e00S22a04S20310M518x572S2ff00482x483S15410494x510S22a04495x539S20310494x557M549x535S2ff00482x483S14e01492x508S22a07519x504S20301528x487adjective
    1. having lived for a long time; no longer young: the old man lay propped up on cushions.
      • made or built long ago: the old quarter of the town.
      • possessed or used for a long time: he gave his old clothes away.
    2. [attributive] belonging only or chiefly to the past; former or previous: valuation under the old rating system was inexact.
      • used to refer to the first of two or more similar things: I was going to try to get m ZZx 33] #! frost2023/09/22 17:24:202026/08/03 17:18:43AS10020S2fe00S10006M508x515S10020493x485identifier number the number between zero and two: room 1 is locked, so we can't go in yet.
        verb to wait briefly, especially as a command or request: one moment, please.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\u00d8.mov"}& 33O!A!Gfrost2023/09/21 18:45:112026/05/03 23:50:44AS16d10S30004S10006S20e00S22a04S20310M518x568S2ff00482x483S16d10492x511S22a04495x535S20310494x553M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M518x572S2ff00482x483S15410494x510S22a04495x539S20310494x557 S38800464x496You might be looking for old/age.Adam Frost{"video":"dominance: right;"} OOA 33] 5! frost2023/09/22 17:26:552026/04/10 20:43:30AS14c20S2fe00S10006M512x516S14c20489x485identifying number equivalent to the sum of two and three; one more than four, or half of ten: the train to New York is on track five.Adam Frost{"video":"dominance: right;\\n\ud8c7\udca1\ud8fc\udc61\u00d8.mov"}D 33] ;! frost2023/09/22 17:26:032026/04/10 20:38:51AS14420S2fe00S10006M511x516S14420489x485identifying number equivalent to the product of two and two; one more than three, or six less than ten: for customer service, press four.Adam Frost{"video":"dominance: right;\\n\ud8c6\udda1\ud8fc\udc61\u00d8.mov"} 33] s! frost2023/09/22 17:25:172026/04/10 20:33:35AS11e20S2fe00S10006M512x515S11e20489x485identifier number equivalent to the sum of one and two; one more than two: team three is in the lead.Adam Frost{"video":"dominance: right;\\n\ud8c2\udf61\ud8fc\udc61\u00d8.mov"} j 33 [!Mfrost2023/09/22 17:32:392026/04/23 23:01:29AS11e20S2fe00S10006S10020M512x532S11e20489x468S10020497x502combined form a construction of three and one.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf61\ud8fc\udc61\u00d8\ud8c0\udc21.mov"} 33 s!M frost2023/09/22 17:32:092026/04/23 23:01:11AS11e20S2fe00S10006S17620M512x525S11e20489x475S17620496x509combined form a construction of three and the number zero.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf61\ud8fc\udc61\u00d8\ud8cb\udc61.mov"} l- 33) k!efrost2023/09/22 17:35:432026/04/23 23:01:52AS10e50S2fe00S10006S22f04S26606M517x526S10e50490x474S26606487x501S22f04484x512combined form a construction of the numbers two and two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c1\udd91\ud8fc\udc61\u00d8\ud8dc\udda5\ud8e1\ude47.mov"} 33 o!Mfrost2023/09/22 17:33:572026/04/23 23:01:43AS11e20S2fe00S10006S10e20M512x532S11e20489x468S10e20497x502combined form a construction of three and the number two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf61\ud8fc\udc61\u00d8\ud8c1\udd61.mov"} U% 33) [!efrost2023/09/22 17:43:072026/04/23 23:02:22AS14450S2fe00S10006S22f04S26606M517x527S14450488x474S26606487x502S22f04484x513combined form a construction of four and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\uddd1\ud8fc\udc61\u00d8\ud8dc\udda5\ud8e1\ude47.mov"}' 33) _!efrost2023/09/22 17:42:012026/04/23 23:02:13AS11e50S2fe00S10006S22f04S26606M518x526S11e50483x474S26606488x501S22f04485x512combined form a construction of three and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf91\ud8fc\udc61\u00d8\ud8dc\udda5\ud8e1\ude47.mov"}oftflrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|WYZ[\]^_`acefhijkm n o qstuwxyz{|}~ !"$% & '()+,-./012346 7"8$9&:'<(=*?+@,A-B.C/D0E1F3G5H7I9J;K=L?MANCOEPGQIRKSNUOVPWQXRYSZU[X]Z_\`^a`bacbddeeffghhiijjlkmlnmonporqusv W/ 33) o!efrost2023/09/22 18:16:422026/04/23 23:02:38AS18750S2fe00S10006S22f04S26606M517x526S18750488x475S26606487x501S22f04484x512combined form a construction of the numbers six and six.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udef1\ud8fc\udc61\u00d8\ud8dc\udda5\ud8e1\ude47.mov"}% 33) [!efrost2023/09/22 17:44:492026/04/23 23:02:31AS14c50S2fe00S10006S22f04S26606M517x527S14c50485x474S26606487x502S22f04484x513combined form a construction of five and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udcd1\ud8fc\udc61\u00d8\ud8dc\udda5\ud8e1\ude47.mov"} U' 33) _!efrost2023/09/22 19:17:072026/04/23 23:02:56AS1bb50S2fe00S10006S22f04S26606M517x525S1bb50489x475S26606487x500S22f04484x511combined form a construction of eight and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d1\ude71\ud8fc\udc61\u00d8\ud8dc\udda5\ud8e1\ude47.mov"}' 33) _!efrost2023/09/22 18:18:112026/04/23 23:02:46AS1a550S2fe00S10006S22f04S26606M517x525S1a550489x475S26606487x500S22f04484x511combined form a construction of seven and seven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude31\ud8fc\udc61\u00d8\ud8dc\udda5\ud8e1\ude47.mov"} y 33) O!frost2023/09/22 19:18:382026/05/05 16:36:56AS1ce50S2fe00S10006S22f04S26606M517x526S1ce50489x474S26606487x501S22f04484x512noun
        1. a thin strip of deep-fried potato: I ordered a cheeseburger and French fries.
        2. a control on a tape or video player for advancing the tape rapidly: [as modifier] : the fast-forward button.
        verb to advance (a tape) rapidly, sometimes while simultaneously playing it at high speed: people avoid commercial breaks by fast-forwarding material recorded off-air.
        combined form a construction of the numbers nine and nine.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated (noun & verb);\\n\ud8d3\udd91\ud8fc\udc61\u00d8\ud8dc\udda5\ud8e1\ude47.mov"}   33K!kfrost2023/09/22 19:21:542026/04/10 22:40:13AS11e50S2fe00S10006S2880aM519x523S11e50482x478S2880a497x511M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M518x526S11e50483x474S26606488x501S22f04485x512 S38800464x496You might be looking for thirty-three.Adam Frost{"video":"dominance: right;\\nvisible: false;"}  33G!kfrost2023/09/22 19:30:302026/04/10 22:44:02AS14450S2fe00S10006S2880aM515x523S14450485x477S2880a493x511M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M517x527S14450488x474S26606487x502S22f04484x513 S38800464x496You might be looking for forty-four.Adam Frost{"video":"dominance: right;\\nvisible: false;"}  33G!kfrost2023/09/22 19:31:542026/04/10 22:47:00AS14c50S2fe00S10006S2880aM516x524S14c50485x477S2880a494x512M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M517x527S14c50485x474S26606487x502S22f04484x513 S38800464x496You might be looking for fifty-five.Adam Frost{"video":"dominance: right;\\nvisible: false;"}  33E!kfrost2023/09/22 19:33:342026/04/10 22:51:17AS18750S2fe00S10006S2880aM516x523S18750485x478S2880a494x511M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M517x526S18750488x475S26606487x501S22f04484x512 S38800464x496You might be looking for sixty-six.Adam Frost{"video":"dominance: right;\\nvisible: false;"}   33M!kfrost2023/09/22 19:34:562026/04/10 22:53:43AS1a550S2fe00S10006S2880aM515x522S1a550485x478S2880a493x510M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M517x525S1a550489x475S26606487x500S22f04484x511 S38800464x496You might be looking for seventy-seven.Adam Frost{"video":"dominance: right;\\nvisible: false;"}   33K!kfrost2023/09/22 19:36:112026/04/10 22:57:43AS1bb50S2fe00S10006S2880aM515x522S1bb50485x478S2880a493x510M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M517x525S1bb50489x475S26606487x500S22f04484x511 S38800464x496You might be looking for eighty-eight.Adam Frost{"video":"dominance: right;\\nvisible: false;"} 033;{!)frost2023/09/22 19:41:382026/06/05 17:20:45AS10000S2fe00S10006S21b00M509x521S10000491x491S21b00501x480M535x531S18510497x496S18514473x488S20600485x478S2c300509x469S2c314465x507 S38a00464x490 M523x520S19a20477x489S27106508x480 M509x515S18720491x486 M515x515S10018489x485S100 337!kfrost2023/09/22 19:37:122026/04/24 00:11:35AS1ce50S2fe00S10006S2880aM515x523S1ce50485x477S2880a493x511M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M517x526S1ce50489x474S26606487x501S22f04484x512 S38800464x496You might be looking for FF.Adam Frost{"video":"dominance: right;\\nvisible: false;"}ok at and comprehend the meaning of (written or printed matter) by mentally interpreting the characters or symbols of which it is composed: it's the best novel I've ever read | I never learned to read music | [no object] : I'll go to bed and read for a while.
        • [no object] have the ability to look at and comprehend the meaning of written or printed matter: only three of them could read and none could write.
        • to habitually read (a particular newspaper or journal): now, I know what my reputation is—I read the papers.
      • to discover (information) by reading it in a written or printed source: he was arrested yesterday—I read it in the paper | [no object] : I read about the course in a magazine.

    INFLECTED FORMS
    read [frequentative]Adam Frost{"video":"dominance: right;\\n\ud8c1\udd91\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8fc\udc05\ud8db\udfc5.mov"} t 33Q!) frost2023/09/22 19:42:452026/08/23 21:56:02AS10e00S2fe00S10006S21b00M508x520S10e00493x490S21b00497x480M509x520S10e00492x490S21d00491x480
    number
    1. equivalent to the product of three and four; two more than ten: he walked twelve miles | there are just twelve of us in all | a twelve-string guitar.
    INFLECTED FORMS
    twelve [in isolation]
    Adam Frost{"video":"dominance: right;\\n\ud8c1\udd41\ud8fc\udc61\u00d8\ud8da\ude21.mov"} u" 33 ]!M"frost2023/09/22 19:45:342026/04/23 23:05:30AS11e20S2fe00S10006S14c20M514x532S11e20486x468S14c20491x501combined form a construction of three and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf61\ud8fc\udc61\u00d8\ud8c7\udca1.mov"}! 33 ]!M!frost2023/09/22 19:44:362026/04/23 23:05:21AS11e20S2fe00S10006S14420M515x532S11e20486x468S14420493x501combined form a construction of three and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf61\ud8fc\udc61\u00d8\ud8c6\udda1.mov"} k$ 33 _!M$frost2023/09/22 19:47:452026/04/23 23:05:48AS11e20S2fe00S10006S1a520M515x531S11e20486x469S1a520494x503combined form a construction of three and seven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf61\ud8fc\udc61\u00d8\ud8cf\ude01.mov"}# 33 q!M#frost2023/09/22 19:46:302026/04/23 23:05:40AS11e20S2fe00S10006S18720M513x531S11e20488x469S18720495x502combined form a construction of three and the number six.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf61\ud8fc\udc61\u00d8\ud8cc\udec1.mov"} t& 33 s!M&frost2023/09/22 19:49:402026/04/23 23:06:06AS11e20S2fe00S10006S1ce20M515x532S11e20485x468S1ce20493x502combined form a construction of three and the number nine.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf61\ud8fc\udc61\u00d8\ud8d3\udd61.mov"}% 33 _!M%frost2023/09/22 19:48:382026/04/23 23:05:57AS11e20S2fe00S10006S1bb20M515x531S11e20486x469S1bb20494x503combined form a construction of three and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf61\ud8fc\udc61\u00d8\ud8d1\ude41.mov"} 4' 33) a!}'frost2023/09/23 17:55:582026/05/05 16:39:42AS11541S2fe00S10006S22f04S26606M517x525S11541483x476S26606487x500S22f04484x511noun a person who has some hearing: the program provides services for the hard of hearing.
    adjective (of a person) having limited hearing: one of the twins was hard of hearing | other cultures need to be recognized by teachers of deaf and hard-of-hearing children.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c2\udc22\ud8fc\udc61\u00d8\ud8dc\udda5\ud8e1\ude47.mov"}532x530S15a20513x471S15a28475x471S2e508509x503S2e510469x502S38b00470x493 M524x532S15a20511x469S15a28477x469S26500510x517S26510476x517S22b20492x501S26500510x500S26510476x500 M524x532S15a20511x469S15a28477x469S26500510x500S26510476x500S22b24492x501S26500510x517S26510476x517 S38b04470x493noun the day of the week before Monday and following Saturday, and (together with Saturday) forming part of the weekend: they left town on Sunday | [as modifier] : Sunday evening.
    adverb on Sunday: the concert will be held Sunday.

    PHONOLOGICAL VARIANTS
    Sunday with upward movement
    Sunday with downward movementAdam Frost{"video":"dominance: equal;\\n\ud8c8\udde1\ud8fc\udc61\ud8c8\udde9\ud8fc\udc61\ud8fc\udc07\ud8ed\udde9\ud8ed\uddf1.mov"} ~b( 33kY!(frost2023/09/24 21:44:202026/06/25 17:49:18AS19220S2fe00S15a18S2fe00S21406S20500M517x514S15a18483x487S19220496x495M517x521S15a18483x480S19220496x488S20600485x510verb [with object]
    1. to establish or indicate who or what (someone or something) is: the judge ordered that the girl not be identified | the contact would identify himself simply as Cobra.
      • to recognize or distinguish (especially something considered worthy of attention): a system that ensures to identify the student's real needs.
      • (identify as) [no object] to assign (a pa# S* 335kM!e*frost2023/09/24 22:05:352026/06/13 18:41:24AS10e50S2fe00S15a0aS2fe00S38004S22a04M514x533S15a0a487x468S10e50495x483S22a04495x518M514x533S15a0a486x468S10e50494x483S22f04489x519verb
        1. to lo5}) 33[ A!})frost2023/09/24 22:03:102026/05/03 21:25:43AS18240S2fe00S18248S2fe00S38006S26500S26510M529x517S18240505x502S18248471x502S26500510x483S26510477x483verb
          1. to begin or continue a course of action: we can proceed with our investigation | the project will go ahead | the government intends to go ahead with its tax cutting plans.
          2. to have a harmonious or friendly relationship: they seem to get along pretty well | he does not get along with his son.
          Adam Frost{"video":"dominance: equal;\\n\ud8cc\udd01\ud8fc\udc61\ud8cc\udd09\ud8fc\udc61\ud8fc\udc07\ud8e1\udde1\ud8e1\uddf1.mov"}1S11502485x504M518x518S11502483x483S2ea06493x503noun
          1. a tall, narrow, traditional row house, generally having three or more floors.
            • a multistory house in a modern housing development which is attached to one or more similar houses by shared walls.
          2. a multistory house in a modern housing development which is attached to one or more similar houses by shared walls: three-story townhomes are becoming quite popular as single-family residences | in 2006, they bought a townhome in the complex.
          suffix forming ordinal numbers from ten onwards: tenth | sixty-sixth.
          noun, adverb Thursday.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated (noun, adverb);\\nfingerspelled: full (suffix);\\n\ud8d7\ude41\ud8fc\udc61\u00d8\ud8c1\udfe3.mov"} mm+ 33A !}+frost2023/09/24 22:13:502026/06/13 18:46:58AS16d40S2fe00S15a48S2fe00S21406S20e00S22a04M516x521S15a48485x479S16d40498x483S22a04501x506noun a main division of a book, typically with a number or title: we will deal with this in chapter eleven.Adam Frost{"video":"dominance: right;\\n\ud8ca\udd21\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8db\udfc5.mov"} A6, 335Q!,frost2023/09/24 22:20:162026/06/25 17:48:42AS19220S2fe00S15a18S2fe00S21406S20600M517x521S15a18483x480S19220496x488S20600485x510M517x514S15a18483x487S19220496x495noun
          1. the fact used to identify who or what a person or thing is: he knows the identity of the bombers | she believes she is the victim of mistaken identity.
            • the characteristics determining who or what a person or thing is: attempts to define a distinct Canadian identity.
          2. a close similarity or affinity: the initiative created an identity between the city and the suburbs.
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\udee1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"} t- 33kq!7-frost2023/09/24 23:20:072026/06/16 20:10:24AS12d20S30007S12d28S30001S20500S20500S22114S22114M541x518S2ff00482x483S12d20514x473S12d28463x473S22114515x465S22114459x465M541x518S2ff00482x483S12d20514x473S22114515x465noun a phonological variant (two handed) of horse.Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8c4\udd01\ud8f0\udc08\ud8c4\udd09\ud8f0\udc02\ud8d8\udde1\ud8d8\udde1\ud8db\udc75\ud8db\udc75.mov"} um.33)WC!A.frost2023/09/24 23:23:322026/06/16 20:08:26AS12d20S30007S10006S20500S22114M541x518S2ff00482x483S12d20514x473S22114515x465S38b00470x493 M541x518S2ff00482x483S12d20514x473S12d28463x473S22114515x465S22114459x465 S38b04470x493noun a large plant-eating domesticated mammal with solid hooves and a flowing mane and tail, used for riding, racing, and to carry and pull loads.

          PHONOLOGICAL VARIANTS
          horse two-handedAdam Frost{"video":"dominance: right;\\n\ud8c4\udd01\ud8f0\udc08\u00d8\ud8d8\udde1\ud8db\udc75.mov"} @@noun           a phonological variant (right handed) of rabbit.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c1\udfe1\ud8f0\udc08\u00d8\ud8d8\udde1\ud8db\udc75.mov"} NN.033A!0frost2023/09/25 18:50:552026/05/24 21:34:36AS10010S2fe00S10019S2fe00S21400S20500S2c300M519x543S10019482x513S10010501x483S2c300493x457M515x538S15a18486x511S10010497x489S2c300489x463 S38a00464x490 S38b00470x493 M519x543S10011498x513S10018486x483S2c311482x457 S38b04470x493noun a phonological variant (index base hand) of minute.

          PHONOLOGICAL VARIANTS
          minute left-handedAdam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc11\ud8fc\udc61\ud8c0\udc1a\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8ea\udd21.mov"} zr1 33[ +!}1frost2023/10/01 17:22:042026/05/17 23:37:08AS15a30S2fe00S15a38S2fe00S38006S2b700S2b711M522x527S15a30510x500S15a38479x500S2b700502x474S2b711480x474verb [with object] to put forward (an idea or plan) for consideration or discussion by others: he proposed a new nine-point peace plan | [with clause] : I proposed that we should retain a 51 percent stake in the company | [with infinitive] : we propose to be away for six months.
          • to nominate (someone) for an elected office or as a member of a society: Thomson was proposed as chairman.
          • to put forward (a motion) to a legislature or committee: the government put its slim majority to the test by proposing a vote of confidence.
          Adam Frost{"video":"dominance: equal;\\n\ud8c8\uddf1\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8fc\udc07\ud8e9\udca1\ud8e9\udcb2.mov"} 993 33 q!M3frost2023/10/07 17:51:542026/04/23 23:06:28AS14420S2fe00S10006S17620M511x526S14420489x475S17620490x510combined form a construction of four and the number zero.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda1\ud8fc\udc61\u00d8\ud8cb\udc61.mov"}-2 33O Q!Y2frost2024/04/27 21:45:222026/03/19 21:52:38AS12b1eS38603S10006S26502S13f1eS20500M529x524S37605472x492S12b1e514x478S26502496x486S13f1e478x477verb to put medicine or another substance into the body, typically by using a needle in the arm: they vaccinated everyone before the trip.
          noun an injection of medicine or another substance, typically in the arm: Jerry gave the monkey a shot of a sedative.Adam Frost{"video":"dominance: right;\\n\ud8c4\udc3f\ud8fc\ude44\u00d8\ud8e1\udde3\ud8c5\udfbf\ud8d8\udde1.mov"} w5 33 m!M5frost2023/10/07 17:54:572026/04/23 23:06:46AS14420S2fe00S10006S10e20M511x533S14420489x468S10e20491x503combined form a construction of four and the number two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda1\ud8fc\udc61\u00d8\ud8c1\udd61.mov"}4 33 Y!M4frost2023/10/07 17:53:342026/04/23 23:06:37AS14420S2fe00S10006S10020M511x533S14420489x468S10020491x503combined form a construction of four and one.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda1\ud8fc\udc61\u00d8\ud8c0\udc21.mov"} u7 33 [!M7frost2023/10/10 17:33:252026/04/23 23:07:02AS14420S2fe00S10006S14c20M512x533S14420490x467S14c20488x502combined form a construction of four and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda1\ud8fc\udc61\u00d8\ud8c7\udca1.mov"}6 33 ]!M6frost2023/10/10 17:29:092026/04/23 23:06:54AS14420S2fe00S10006S11e20M514x533S14420492x468S11e20486x503combined form a construction of four and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda1\ud8fc\udc61\u00d8\ud8c2\udf61.mov"} l9 33 ]!M9frost2023/10/10 17:39:282026/04/23 23:07:19AS14420S2fe00S10006S1a520M512x532S14420489x468S1a520491x504combined form a construction of four and seven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda1\ud8fc\udc61\u00d8\ud8cf\ude01.mov"}8 33 o!M8frost2023/10/10 17:35:022026/04/23 23:07:11AS14420S2fe00S10006S18720M511x532S14420489x468S18720489x503combined form a construction of four and the number six.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda1\ud8fc\udc61\u00d8\ud8cc\udec1.mov"} u; 33 q!M;frost2023/10/10 17:46:272026/04/23 23:07:38AS14420S2fe00S10006S1ce20M511x533S14420489x467S1ce20489x503combined form a construction of four and the number nine.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda1\ud8fc\udc61\u00d8\ud8d3\udd61.mov"}: 33 ]!M:frost2023/10/10 17:44:002026/04/23 23:07:28AS14420S2fe00S10006S1bb20M512x532S14420489x468S1bb20491x504combined form a construction of four and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda1\ud8fc\udc61\u00d8\ud8d1\ude41.mov"} k= 33 Y!M=frost2023/10/24 17:38:392026/04/23 23:10:07AS14c20S2fe00S10006S10020M512x533S14c20489x468S10020493x503combined form a construction of five and one.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8c0\udc21.mov"}< 33 q!Mcombined form           a construction of five and the number zero.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8cb\udc61.mov"} m? 33 ]!M?frost2023/10/24 17:55:512026/04/23 23:10:25AS14c20S2fe00S10006S11e20M514x533S14c20491x468S11e20487x503combined form a construction of five and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8c2\udf61.mov"}> 33 m!M>frost2023/10/24 17:53:552026/04/23 23:10:16AS14c20S2fe00S10006S10e20M512x533S14c20489x468S10e20493x503combined form a construction of five and the number two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8c1\udd61.mov"} vA 33 o!MAfrost2023/10/24 18:10:422026/04/23 23:10:42AS14c20S2fe00S10006S18720M512x532S14c20489x468S18720491x503combined form a construction of five and the number six.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8cc\udec1.mov"}@ 33 [!M@frost2023/10/24 17:57:002026/04/23 23:10:33AS14c20S2fe00S10006S14420M512x533S14c20488x467S14420490x502combined form a construction of five and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8c6\udda1.mov"} uC 33 ]!MCfrost2023/10/24 18:13:122026/04/23 23:10:57AS14c20S2fe00S10006S1bb20M513x532S14c20488x468S1bb20492x504combined form a construction of five and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8d1\ude41.mov"}B 33 ]!MBfrost2023/10/24 18:11:522026/04/23 23:10:50AS14c20S2fe00S10006S1a520M513x532S14c20488x468S1a520492x504combined form a construction of five and seven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8cf\ude01.mov"} kE 33 q!MEfrost2023/10/25 17:43:212026/04/23 23:11:31AS18720S2fe00S10006S17620M509x525S18720491x476S17620492x509combined form a construction of the numbers six and zero.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8cb\udc61.mov"}D 33 q!MDfrost2023/10/24 18:15:032026/04/23 23:11:06AS14c20S2fe00S10006S1ce20M512x533S14c20488x467S1ce20490x503combined form a construction of five and the number nine.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8d3\udd61.mov"} lG 33 m!MGfrost2023/10/25 17:45:462026/05/01 16:27:46AS18720S2fe00S10006S10e20M509x532S18720491x469S10e20493x502combined form a construction of the numbers six and two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8c1\udd61.mov"}F 33 o!MFfrost2023/10/25 17:44:362026/04/23 23:11:39AS18720S2fe00S10006S10020M509x532S18720491x469S10020493x502combined form a construction of the numbers six and one.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8c0\udc21.mov"} jI 33 q!MIfrost2023/10/25 17:47:362026/04/23 23:12:02AS18720S2fe00S10006S14420M511x532S18720489x468S14420489x501combined form a construction of the numbers six and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8c6\udda1.mov"}H 33 s!MHfrost2023/10/25 17:46:422026/04/23 23:11:54AS18720S2fe00S10006S11e20M512x532S18720494x469S11e20488x502combined form a construction of the numbers six and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8c2\udf61.mov"} kK 33 s!MKfrost2023/10/25 17:50:172026/04/23 23:12:18AS18720S2fe00S10006S1a520M511x531S18720489x470S1a520490x503combined form a construction of the numbers six and seven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8cf\ude01.mov"}J 33 q!MJfrost2023/10/25 17:48:482026/04/23 23:12:10AS18720S2fe00S10006S14c20M512x532S18720491x468S14c20489x501combined form a construction of the numbers six and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8c7\udca1.mov"} fjfN33[S!}Nfrost2024/01/16 03:45:162026/05/26 02:21:36AS15a20S2fe00S15a28S2fe00S38006S2e508S2e510M;M 33 q!MMfrost2023/10/25 17:54:172026/04/23 23:12:33AS18720S2fe00S10006S1ce20M512x532S18720489x469S1ce20490x502combined form a construction of the numbers six and nine.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8d3\udd61.mov"}L 33 s!MLfrost2023/10/25 17:52:262026/04/23 23:12:25AS18720S2fe00S10006S1bb20M511x531S18720489x470S1bb20490x503combined form a construction of the numbers six and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8d1\ude41.mov"}urface: a pool of blood.
        2. a swimming pool: I spent all my time lounging around the pool.
    2. a supply of vehicles or goods available for use when needed: the oldest vehicle in the motor pool.
      • a group of people available for work when required or considered as a resource: the typing pool | a nationwide pool of promising high-school students.
      • a common fund into which all contributors pay and from which financial backing is provided: big public investment pools.
      • the collective amount of players' stakes in gambling or sweepstakes; a kitty: dividends are calculated by dividing the net pool by the stakes on the winners.
    3. a game of pool (noun).
    Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udc52\ud8fc\udc61\u00d8\ud8cb\udc61\ud8cb\udc61\ud8d4\udea1.mov"} =O 33!=!GOfrost2024/01/07 18:40:272026/05/03 21:27:03AS16d10S2fe00S16d18S2fe00S21406S20500S2df06S2df1eM522x529S16d10505x499S16d18478x499S20500495x518S2df06502x471S2df1e478x471M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M522x524S16d10505x504S16d18478x504S2df06502x476S2df1e478x476 S38800464x496You might be looking for class.Adam Frost{"video":"dominance: equal;"} 9P 33g!O!GPfrost2024/01/06 01:31:582026/05/03 21:27:15AS15712S2fe00S16d48S2fe00S21406S20500S2880aS18517M541x520S16d48459x496S15712470x491S2880a497x481S18517522x493M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M541x520S16d48459x499S14c13471x490S2880a497x481S18517522x493 S38800464x496You might be looking for exit/leave/out.Adam Frost{"video":"dominance: right;"} gQ 33'!?!sQfrost2024/01/07 18:43:302026/05/08 23:24:56AS1ce20S2fe00S1ce28S2fe00S21406S20500S2df06S2df1eS20500M524x541S1ce20502x499S1ce28477x499S20500495x530S2df06502x471S2df1e479x471S20500496x460M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M524x529S1ce20502x499S1ce28477x499S2df06502x471S2df1e479x471 S38800464x496You might be looking for family.Adam Frost{"video":"dominance: equal;\\nletter: integrated;"} IR 33g!C!sRfrost2024/01/07 18:53:132026/05/08 23:25:31AS1dc50S2fe00S1dc58S2fe00S21406S20500S26506S26512M545x515S1dc50502x485S1dc58475x485S26506530x500S26512455x500M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M535x527S1dc50502x473S1dc58475x473S28805515x507S2881d466x507 S38800464x496You might be looking for language.Adam Frost{"video":"dominance: equal;\\nletter: integrated;"} ;;ɅAS33g+!Sfrost2024/01/07 18:56:342026/09/20 16:25:35AS1ce40S2fe00S1ce48S2fe00S21406S20500S26506S26512M538x515S1ce40501x485S1ce48477x485S26506523x500S26512462x500M535x527S1dc50502x473S1dc58475x473S28805515x507S2881d466x507noun
    1. a set of words that is complete in itself, typically containing a subject and predicate, conveying a statement, question, exclamation, or command, and consisting of a main clause and sometimes one or more subordinate clauses.
    2. a language.
    Adam Frost{"video":"dominance: equal;\\n\ud8d3\udd81\ud8fc\udc61\ud8d3\udd89\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\udde7\ud8e1\uddf3.mov"} sCsKU 33 ]!UUfrost2024/01/16 03:53:512026/05/08 23:26:02AS1fb00S2fe00S10006S2ea06M513x520S1fb00492x481S2ea06488x505noun the day of the week before Wednesday and following Monday: come to dinner on Tuesday | the following Tuesday | [as modifier] : Tuesday afternoon.
    adverb on Tuesday: they're all leaving Tuesday.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d7\ude21\ud8fc\udc61\u00d8\ud8ed\udfc7.mov"}9T 33 9!UTfrost2024/01/16 03:51:382026/05/08 23:25:53AS18d00S2fe00S10006S2ea06M513x522S18d00488x478S2ea06488x507noun the day of the week before Tuesday and following Sunday: I saw him on Monday | the Monday before last | [as modifier] : Monday morning.
    adverb on Monday: I'll call you Monday.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\udce1\ud8fc\udc61\u00d8\ud8ed\udfc7.mov"} /5/X 33 s!MXfrost2023/11/09 16:14:182026/04/23 23:12:46AS1a520S2fe00S10006S17620M511x524S1a520490x476S17620490x508combined form a construction of seven and the number zero.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude01\ud8fc\udc61\u00d8\ud8cb\udc61.mov"}eW 33Q_!CWfrost2024/01/16 04:00:052026/05/21 16:02:33AS1fb20S2fe00S10006S11502M515x519S1fb20500x48>GV 33 U!UVfrost2024/01/16 03:56:162026/05/08 23:26:13AS18700S2fe00S10006S2ea0aM513x524S18700491x476S2ea0a488x509noun the day of the week before Thursday and following Tuesday: a report goes before the councilors on Wednesday | [as modifier] : on a Wednesday morning.
    adverb on Wednesday: see you Wednesday.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cc\udea1\ud8fc\udc61\u00d8\ud8ed\udfcb.mov"}S10120499x447S14a20499x481S16d20498x500S14020485x524noun
    1. a structure of planks or plates, approximately horizontal, extending across a ship or boat at any of various levels, especially one of those at the highest level and open to the weather: he stood on the deck of his flagship.
      • a floor or platform resembling or compared to a ship's deck, especially the floor of a pier or a platform for sunbathing.
      • a platform, typically made of lumber and unroofed, attached to a house or other building: they cooked hamburgers on the deck adjoining the living room.
      • a level of a large, open building, especially a sports stadium: Jeter hit an enormous home run into the upper deck.
      • the flat part of a skateboard or snowboard.
    2. a pack of cards: shuffle the deck.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c0\udc81\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8ca\udd01\ud8c6\udc21.mov"} vZ 33 o!MZfrost2023/11/09 16:17:362026/04/23 23:13:01AS1a520S2fe00S10006S10e20M511x531S1a520490x469S10e20491x501combined form a construction of seven and the number two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude01\ud8fc\udc61\u00d8\ud8c1\udd61.mov"}Y 33 [!MYfrost2023/11/09 16:16:002026/04/23 23:12:54AS1a520S2fe00S10006S10020M511x531S1a520490x469S10020491x501combined form a construction of seven and one.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude01\ud8fc\udc61\u00d8\ud8c0\udc21.mov"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx778899::;;<<==>>??@@AABBCCDDEEFFGGHHIIJJKKLLMMNNOOPPQQRRSSTTUUVVWWXXYYZZ[[\\]]^^__``aabbccddeeffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~ t\ 33 ]!M\frost2023/11/09 16:20:382026/04/23 23:13:18AS1a520S2fe00S10006S14420M511x532S1a520490x469S14420489x501combined form a construction of seven and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude01\ud8fc\udc61\u00d8\ud8c6\udda1.mov"}[ 33 _!M[frost2023/11/09 16:18:542026/04/23 23:13:10AS1a520S2fe00S10006S11e20M514x531S1a520493x469S11e20486x501combined form a construction of seven and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude01\ud8fc\udc61\u00d8\ud8c2\udf61.mov"} u^ 33 q!M^frost2023/11/09 16:23:202026/04/24 00:29:56AS1a520S2fe00S10006S18720M511x531S1a520490x469S18720489x502combined form a construction of seven and the number six.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude01\ud8fc\udc61\u00d8\ud8cc\udec1.mov"}] 33 ]!M]frost2023/11/09 16:22:192026/04/23 23:13:25AS1a520S2fe00S10006S14c20M512x532S1a520491x469S14c20488x501combined form a construction of seven and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude01\ud8fc\udc61\u00d8\ud8c7\udca1.mov"} t` 33 s!M`frost2023/11/09 16:26:482026/04/23 23:16:19AS1a520S2fe00S10006S1ce20M511x531S1a520489x469S1ce20489x501combined form a construction of seven and the number nine.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude01\ud8fc\udc61\u00d8\ud8d3\udd61.mov"}_ 33 _!M_frost2023/11/09 16:25:422026/04/23 23:13:37AS1a520S2fe00S10006S1bb20M511x530S1a520490x470S1bb20490x502combined form a construction of seven and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude01\ud8fc\udc61\u00d8\ud8d1\ude41.mov"} CC9a 33)Q!afrost2024/01/16 04:09:092026/09/20 16:41:12AS1fb20S2fe00S10006S11502S2ea06M518x529S1fb20498x472S11502483x495S2ea06493x514M518x518S11502483x483S2ea06493x503noun, adverb a phonological variant (circular movement) of Thursday.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\nvisible: sign;\\n\ud8d7\ude41\ud8fc\udc61\u00d8\ud8c1\udfe3\ud8ed\udfc7.mov"} TGb33[!Ubfrost2024/01/16 04:17:542026/05/23 18:35:52AS11502S2fe00S10006S2ea06M518x518S11502483x483S2ea06493x503S38b00470x493 M518x529S1fb20498x472S11502483x495S2ea06493x514 S38b04470x493 S38a00464x490 M515x519S1fb20500x481S11502485x504noun the day of the week before Friday and following Wednesday: the committee met on Thursday | [as modifier] : Thursday morning.
    adverb on Thursday: he called her up Thursday.

    PHONOLOGICAL VARIANTS
    Thursday with initial T-hand

    SIGN VARIATIONS
    Thursday with T- and H-handAdam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c1\udfe3\ud8fc\udc61\u00d8\ud8ed\udfc7.mov"} JQJd 33 K!Udfrost2024/01/16 04:46:082026/05/08 23:28:26AS20300S2fe00S10006S2ea06M513x517S20300493x483S2ea06488x502noun the day of the week before Sunday and following Friday, and (together with Sunday) forming part of the weekend: [as modifier] : Saturday night | I am going to see Twelfth Night on Saturday.
    adverb on Saturday: he made his first appearance Saturday.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d8\udd21\ud8fc\udc61\u00d8\ud8ed\udfc7.mov"}+c 33 !Ucfrost2024/01/16 04:20:482026/05/08 23:28:17AS1ce00S2fe00S10006S2ea06M514x524S1ce00487x476S2ea06489x509noun the day of the week before Saturday and following Thursday: he was arrested on Friday | [as modifier] : Friday evening.
    adverb on Friday: we'll try again Friday.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d3\udd41\ud8fc\udc61\u00d8\ud8ed\udfc7.mov"}   oe 33[ %!}efrost2024/01/16 04:49:402026/05/03 21:28:55AS19a00S2fe00S19a08S2fe00S38006S22f04S22f14M535x520S19a00507x481S19a08465x481S22f04509x506S22f14465x506adverb
    1. on or in the course of this present day: she's thirty today | he will appear in court today.
    2. at the present period of time; nowadays: millions of people today cannot afford adequate housing.
    noun
    1. this present day: today is a day of rest | today's game against the Blue Jays.
    2. the present period of time: the powerful computers of today | today's society.
    Adam Frost{"video":"dominance: equal;\\n\ud8ce\uddc1\ud8fc\udc61\ud8ce\uddc9\ud8fc\udc61\ud8fc\udc07\ud8dc\udda5\ud8dc\uddb5.mov"} RIf 33C -!Affrost2024/01/16 04:52:522026/01/03 20:02:30AS1f540S30005S10006S20e00S2b700M531x533S2ff00482x483S1f540508x509S20e00519x498S2b700511x473adverb on the day after today: I'll see you tomorrow | the show opens tomorrow. noun the day after today: tomorrow is going to be a special day | tomorrow's Grand Prix in Brazil.Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8f0\udc06\u00d8\ud8d9\udd41\ud8e9\udca1.mov"} h 33 !)hfrost2024/01/16 04:59:312025/02/16 18:03:04AS15a10S30006S10006S2b700M534x518S2ff00482x483S15a10522x485S2b700514x458adjective nearest after the present, not including tomorrow.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd1\ud8f0\udc07\u00d8\ud8e9\udca1.mov"}@g 33 Y!)gfrost2024/01/16 04:55:332025/02/16 18:03:20AS15a00S38507S10006S26504M541x523S36d00479x492S15a00528x477S26504527x508adjective (of a day of the week) nearest before the present, generally not including yesterday.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc1\ud8fc\udde8\u00d8\ud8e1\udde5.mov"} i 33?!Gifrost2024/01/16 05:00:542026/05/03 23:51:18AS15a10S2fe03S10006S2b700M535x531S36d00479x527S15a10523x496S2b700515x469M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M534x518S2ff00482x483S15a10522x485S2b700514x458 S38800464x496You might be looking for future.Adam Frost{"video":"dominance: right;"} RR*j 33A 5!}jfrost2024/01/16 05:09:492025/12/14 03:47:21AS10012S2fe00S10039S2fe00S21400S2e708S20500M536x518S10012487x488S10039464x488S2e708521x482interrogative adverb
    1. at what time: when did you last see him? | [with preposition] : since when have you been interested?
    2. how soon: when can I see you?
    3. in what circumstances: when would such a rule be justifiable?
    relative adverb at or on which (referring to a time or circumstance): Saturday is the day when I get my hair done.
    conjunction at or during the time that: I loved math when I was in school.
    1. after: call me when you're finished.
    2. at any time that; whenever: can you spare five minutes when it's convenient?
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8fc\udc61\ud8c0\udc3a\ud8fc\udc61\ud8d9\udf81\ud8ed\udea9\ud8d8\udde1.mov"} jjl 33[ !}lfrost2024/01/16 19:06:452026/05/03 21:29:11AS14402S2fe00S1440aS2fe00S38006S26506S26512M552x511S14402502x489S1440a467x489S26506537x491S26512448x491noun a barrier, railing, or other upright structure, typically of wood or wire, enclosing an area of ground to mark a boundary, control access, or prevent escape. Adam Frost{"video":"dominance: equal;\\n\ud8c6\udd83\ud8fc\udc61\ud8c6\udd8b\ud8fc\udc61\ud8fc\udc07\ud8e1\udde7\ud8e1\uddf3.mov"}rk 335 i!ekfrost2024/01/16 19:01:352026/08/04 16:04:29AS10e51S2fe00S10e08S2fe00S21400S20600M519x523S10e08485x493S10e51489x491S20600482x478noun two people or things considered together as a unit: the two dancers make an excellent pair.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd92\ud8fc\udc61\ud8c1\udd49\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} @@noun a hinged barrier used to close an opening in a wall, fence, or hedge: she closed the front gate.
    • a gateway: she went out through the gate.
    Adam Frost{"video":"dominance: right;\\n\ud8c6\udd83\ud8fc\udc61\ud8c6\udd8b\ud8fc\udc61\ud8fc\udc07\ud8e2\udc21.mov"} ]n 33O !nfrost2024/01/16 19:11:552026/05/04 02:47:42AS19a20S2fe00S10006S1f720S11a20S10120M514x554S19a20486x447S1f720488x471S11a20493x490S10120493x524noun
    1. a piece of ground adjoining a building or house.
      • an area of ground surrounded by walls or buildings.
      • an area of land used for a particular purpose or business: a storage yard.
    2. a unit of linear measure equal to 3 feet (0.9144 meter): a full skirt that took twenty yards of cloth.
      • a cloth measure, of three feet in length and varying widths.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8ce\udde1\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8c2\udde1\ud8c0\udc81.mov"} ]o 33u E!ofrost2024/01/16 19:14:542026/05/04 02:47:56AS14051S2fe00S10006S17620S11a20S16d20S11502M517x561S14051486x440S17620499x468S11a20499x488S16d20498x522S11502484x546noun a covered shelter projecting in front of the entrance of a building: the north porch of Hereford Cathedral.
    • a roofed platform along the outside of a house, level with the ground floor: Daniel and Lydia sat out on the porch for many hours.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udc52\ud8fc\udc61\u00d8\ud8cb\udc61\ud8c2\udde1\ud8ca\udd01\ud8c1\udfe3.mov"} hp 33O !pfrost2024/01/16 19:16:262026/05/04 02:48:09AS11a20S2fe00S10006S17620S17620S1ce20M511x552S11a20490x448S17620490x482S17620490x502S1ce20489x522noun the structure forming the upper covering of a building or vehicle.
    • the top inner surface of a covered area or space; the ceiling: the roof of the cave fell in.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c2\udde1\ud8fc\udc61\u00d8\ud8cb\udc61\ud8cb\udc61\ud8d3\udd61.mov"} ""Nr 33) #!orfrost2024/01/16 19:19:242026/05/04 02:48:33AS11a20S2fe00S10006S11520S1f000M515x542S11a20500x459S11520500x493S1f000486x527noun a floor covering of thick woven material or animal skin, typically not extending over the entire floor: a Persian rug | Charles and Elaine were sitting on the rug in front of the fire.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c2\udde1\ud8fc\udc61\u00d8\ud8c2\udc01\ud8d6\ude01.mov"}q 33u !qfrost2024/01/16 19:17:522026/05/04 02:48:21AS1f720S2fe00S10006S1fb20S1fb20S19220S16d20M513x554S1f720487x446S1fb20492x465S1fb20492x488S19220492x511S16d20491x534noun a space or room just below the roof of a building: I discovered a dozen rolls of the original wallpaper in a tin trunk in the attic | [as modifier] : there are five attic bedrooms.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8d7\ude41\ud8d7\ude41\ud8cd\udee1\ud8ca\udd01.mov"}ting an official or important situation or occasion: a formal dinner party.
  • officially sanctioned or recognized: a formal complaint.
    • having a conventionally recognized form, structure, or set of rules: he had little formal education.
  • of or concerned with outward form or appearance, especially as distinct from content or matter: I don't know enough about art to appreciate the purely formal qualities.
    • having the form or appearance without the spirit: his sacrifice will be more formal than real.
    • relating to linguistic or logical form as opposed to function or meaning.
  • elaborate in structure or decoration: the furniture was very fancy | a fancy computerized system.
    • sophisticated or expensive in a way that is intended to impress: fancy hotels and restaurants.
    Adam Frost{"video":"dominance: right;\\n\ud8c7\udc91\ud8fc\uddf1\u00d8\ud8d9\udd41\ud8dc\udda1.mov"} }Ku 33O _!ufrost2024/01/16 19:29:032026/05/04 02:49:08AS10120S2fe00S10006S14a20S16d20S14020M515x554\2t 335 i!etfrost2024/01/16 19:25:362026/01/03 21:03:11AS1f502S2fe00S15a1aS2fe00S37f04S2e732M524x520S15a1a476x481S1f502480x496S2e732499x502noun the floor of a building which is partly or entirely below ground level: they went down the stairs into the basement | [as modifier] : a basement apartment.Adam Frost{"video":"dominance: right;\\n\ud8d6\udfe3\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8fb\udfa5\ud8ed\uded3.mov"}$s 33O !sfrost2024/01/16 19:20:272026/09/20 16:42:28AS14051S2fe00S10006S17620S17620S1dc20M516x549S14051485x451S17620498x479S17620498x499S1dc20490x519noun
    1. a small area of still water, typically one formed naturally.
    exclamation used to show assent: "This is hard work!" "It is.".Adam Frost{"video":"dominance: right;\\n\ud8c0\udc11\ud8f5\udee1\u00d8\ud8d8\udde1\ud8e1\udde1.mov"} PP,v 33O !!vfrost2024/01/16 19:30:192026/05/04 02:49:24AS10120S2fe00S10006S14a20S20320S14020M515x551S10120499x449S14a20499x483S20320499x502S14020485x521noun a piece of furniture with a flat or sloped surface and typically with drawers, at which one can read, write, or do other work.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c0\udc81\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8d8\udd41\ud8c6\udc21.mov"} @<@px 33) !Axfrost2024/01/16 19:35:572026/06/27 17:02:41AS14c10S38510S10006S20e00S22f00M523x519S14c10478x488S22f00498x482S20e00504x500adjective
    1. done in accordance with rules of convention or etiquette; suitable for or constitup@w 335 !ewfrost2024/01/16 19:33:022025/11/18 19:19:48AS11e40S2fe00S15a56S2fe00S37f04S26a00M527x524S11e40480x494S15a56474x477S26a00500x490noun
      1. a building for housing a motor vehicle or vehicles: a detached house with an integral garage | a bus garage.
        • an establishment that provides services and repairs for motor vehicles.
      2. (also garage rock) a style of unpolished, energetic rock music associated with suburban amateur bands: [as modifier] : a garage band. [from the idea of amateur bands practicing in garages]
      Adam Frost{"video":"dominance: right;\\n\ud8c2\udf81\ud8fc\udc61\ud8c8\ude17\ud8fc\udc61\ud8fb\udfa5\ud8e1\udfc1.mov"}11S21000504x509S22f00502x492S14c30481x465M525x536S16d48475x496S1853e490x511S21000505x509S22a00509x492S14c30482x465 M527x522S16d48473x502S14020474x478S21300506x506S2b700502x481noun
      1. a living organism that typically grows in a permanent site, absorbs water through its roots, and uses light to produce nutrients.
        • a small plant, as distinct from a shrub or tree: garden plants.
        SIGN VARIATIONS
        plant with P-hand
      2. the season after winter and before summer, in which vegetation begins to appear: in spring the garden is a feast of blossom | [as modifier] : spring rain.
      verb [frequentative] to grow.Adam Frost{"video":"dominance: right;\\n\ud8cc\ude1f\ud8fc\udc61\ud8ca\udd29\ud8fc\udc61\ud8d9\udf87\ud8d9\ude01\ud8dc\udda1\ud8c7\udcb1.mov"} zrz 33g !zfrost2024/01/16 19:41:212026/04/18 17:52:24AS14040S2fe00S15a37S2fe00S21400S20500S2a408S20500M530x537S15a37490x476S14040470x463S2a408490x501S20600508x491noun a room or area where food is prepared and cooked.Adam Frost{"video":"dominance: right;\\n\ud8c6\udc41\ud8fc\udc61\ud8c8\uddf8\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e7\udd89\ud8d8\udde1.mov"}y 33 y!)yfrost2024/01/16 19:39:352026/04/21 18:14:12AS15a10S30006S10006S20500M529x518S2ff00482x483S15a10517x487noun a piece of furniture for sleep or rest, typically a framework with a mattress and coverings: she was in bed by nine.
      • a place or article used by a person or animal for sleep or rest: a bed of straw.
      • the time for sleeping: a glass of milk before bed.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd1\ud8f0\udc07\u00d8\ud8d8\udde1.mov"} 55G{ 33[ U!}{frost2024/01/16 19:44:062025/11/18 19:31:52AS10620S2fe00S1001aS2fe00S21400S20900S26506M524x527S1001a477x505S10620503x501S20900489x489S26506493x474noun a small room or enclosed space built into a house for storing clothes, often with a rod to hang garments: he has a closet full of designer suits.Adam Frost{"video":"dominance: right;\\n\ud8c0\ude61\ud8fc\udc61\ud8c0\udc1b\ud8fc\udc61\ud8d9\udf81\ud8d8\udf61\ud8e1\udde7.mov"} T| 33' s!-|frost2024/01/16 19:47:042026/05/03 21:29:28AS15a51S2fe00S15a57S2fe00S38006S2d508S2d510S2d508S2d510M542x521S15a51503x498S15a57475x498S2d508520x479S2d510459x479S2d508520x490S2d510459x490verb to propel the body through water by using the limbs or other bodily movement: they swam ashore | Adrian taught her to swim breaststroke.
      noun an act or period of swimming: we went for a swim in the river.Adam Frost{"video":"dominance: equal;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\ude18\ud8fc\udc61\ud8fc\udc07\ud8eb\udfe9\ud8eb\udff1\ud8eb\udfe9\ud8eb\udff1.mov"} //~ 33 !M~frost2024/01/16 20:01:552026/04/23 23:17:43AS10020S2fe00S10006S16d20M509x527S10020494x473S16d20492x507combined form a construction of one and the combining form -hundred.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ca\udd01.mov"},} 33[ !}}frost2024/01/16 19:57:512025/11/18 19:53:04AS15411S2fe00S1541fS2fe00S37f00S2e10eS2e112M542x529S15411492x474S1541f483x493S2e10e521x471S2e112459x484verb to wash (clothes or linens), especially in a tumbling cycle: I need someone to cook and wash for me.
      noun the action or process of washing clothes and linens: I talked her into letting me help Ben with the rest of the laundry.Adam Frost{"video":"dominance: right;\\n\ud8c7\udf92\ud8fc\udc61\ud8c7\udfa0\ud8fc\udc61\ud8fb\udfa1\ud8ed\udc6f\ud8ed\udc73.mov"}  33O {!}frost2024/01/16 20:02:382026/04/23 23:18:08AS10020S2fe00S10006S16d20S17620S10020M509x553S10020494x447S16d20492x481S17620493x504S10020494x523combined form a construction of one hundred, the number zero and one.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ca\udd01\ud8cb\udc61\ud8c0\udc21.mov"}  33O {!}frost2024/01/16 20:07:162026/04/23 23:18:17AS10020S2fe00S10006S16d20S17620S10e20M509x553S10020494x447S16d20492x481S17620493x504S10e20494x523combined form a construction of one hundred, the numbers zero and two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ca\udd01\ud8cb\udc61\ud8c1\udd61.mov"}  33O !}frost2024/01/16 20:08:542026/04/23 23:18:25AS10020S2fe00S10006S16d20S17620S11e20M512x553S10020497x447S16d20495x481S17620496x504S11e20489x523combined form a construction of one hundred, the number zero and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ca\udd01\ud8cb\udc61\ud8c2\udf61.mov"}  33O }!}frost2024/01/16 20:13:502026/04/23 23:18:32AS10020S2fe00S10006S16d20S17620S14420M511x554S10020491x447S16d20489x481S17620490x504S14420489x523combined form a construction of one hundred, the number zero and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ca\udd01\ud8cb\udc61\ud8c6\udda1.mov"}  33O }!}frost2024/01/16 20:16:482026/04/23 23:18:40AS10020S2fe00S10006S16d20S17620S14c20M512x554S10020493x447S16d20491x481S17620492x504S14c20489x523combined form a construction of one hundred, the number zero and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ca\udd01\ud8cb\udc61\ud8c7\udca1.mov"}  33O }!}frost2024/01/16 20:18:122026/04/23 23:18:48AS10020S2fe00S10006S16d20S17620S18720M509x553S10020493x448S16d20491x482S17620492x505S18720491x524combined form a construction of one hundred, the numbers zero and six.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ca\udd01\ud8cb\udc61\ud8cc\udec1.mov"}  33O !}frost2024/01/16 20:19:552026/04/23 23:18:56AS10020S2fe00S10006S16d20S17620S1a520M511x552S10020491x448S16d20489x482S17620490x505S1a520490x524combined form a construction of one hundred, the number zero and seven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ca\udd01\ud8cb\udc61\ud8cf\ude01.mov"}  33O !}frost2024/01/16 20:25:112026/04/23 23:19:04AS10020S2fe00S10006S16d20S17620S1bb20M511x552S10020491x448S16d20489x482S17620490x505S1bb20490x524combined form a construction of one hundred, the number zero and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ca\udd01\ud8cb\udc61\ud8d1\ude41.mov"} ] 33 -!)frost2024/01/16 21:30:372026/04/23 23:32:37AS10020S2fe00S10006S10620M511x530S10020496x470S10620490x504number equivalent to the product of ten and ten; ten more than ninety: a hundred yards away | there are just a hundred of us here.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8c0\ude61.mov"} 33O !}frost2024/01/16 20:26:322026/04/23 23:19:11AS10020S2fe00S10006S16d20S17620S1ce20M512x553S10020491x447S16d20489x481S17620490x504S1ce20490x523combined form a construction of one hundred, the numbers zero and nine.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ca\udd01\ud8cb\udc61\ud8d3\udd61.mov"}  33O }!}frost2024/01/16 21:38:102026/04/23 23:32:50AS10020S2fe00S10006S10620S17620S10020M511x557S10020495x443S10620489x477S17620495x507S10020495x527combined form a construction of the numbers one hundred, zero and one.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8c0\ude61\ud8cb\udc61\ud8c0\udc21.mov"}  33O {!}frost2024/01/16 21:40:012026/04/23 23:32:59AS10020S2fe00S10006S10620S17620S10e20M511x557S10020495x443S10620489x477S17620495x507S10e20495x527combined form a construction of the numbers one hundred, zero and two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8c0\ude61\ud8cb\udc61\ud8c1\udd61.mov"}  33O !}frost2024/01/16 21:41:532026/04/23 23:33:08AS10020S2fe00S10006S10620S17620S11e20M512x557S10020496x443S10620490x477S17620496x507S11e20488x527combined form a construction of the numbers one hundred, zero and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8c0\ude61\ud8cb\udc61\ud8c2\udf61.mov"}  33O !}frost2024/01/16 21:44:262026/04/23 23:33:17AS10020S2fe00S10006S10620S17620S14420M514x558S10020493x443S10620487x477S17620493x507S14420492x527combined form a construction of the numbers one hundred, zero and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8c0\ude61\ud8cb\udc61\ud8c6\udda1.mov"}  33O !}frost2024/01/16 21:45:522026/04/23 23:33:27AS10020S2fe00S10006S10620S17620S14c20M513x558S10020493x443S10620487x477S17620493x507S14c20490x527combined form a construction of the numbers one hundred, zero and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8c0\ude61\ud8cb\udc61\ud8c7\udca1.mov"}  33O }!}frost2024/01/16 22:15:282026/04/23 23:33:35AS10020S2fe00S10006S10620S17620S18720M512x557S10020495x444S10620489x478S17620495x508S18720494x528combined form a construction of the numbers one hundred, zero and six.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8c0\ude61\ud8cb\udc61\ud8cc\udec1.mov"}  33O !}frost2024/01/16 22:16:522026/04/23 23:33:44AS10020S2fe00S10006S10620S17620S1a520M514x556S10020493x444S10620487x478S17620493x508S1a520493x528combined form a construction of the numbers one hundred, zero and seven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8c0\ude61\ud8cb\udc61\ud8cf\ude01.mov"}  33O !}frost2024/01/16 22:18:072026/04/23 23:33:52AS10020S2fe00S10006S10620S17620S1bb20M514x556S10020493x444S10620487x478S17620493x508S1bb20493x528combined form a construction of the numbers one hundred, zero and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8c0\ude61\ud8cb\udc61\ud8d1\ude41.mov"} ee} 33) /!Afrost2024/01/16 22:29:212026/03/20 04:01:21AS14c40S2fe00S10006S26506S18540M537x516S14c40464x485S26506492x496S18540511x501conjunction used to connect words or phrases that are to be taken jointly when otherwise would be unclear: a motorcycle and helmet.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcc1\ud8fc\udc61\u00d8\ud8e1\udde7\ud8cc\ude21.mov"} 33O !}frost2024/01/16 22:20:292026/04/23 23:34:01AS10020S2fe00S10006S10620S17620S1ce20M514x557S10020492x443S10620486x477S17620492x507S1ce20492x527combined form a construction of the numbers one hundred, zero and nine.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8c0\ude61\ud8cb\udc61\ud8d3\udd61.mov"} I 33 !)frost2024/01/16 22:35:162026/01/14 21:29:36AS15a20S2fe00S10006S2f900M506x518S15a20494x483S2f900494x513affix used to represent the position or movement of a vertical rectangular flat object: a picture on the wall.Adam Frost{"video":"dominance: right;\\n\ud8c8\udde1\ud8fc\udc61\u00d8\ud8ef\udd61.mov"} 33)9!Gfrost2024/01/16 22:30:422026/05/03 23:51:31AS15740S2fe00S10006S26506S18540M534x513S15740467x487S26506489x493S18540508x498M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M537x516S14c40464x485S26506492x496S18540511x501 S38800464x496You might be looking for and.Adam Frost{"video":"dominance: right;"} `` 33 +!)frost2024/01/16 22:37:282026/05/11 22:26:39AS16d26S2fe00S10006S2f900M510x513S16d26490x488S2f900494x508affix used to represent the position or movement of a freestanding 3D object whose width, height, and depth are roughly comparable, conceptualized by its front: the microwave is on the counter.Adam Frost{"video":"dominance: right;\\n\ud8ca\udd07\ud8fc\udc61\u00d8\ud8ef\udd61.mov"} q 333 !Efrost2024/01/16 22:45:132026/05/11 22:25:53AS16d50S2fe00S16d58S2fe00S21406S2f900S2f900S20500S26506S26512M539x514S16d50502x486S16d58481x486S2f900506x509S2f900484x509S26506524x489S26512462x489affix used to represent the shape and location of an elongated 3D object conceptualized by its top: there’s a long counter in front of the cashier | a log was laying on the ground.Adam Frost{"video":"dominance: equal;\\n\ud8ca\udd31\ud8fc\udc61\ud8ca\udd39\ud8fc\udc61\ud8d9\udf87\ud8ef\udd61\ud8ef\udd61\ud8d8\udde1\ud8e1\udde7\ud8e1\uddf3.mov"} GGw 33 a!)frost2024/01/16 22:56:282026/01/14 21:29:05AS15a50S2fe00S10006S2f900M506x518S15a50494x483S2f900494x513affix used to represent the position or movement of a horizontal flat object: the book was lying flat on the table | the table was set next to the bathroom.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\u00d8\ud8ef\udd61.mov"}: 33 g!)frost2024/01/16 22:49:162026/01/05 21:39:06AS11050S2fe00S10006S2f900M510x518S11050491x483S2f900497x513affix
      1. used to represent the location of an object designed for sitting, typically for one person: a seat is there by the window.
      2. used to represent a seated entity, typically depicted as a two-legged sitting figure, to show position or location: the child was sitting on the floor | the bird sat on a telephone line.
      Adam Frost{"video":"dominance: right;\\n\ud8c1\ude51\ud8fc\udc61\u00d8\ud8ef\udd61.mov"} n0 33 S!)frost2024/01/16 23:02:482026/01/14 21:44:25AS1f540S2fe00S10006S2f900M508x516S1f540493x484S2f900495x511affix used to represent the position or movement of a freestanding 3D object with a complex form that varies shape across like items: the small building on the corner | the statue stood in the center of the plaza.Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\u00d8\ud8ef\udd61.mov"} 33) Q!Afrost2024/01/16 22:57:482026/01/07 17:17:02AS16d26S2fe00S10006S2f900S22a04M510x522S16d26490x479S2f900494x499S22a04493x507affix used to represent the location of a freestanding 3D object whose height is dominant, conceptualized by its front: the fridge is in the corner.Adam Frost{"video":"dominance: right;\\n\ud8ca\udd07\ud8fc\udc61\u00d8\ud8ef\udd61\ud8db\udfc5.mov"}   33[ a!}frost2024/01/18 01:06:012026/01/10 19:10:55AS11502S2fe00S1150aS2fe00S37f04S22a04S2c404M547x523S1150a453x477S11502474x489S22a04490x508S2c404509x485noun a window covering, especially one made of horizontal slats: she pulled down the blinds.Adam Frost{"video":"dominance: right;\\n\ud8c1\udfe3\ud8fc\udc61\ud8c1\udfeb\ud8fc\udc61\ud8fb\udfa5\ud8db\udfc5\ud8ea\udd85.mov"}d 33[ !}frost2024/01/16 23:06:152026/04/19 15:58:44AS11050S2fe00S1155aS2fe00S21400S20e00S26506M540x514S1155a460x489S11050487x487S20e00510x497S26506525x496noun
      1. a long seat for several people, typically made of wood or stone: a park bench.
      2. a couch.
      Adam Frost{"video":"dominance: right;\\n\ud8c1\ude51\ud8fc\udc61\ud8c2\udc3b\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde7.mov"}  33[ g!}frost2024/01/18 01:10:442026/05/03 21:30:10AS11e40S2fe00S11e48S2fe00S38006S23000S23010M539x526S11e40516x496S11e48461x496S23000513x474S23010462x474noun
      1. a chair mounted on rockers or springs, so as to rock back and forth.
      2. an upholstered armchair that can be tilted backward, especially one with a footrest that simultaneously extends from the front.
      Adam Frost{"video":"dominance: equal;\\n\ud8c2\udf81\ud8fc\udc61\ud8c2\udf89\ud8fc\udc61\ud8fc\udc07\ud8dc\ude01\ud8dc\ude11.mov"}   o 33M k!Efrost2024/01/18 01:15:232026/05/03 21:30:26AS20330S2fe00S20338S2fe00S38006S26504S26514S22a24S26504S26514M534x528S20330519x473S20338467x473S22a24494x503S26504520x495S26504520x513S26514467x495S26514467x513noun a piece of furniture consisting of a set of drawers in a frame, typically used for storing clothes.Adam Frost{"video":"dominance: equal;\\n\ud8d8\udd51\ud8fc\udc61\ud8d8\udd59\ud8fc\udc61\ud8fc\udc07\ud8e1\udde5\ud8e1\uddf5\ud8db\udfe5\ud8e1\udde5\ud8e1\uddf5.mov"} )): 33[ ;!}frost2024/01/18 01:28:052026/05/03 21:30:43AS14420S2fe00S14428S2fe00S38006S22a04S22a14M536x525S14420514x475S14428465x475S22a04516x510S22a14471x510noun a window covering, typically made of fabric: she drew the curtains and lit the fire | Katherine pulled back the heavy velvet drapes.Adam Frost{"video":"dominance: equal;\\n\ud8c6\udda1\ud8fc\udc61\ud8c6\udda9\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"} 33 k!Efrost2024/01/18 01:21:432025/11/19 17:59:51AS10650S38630S2035aS2fe00S20500S1ed10S2fe00S1ed18S2fe00S38006M534x534S10650488x480S2035a500x472S20500485x467S1ed10508x515S1ed18467x515noun a mechanical or electrical device for measuring time, indicating hours, minutes, and sometimes seconds, typically by hands on a round dial or by displayed figures.Adam Frost{"video":"dominance: right;\\n\ud8c0\ude91\ud8fc\ude71\ud8d8\udd7b\ud8fc\udc61\ud8d8\udde1\ud8d6\udcf1\ud8fc\udc61\ud8d6\udcf9\ud8fc\udc61\ud8fc\udc07.mov"} " 33?!Gfrost2024/01/18 01:41:452026/05/03 23:51:44AS15a00S2fe02S10006S2e100M545x533S15a00527x501S2e100522x467S36d00479x529M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M547x518S15a00529x489S2e100524x455S2ff00482x483 S38800464x496You might be looking for mirror.Adam Frost{"video":"dominance: right;"}G! 33 g!)frost2024/01/18 01:37:592025/11/19 18:32:40AS15a00S30006S10006S2e100M547x518S15a00529x489S2e100524x455S2ff00482x483noun a reflective surface that reflects a clear image: he checked his appearance in the mirror.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc1\ud8f0\udc07\u00d8\ud8ed\udc61.mov"}ing a pleasing quality involving a subtle effect or contrast rather than sharp definition: the soft glow of the lamps | the moon's pale light cast soft shadows.
    2. sympathetic, lenient, or compassionate, especially to a degree perceived as excessive; not strict or sufficiently strict: the administration is not becoming soft on crime | Julia's soft heart was touched by his grief.
    verb [frequentative] wet (verb).Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcb2\ud8fc\udc61\ud8c7\udcba\ud8fc\udc61\ud8fc\udc07\ud8dc\udda5\ud8dc\uddb5\ud8cc\ude1e\ud8cc\ude16.mov"} P;$ 33 O!)frost2024/01/18 01:46:322026/04/23 21:39:38AS15a10S30006S10006S20600M529x528S2ff00482x483S15a10517x487S20600507x517noun bed, often used for clarity.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd1\ud8f0\udc07\u00d8\ud8d8\ude41.mov"}# 33) 7!Afrost2024/01/18 01:44:342026/05/17 23:39:21AS10010S33d00S10006S20500S26500M520x541S33b00482x483S10010486x511S26500506x520adjective
    1. in accordance with fact or reality: a true story | of course it's true | that is not true of ther v v&33 !frost2024/01/18 01:52:502026/08/15 19:17:00AS1853eS2fe00S16d48S2fe00S21406S21000S22f00S14c30M527x536S16d48474x496S1853e489x5ur% 33 S!frost2024/01/18 01:48:472026/05/03 21:30:59AS18541S38517S18549S38511S22a00S22a10S20500S20500M536x525S18541509x475S18549465x475S20500516x496S20500475x496S22a00515x510S22a10474x510noun
      1. a large piece of woolen or similar material used as a bed covering or other covering for warmth: I slept on the ground covered by my blanket.
      2. a warm bed covering made of padding enclosed between layers of fabric and kept in place by lines of stitching, typically applied in a decorative design.
        • a knitted or fabric bedspread with decorative stitching.
      Adam Frost{"video":"dominance: equal;\\n\ud8cc\ude22\ud8fc\uddf8\ud8cc\ude2a\ud8fc\uddf2\ud8db\udfc1\ud8db\udfd1\ud8d8\udde1\ud8d8\udde1.mov"} the pages.
      • (especially of a baby or young child) to urinate in or on: the child wet the bed.
      • (wet oneself) to urinate involuntarily: she was going to wet herself from fear.

      INFLECTED FORMS
      wet [frequentative]
      adjective
      1. covered or saturated with water or another liquid: she followed, slipping on the wet rock.
        • (of a baby or young child) having urinated in its diaper or underwear: the baby was wet and needed changing.
      2. informal (of a country or region or of its legislation) allowing the sale, possession, or consumption of alcoholic beverages.
      3. [attributive] soft (adjective).
      Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcb2\ud8fc\udc61\ud8c7\udcba\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5\ud8cc\ude1e\ud8cc\ude16.mov"} Q' 33;K!Gfrost2024/01/18 01:58:362026/05/03 23:51:56AS1853eS2fe00S16d48S2fe00S21406S21000S22f00S15730M527x534S16d48474x494S1853e489x509S21000504x507S22f00502x490S15730481x467M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M527x536S16d48474x496S1853e489x511S21000504x509S22f00502x492S14c30481x465 S38800464x496You might be looking for plant/spring.Adam Frost{"video":"dominance: right;"}
      1. of or at a low or relatively low temperature, especially when compared with the human body: a cold day | it's cold outside.
        • (of a person) feeling uncomfortably cold: she was cold, and I put some more wood on the fire.
        • (of food or drink) served or consumed without being heated or after cooling: a cold drink | serve hot or cold.
      2. lacking affection or warmth of feeling; unemotional: how cold and calculating he was | cold black eyes | cold politeness.
      noun
      1. a low temperature, especially in the atmosphere; cold weather; a cold environment: my teeth chattered with the cold | they nearly died of cold.
      2. a freezer.
      3. a phonological variant (straight movements) of winter.
      Adam Frost{"video":"dominance: equal;\\n\ud8d8\udd31\ud8fc\udc61\ud8d8\udd39\ud8fc\udc61\ud8fc\udc07\ud8e2\ude63\ud8e2\ude77.mov"} HH,(33'9u!-frost2024/01/18 02:11:122026/06/24 21:42:46AS14c31S2fe00S14c39S2fe00S38006S22f04S22f14S1853dS18535M538x532S14c31506x469S14c39468x469S22f04512x498S22f14462x498S1853d511x513S18535462x513M538x532S14c31506x469S14c39468x469S22a04518x499S22a14468x499S1853d511x513S18535462x513adjective
      1. easy to mold, cut, compress, or fold; not hard or firm to the touch: soft margarine | the ground was soft beneath their feet.
        • having a smooth surface or texture that is pleasant to touch; not rough or coarse: soft crushed velvet | her hair felt very soft.
        • rounded; not angular: the soft edges of their adobe home.
      2. hav27x518S15a3a474x505S11040480x484S2a400502x482verb to roll back and forth while laying down: the dog likes to roll around in the mud.
        • to roll back and forth during sleep: he tossed and turned all night.
        • to roll back and forth uncontrollably during a medical episode: he was seizuring on the floor when help arrived.
        adjective [predicative] (of a person or animal) unable to rest or relax as a result of anxiety or boredom: the audience grew restless and started leaving.
        • offering no physical or emotional rest; involving constant activity or motion: he was restless all night.
        noun a sudden attack of illness, especially an epileptic fit: the patient had a seizure.Adam Frost{"video":"dominance: right;\\n\ud8c1\ude41\ud8fc\udc61\ud8c8\uddfb\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e7\udd81.mov"} o* 335k!efrost2024/01/20 20:16:542026/06/05 19:01:42AS15a30S2fe00S15a1aS2fe00S37f04S26a00M525x523S15a1a476x478S15a30481x496S26a00498x504M520x522S15a1a481x479S15a30488x495S26500506x500noun [frequentative] an enclosed compartment for baking and heating food: place the dish in a preheated oven.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddf1\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8fb\udfa5\ud8e1\udfc1.mov"}k)33'9s!-frost2024/01/18 02:16:352026/08/02 18:42:27AS14c31S2fe00S14c39S2fe00S38006S22a04S22a14S1853dS18535M538x532S14c31506x469S14c39468x469S22a04518x499S22a14468x499S1853d511x513S18535462x513M538x532S14c31506x469S14c39468x469S22f04512x498S22f14462x498S1853d511x513S18535462x513verb to cover or touch with liquid: he wet a finger and flicked through z+ 33u !!}frost2024/01/20 20:18:472026/05/03 21:31:16AS1f702S38517S1f70aS38511S21100S23600S23610M550x522S1f702511x502S1f70a475x502S21100494x479S23600511x479S23610451x479verb to wash by immersing one's body into water: she was advised to bathe or shower daily.
        noun an act or process of immersing and washing one's body in a large container of water: she likes a long, hot bath.
        • a bathtub.
        Adam Frost{"video":"dominance: equal;\\n\ud8d7\udca3\ud8fc\uddf8\ud8d7\udcab\ud8fc\uddf2\ud8d9\ude61\ud8dd\udc41\ud8dd\udc51.mov"} }}, 33 E!Ufrost2024/01/20 20:21:012026/08/27 22:39:43AS14710S2fe00S10006S2df08M511x523S14710492x501S2df08490x478
        adjective
        1. of the color intermediate between green and violet, as of the sky or sea on a sunny day: the clear blue sky | a blue silk shirt | deep blue eyes.
        INFLECTED FORMS
        blue (adjective) [in isolation]
        Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udeb1\ud8fc\udc61\u00d8\ud8ec\udfa9.mov"} 55G-33C!mfrost2024/01/20 20:24:222026/08/27 18:42:24AS14720S30005S10006S21100S22a04M521x558S2ff00482x483S14720507x503S21100508x527S22a04508x543M527x555S2ff00482x483S14720507x503S20e00508x527S22f04502x541
        adjective
        1. of the color produced by mixing red, yellow, and blue, as of dark wood or rich soil: an old brown coat | she had warm brown eyes.
        noun
        1. the color or pigment produced by mixing red, yellow, and blue, as of dark wood or rich soil: the brown of his eyes | a pair of boots in brown | the print is rich with velvety browns.
        INFLECTED FORMS
        brown [in isolation]
        Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udec1\ud8f0\udc06\u00d8\ud8d9\ude61\ud8db\udfc5.mov"} :B:/ 33I!Gfrost2024/01/20 20:30:192026/05/03 23:52:14AS10000S2fe02S10006S2ea06M548x528S10000526x491S2ea06523x473S36d00479x524M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M550x518S10000528x488S2ea06525x470S2ff00482x483 S38800464x496You might be looking for ceiling fan.Adam Frost{"video":"dominance: right;"}:. 33 M!)frost2024/01/20 20:28:142025/04/18 22:53:37AS10000S30006S10006S2ea06M550x518S10000528x488S2ea06525x470S2ff00482x483noun a mechanical device with rotating blades that is mounted on the ceiling of a room and used to circulate air for cooling or ventilation: we turned on the ceiling fan to keep the room cool during the summer.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8f0\udc07\u00d8\ud8ed\udfc7.mov"}ct] : I felt angry and humiliated.
        • [no object, with complement] to consider oneself to be in a particular state or exhibiting particular qualities: he doesn't feel obliged to visit every weekend.
        • (feel like) to have the strength and energy to do or deal with: after the accident she didn't feel like driving.
        • to be emotionally affected by: he didn't feel the loss of his mother so keenly.
        • (feel for) have compassion for: poor woman—I feel for her.
      3. [with clause] to have a belief or impression, especially without an identifiable reason: she felt that the woman positively disliked her.
        • to hold an opinion: I felt I could make a useful contribution.

      DERIVATIVES
      feeling [frequentative]Adam Frost{"video":"dominance: right;\\n\ud8d2\udde2\ud8fc\uddf1\u00d8\ud8d9\udd41\ud8db\udfc1.mov"} ;(1 33[ !}frost2024/01/20 20:37:462025/11/19 19:05:56AS20340S2fe00S20348S2fe00S38006S2d503S2d51bM536x518S20340517x482S20348469x482S2d503517x503S2d51b465x503noun a small recess with a door and typically shelves, used for storing or displaying articles: a medicine cabinet | a kitchen cupboard.
      verb to open a small recess or similar with doors: Jake looked in the cupboards for a cup.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8fc\udc07\ud8eb\udfe4\ud8eb\udffc.mov"}f033[!}frost2024/01/20 20:34:352026/06/26 17:02:10AS20310S2fe00S20318S2fe00S38006S27102S27116M541x520S20310507x493S20318478x493S27102526x480S27116460x480M527x517S20310507x484S20318478x484S2ea32502x502S2ea46473x502adjective LL|n3 33Q_!Ufrost2024/01/20 20:42:572026/09/23 16:54:47AS1f010S2fe00S10006S2df08M516x520S1f010485x505S2df08495x480M516x524S1f010485x509S2e100493x476
      adjective
      1. of the color between blue and yellow in the spectrum; colored like grass or emeralds: bright green leaves.
      INFLECTED FORMS
      green (adjective) [in isolation]
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d6\ude11\ud8fc\udc61\u00d8\ud8ec\udfa9.mov"}>2 33 3!efrost2024/01/20 20:40:462026/05/05 16:40:07AS10120S2fe00S10006S18720M509x532S10120492x469S18720491x503noun a dishwasher.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c0\udc81\ud8fc\udc61\u00d8\ud8cc\udec1.mov"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx wo433[q?!}frost2024/01/20 20:48:142026/05/23 18:36:10AS20340S2fe00S20348S2fe00S38006S21d00S21d00M529x514S20340513x499S20348472x499S21d00511x487S21d00471x487S38b00470x493 M564x516S20340549x495S20348436x495S26a02532x489S26a16454x489S14c40504x485S14c48471x485 S38b04470x493noun an appliance that uses microwaves to cook or heat food.

      PHONOLOGICAL VARIANTS
      microwave with inward hand movementsAdam Frost{"video":"dominance: equal;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8fc\udc07\ud8da\udee1\ud8da\udee1.mov"} 0533'!Ofrost2024/01/20 20:49:282026/05/21 01:57:20AS20340S2fe00S20348S2fe00S38006S26a02S26a16S14c40S14c48M564x516S20340549x495S20348436x495S26a02532x489S26a16454x489S14c40504x485S14c48471x485M529x514S20340513x499S20348472x499S21d00511x487S21d00471x487noun a phonological variant (inward hand movements) of microwave.Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8fc\udc07\ud8e1\udfc3\ud8e1\udfd7\ud8c7\udcc1\ud8c7\udcc9.mov"} n6 33'UE!Gfrost2024/01/20 20:53:422026/05/03 21:31:57AS20340S2fe00S20348S2fe00S38006S26a02S26a16S15740S15748M557x516S20340542x495S20348444x495S26a02525x489S26a16462x489S15740503x484S15748480x484M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M564x516S20340549x495S20348436x495S26a02532x489S26a16454x489S14c40504x485S14c48471x485 S38800464x496You might be looking for microwave.Adam Frost{"video":"dominance: equal;"}offlrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|vzw{x|y~z{|}~      "$&'(*+,-/1345689:;<=>@ABCDEFGHIKMOQST…UÅWąXŅYƅZDž\Ʌ^ʅ`˅b̅d΅eЅgхi҅jӅkԅmՅoօpׅq؅rمsڅtۅu܅w݅yޅ{߅}~     LA8 33) 7!Afrost2024/01/20 21:01:122025/02/16 20:22:27AS20310S30004S10006S20500S21600M518x538S2ff00482x483S20310492x513S21600496x530adjective reddish yellow in color: there was an orange glow in the sky.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd31\ud8f0\udc05\u00d8\ud8d8\udde1\ud8da\udc41.mov"}7 33 +!)frost2024/01/20 20:58:472026/06/05 17:21:07AS13f20S2fe00S10006S22104M515x513S13f20486x498S22104487x488exclamation used to give a negative response: “Is anything wrong?” “No, I'm fine.”.
      • expressing disagreement or contradiction: “This is boring.” “No, it's not!”.

      INFLECTED FORMS
      no [in isolation]Adam Frost{"video":"dominance: right;\\n\ud8c5\udfc1\ud8fc\udc61\u00d8\ud8db\udc65.mov"} 9 33)?!Gfrost2024/01/20 21:02:542026/05/03 23:52:30AS15410S30004S10006S20500S20310M518x532S2ff00482x483S15410483x507S20310500x513M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M518x538S2ff00482x483S20310492x513S21600496x530 S38800464x496You might be looking for orange.Adam Frost{"video":"dominance: right;"} +: 33u?!Gfrost2024/01/20 21:06:182026/05/03 23:52:38AS15410S30004S10006S20500S20310S15410S20310M531x533S2ff00482x483S15410465x508S20310482x513S15410499x508S20310516x513M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M518x538S2ff00482x483S20310492x513S21800491x530 S38800464x496You might be looking for orange.Adam Frost{"video":"dominance: right;"} LL0; 33O )!frost2024/01/20 21:09:002026/05/28 19:59:34AS17620S2fe00S10006S10e20S14a20S11920M511x550S17620495x451S10e20495x471S14a20495x505S11920489x524noun an enclosed compartment, as in a kitchen range, for cooking and heating food: bake the dish in a preheated oven.
      • a small furnace or kiln.
      • used to describe a very hot place: the sun was beating down onto my little tent and it was like an oven in there.
      • historical a cremation chamber or gas chamber in a Nazi concentration camp.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cb\udc61\ud8fc\udc61\u00d8\ud8c1\udd61\ud8c6\udfe1\ud8c2\udd81.mov"}   o< 33) W!}frost2024/01/20 21:13:572026/05/05 16:40:32AS11a20S2fe00S10006S14a20S1ce20M511x542S11a20490x459S14a20490x493S1ce20489x512noun
      1. an appliance or compartment which is artificially kept cool and used to store food and drink.
      2. an official who watches a game or match closely to ensure that the rules are adhered to and (in some sports) to arbitrate on matters arising from the play: the referee sent off two French players.
      3. the use of a source of information in order to ascertain something: popular works of reference | [as modifier] : a reference work.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c2\udde1\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8d3\udd61.mov"} q]=33C/!mfrost2024/01/20 21:20:022026/08/26 23:53:12AS14007S30004S10006S20e00S22a04M521x548S2ff00482x483S14007497x512S20e00484x519S22a04483x533M521x545S2ff00482x483S14007497x512S20e00481x517S22f04474x531
      adjective
      1. of a color intermediate between red and white, as of coral or salmon: bright pink lipstick | her healthy pink cheeks.
      noun
      1. the color or pigment intermediate between red and white, as of coral or salmon: she looks good in pink.
      INFLECTED FORMS
      pink [in isolation]
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc08\ud8f0\udc05\u00d8\ud8d9\udd41\ud8db\udfc5.mov"} WI> 33Q!Ufrost2024/01/20 21:21:272026/08/27 18:47:29AS14051S2fe00S10006S2a204M517x528S14051484x473S2a204494x500M517x532S14051484x468S2a40c492x496
      adjective
      1. of a color intermediate between red and blue: a faded purple T-shirt.
      INFLECTED FORMS
      purple (adjective) [in isolation]
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc52\ud8fc\udc61\u00d8\ud8e7\udcc5.mov"} >$@ 33u S!frost2024/01/20 21:24:542026/05/28 20:19:32AS20320S2fe00S10006S1fb20S17620S10e20S14a20M508x556S20320492x445S1fb20492x464S17620492x487S10e20492x507S14a20492x541noun an apparatus for cooking or heating that operates by burning fuel or using electricity.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8d7\ude41\ud8cb\udc61\ud8c1\udd61\ud8c6\udfe1.mov"}>? 33O E!frost2024/01/20 21:23:262026/05/28 20:17:55AS20320S2fe00S10006S19220S11920S14020M518x551S20320497x449S19220497x468S11920491x491S14020483x521noun a fixed basin with a water supply and a drain: I stood at the kitchen sink | [as modifier] : a sink unit with cupboard and drawers under.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8cd\udee1\ud8c2\udd81\ud8c6\udc21.mov"} !![A33O3!Yfrost2024/01/20 21:26:282026/08/29 17:53:53AS14c02S38510S10006S20500S26a00S18501M518x535S14c02483x503S20500501x524S26a00491x486S18501489x466M517x535S14c02484x503S20500502x524S26500498x485S18501490x466
      adjective, noun [in isolation] the color white.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc83\ud8fc\uddf1\u00d8\ud8d8\udde1\ud8e1\udfc1\ud8cc\udde2.mov"} $B 33O!=!Gfrost2024/01/20 21:28:042026/05/03 23:52:57AS15702S38510S10006S20500S26a00S18501M515x534S15702485x506S20500498x523S26a00488x487S18501486x467M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M518x535S14c02483x503S20500501x524S26a00491x486S18501489x466 S38800464x496You might be looking for white.Adam Frost{"video":"dominance: right;"} TT(C 33QS!Ufrost2024/01/20 21:29:552026/09/16 21:15:36AS19a10S2fe00S10006S2df08M514x521S19a10486x501S2df08490x480M514x525S19a10486x505S2e100487x475
      adjective
      1. of the color between green and orange in the spectrum, a primary subtractive color complementary to blue; colored like ripe lemons or egg yolks: curly yellow hair.
      INFLECTED FORMS
      yellow (adjective) [in isolation]
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ce\uddd1\ud8fc\udc61\u00d8\ud8ec\udfa9.mov"} ZQD 33[ i!}frost2024/01/20 21:37:512026/05/11 22:28:11AS1ed40S2fe00S1ed48S2fe00S38006S2f900S2f900M530x514S1ed40504x487S1ed48471x487S2f900517x509S2f900472x509affix used to represent the position or movement of a flat object with a rounded outline, conceptualized as horizontal: I want the round table over there | we keep the circular lids here.
      noun a flat object typically circular and made of china, from which food is eaten or served: he pushed his empty plate to one side and sipped his wine | a dinner plate.
      • an amount of food on a plate: a plate of spaghetti.
      • a course of a meal, served on one plate: I'll have the salad plate.
      Adam Frost{"video":"dominance: equal;\\n\ud8d6\udd21\ud8fc\udc61\ud8d6\udd29\ud8fc\udc61\ud8fc\udc07\ud8ef\udd61\ud8ef\udd61.mov"} \PE 33C ;!Afrost2024/01/20 21:44:432026/04/21 17:53:55AS1e101S33200S10006S20e00S22f04M542x529S33100482x483S1e101486x500S20e00523x500S22f04517x515noun
      1. a common viral infection in which the mucous membrane of the nose and throat becomes inflamed, typically causing running at the nose, sneezing, a sore throat, and other similar symptoms: Suzie's got a cold | a bad cold | [as modifier] : a cold remedy.
      2. a square of cotton or other finely woven material, typically carried in one's pocket and intended for blowing or wiping one's nose.
        • a tissue.
      verb to wipe one's nose clean: Kate wiped her nose with a napkin.Adam Frost{"video":"dominance: right;\\n\ud8d5\udc62\ud8f4\udec1\u00d8\ud8d9\udd41\ud8dc\udda5.mov"} zF 33[ ;!}frost2024/01/20 21:46:352026/01/11 19:53:28AS15a51S2fe00S15a39S2fe00S21400S20e00S22115M525x518S15a39476x482S15a51484x495S20e00502x483S22115506x486noun a substance used with water for washing and cleaning: a bar of soap.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8db\udc76.mov"} ``G 33C S!Afrost2024/01/20 21:48:062026/05/17 23:42:28AS20311S30007S10006S22f03S14c11M568x518S2ff00482x483S20311547x445S22f03535x457S14c11515x468noun an enclosure under which a person stands under a spray of water to wash.
      • the apparatus in a shower that produces the spray of water: she turned off the shower and reached for a towel.
      • an act of washing oneself in a shower: she had a nice refreshing shower.
      verb [no object] to wash oneself in a shower: she showered and went down to breakfast.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd32\ud8f0\udc08\u00d8\ud8dc\udda4\ud8c7\udc92.mov"} H 33C!?!Gfrost2024/01/20 21:51:392026/05/03 23:53:14AS20311S2fe02S10006S22f03S14c11M569x537S36d00479x533S20311548x464S22f03536x476S14c11516x487M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M568x518S2ff00482x483S20311547x445S22f03535x457S14c11515x468 S38800464x496You might be looking for shower.Adam Frost{"video":"dominance: right;"} I 33C!?!Gfrost2024/01/20 21:52:322026/05/03 23:53:24AS20311S30007S10006S22f03S15711M568x518S2ff00482x483S20311547x445S22f03535x457S15711514x471M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M568x518S2ff00482x483S20311547x445S22f03535x457S14c11515x468 S38800464x496You might be looking for shower.Adam Frost{"video":"dominance: right;"} XXK 33i S!efrost2024/01/20 21:56:152025/11/21 18:22:25AS20320S30006S20328S30002S27106S27116M569x522S2ff00482x483S20320534x494S20328452x494S27106554x482S27116432x482noun a piece of thick absorbent cloth or paper used for drying oneself or wiping things dry.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd41\ud8f0\udc07\ud8d8\udd49\ud8f0\udc03\ud8e2\ude67\ud8e2\ude77.mov"}J 33C!?!Gfrost2024/01/20 21:53:552026/05/03 23:53:35AS20311S2fe02S10006S22f03S15711M569x537S36d00479x533S20311548x464S22f03536x476S15711515x490M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M568x518S2ff00482x483S20311547x445S22f03535x457S14c11515x468 S38800464x496You might be looking for shower.Adam Frost{"video":"dominance: right;"} ::zM 33u !!}frost2024/01/27 20:06:042025/11/21 18:29:10AS15a30S2fe00S15a5aS38617S20500S22a00S2f900M514x542S15a30502x483S37800507x510S15a5a487x528S22a00501x465S2f900502x458adverb throughout the entire morning: I studied all morning.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddf1\ud8fc\udc61\ud8c8\ude1b\ud8fc\ude58\ud8d8\udde1\ud8db\udfc1\ud8ef\udd61.mov"}DL 33u;=!Gfrost2024/01/20 22:01:542026/05/03 23:53:45AS20320S2fe03S20328S2fe03S38006S27106S27116M568x522S36d00479x518S20320533x490S20328451x490S27106553x478S27116431x478M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M569x522S2ff00482x483S20320534x494S20328452x494S27106554x482S27116432x482 S38800464x496You might be looking for towel.Adam Frost{"video":"dominance: right;"} X}X!O 33OQi!efrost2024/01/27 20:18:482026/05/18 06:40:20AS15a1bS2fe00S15a1aS38617S20500S2880eM531x525S15a1a469x475S37803495x477S15a1b508x497S2880e490x513M513x516S2031a498x501S18220487x485adverb [durative] throughout the entire night.
      adjective [attributive] lasting, open, or operating throughout the night: an all-night party.Adam Frost{"video":"dominance: right;\\n\ud8c8\udddc\ud8fc\udc61\ud8c8\udddb\ud8fc\ude58\ud8d8\udde1\ud8e4\udf0f.mov"}N 33u +!}frost2024/01/27 20:14:142026/01/17 19:16:57AS15a50S2fe00S15a1aS38615S20500S22a04S2f900M522x532S15a50491x468S37800496x495S15a1a478x520S22a04509x476S2f900510x493adverb throughout the entire afternoon: she cooked all afternoon.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\ud8c8\udddb\ud8fc\ude56\ud8d8\udde1\ud8db\udfc5\ud8ef\udd61.mov"}   Q 33 !frost2024/01/27 20:40:402025/11/21 18:28:52AS10050S2fe00S15a36S2fe00S21400S21100S26506S2f900M528x519S15a36472x507S10050477x482S21100497x495S26506513x496S2f900515x513adverb throughout the entire week: I worked all week.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc51\ud8fc\udc61\ud8c8\uddf7\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e1\udde7\ud8ef\udd61.mov"}jP 33O ?!efrost2024/01/27 20:37:032025/04/23 00:21:38AS15a17S2fe00S15a1aS38615S20500S28802M525x527S3780b488x493S15a1a476x515S15a17502x479S28802485x473adverb throughout the entire day: she sleeps all day and goes out at night.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd8\ud8fc\udc61\ud8c8\udddb\ud8fc\ude56\ud8d8\udde1\ud8e4\udf03.mov"} tS 33g 3!frost2024/01/27 20:49:362025/11/21 18:38:32AS10010S2fe00S15a18S2fe00S21406S2e700S20500S2f900M515x534S15a18485x489S10010498x467S2e700500x501S2f900500x529adverb throughout the entire hour: the meeting went on all hour long.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc11\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8ed\udea1\ud8d8\udde1\ud8ef\udd61.mov"}R 33 !frost2024/01/27 20:45:392026/01/11 20:24:03AS10002S2fe00S10028S2fe00S21414S21100S22a04S2f900M519x530S10028481x471S10002489x473S21100505x490S22a04505x507S2f900506x525adverb throughout the entire month: it rained all month.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc03\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf95\ud8d9\ude61\ud8db\udfc5\ud8ef\udd61.mov"} D5T 33[ 1!}frost2024/01/27 20:52:062026/08/28 17:55:44AS10051S2fe00S10059S2fe00S21400S20e00S22a04M527x521S10059473x479S10051497x479S20e00494x491S22a04493x506
      modal verb
      1. to be unable to: he can't afford it.
        • to be unable to due to lack of knowledge or skill: I can't speak Italian.
        • to be unable to due to lack of opportunity or possibility: vacationers can't take money abroad in some countries.
        • to express doubt or surprise about the possibility of something being the case: he can't mean that.
      2. to not be permitted to: you can't use the phone.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc52\ud8fc\udc61\ud8c0\udc5a\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8db\udfc5.mov"} U 33i q!efrost2024/01/27 20:53:482026/05/17 23:53:35AS10012S30007S1001aS30001S26a02S26a16M544x531S2ff00482x483S10012514x484S26a02528x503S1001a454x484S26a16456x504noun pain felt in the head: I've got a splitting headache | she complained of a severe headache.
      • [informal] a thing or person that causes worry or trouble; a problem: an administrative headache.
      Adam Frost{"video":"dominance: equal;\\n\ud8c0\udc13\ud8f0\udc08\ud8c0\udc1b\ud8f0\udc02\ud8e1\udfc3\ud8e1\udfd7.mov"} NNcW 33i !efrost2024/01/27 22:58:422025/11/21 18:44:48AS20350S38530S20358S38530S2c300S21600M549x532S36d00479x469S20350501x514S20358484x517S2c300523x507S21600504x502noun severe abdominal pain, especially caused by menstruation.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd71\ud8fc\ude11\ud8d8\udd79\ud8fc\ude11\ud8ea\udd21\ud8da\udc41.mov"}GV 33u;C!Gfrost2024/01/27 20:56:352026/05/03 21:33:00AS10012S2fe02S1001aS2fe02S38006S26a02S26a16M544x524S36d00479x510S10012514x477S26a02528x496S1001a454x477S26a16456x497M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M544x531S2ff00482x483S10012514x484S26a02528x503S1001a454x484S26a16456x504 S38800464x496You might be looking for headache.Adam Frost{"video":"dominance: equal;"} Dverb       to expel air from the lungs with sudden force, especially to clear the airway: he started to cough.
      noun an act of coughing, especially to clear the airway: that cough was loud. Adam Frost{"video":"dominance: right;\\n\ud8d8\udd32\ud8fc\uddf1\u00d8\ud8d8\ude41.mov"} &&VY 33i }!efrost2024/01/27 23:11:592026/05/03 21:33:38AS10012S36a00S1001aS36a00S26a02S26a16M536x567S2ff00482x483S10012506x521S26a02520x540S1001a465x521S26a16466x540noun a condition marked by pain in the throat, typically caused by inflammation due to a cold or other virus: she whispers through her role as if she's got a sore throat.Adam Frost{"video":"dominance: equal;\\n\ud8c0\udc13\ud8f9\udfc1\ud8c0\udc1b\ud8f9\udfc1\ud8e1\udfc3\ud8e1\udfd7.mov"} -#Z 33i !efrost2024/01/27 23:17:462026/03/09 23:17:05AS14e51S38620S2035aS2fe00S21100S27102M524x533S37806477x512S2035a509x505S14e51477x504S21100482x481S27102497x468verb to rub the forearm with one's fingernails to relieve irritation: Jessica rolled up her sleeve and scratched her arm. noun an uncomfortable sensation on the skin that causes a desire to scratch: my arm has a bad itch.
      adjective having or causing such irritation on the forearm: dry, itchy skin | an itchy rash.Adam Frost{"video":"dominance: right;\\n\ud8c7\udd92\ud8fc\ude61\ud8d8\udd7b\ud8fc\udc61\ud8d9\ude61\ud8e2\ude63.mov"} Qy\ 33A S!}frost2024/01/27 23:45:182026/05/17 23:54:49AS11040S2fe00S15a3aS2fe00S21400S20500S2a400M5+[ 33[ !}frost2024/01/27 23:41:152026/05/26 03:00:02AS15440S2fe00S15448S2fe00S38006S26506S26512M541x513S15440505x488S15448480x488S26506526x495S26512459x495adjective [at center locus] (especially of a part of the body) larger or rounder in size, typically as a result of an accumulation of fluid: swollen glands.
      verb [at center locus] (especially of a part of the body) to become larger or rounder in size, typically as a result of an accumulation of fluid: her bruised knee was already swelling up.Adam Frost{"video":"dominance: equal;\\n\ud8c7\udfc1\ud8fc\udc61\ud8c7\udfc9\ud8fc\udc61\ud8fc\udc07\ud8e1\udde7\ud8e1\uddf3.mov"}r irrational one: [with clause] : he had the feeling that he was being watched.
    2. the ability to feel through the sense of touch: a loss of feeling in the hands.
    3. (feeling for) a sensitivity to or intuitive understanding of: he seems to have little feeling for art.
    4. an act of touching something to examine it.
    5. a sensation given by an object or material when touched: nylon cloth with a cotton feel.
    6. the impression given by something: the restaurant has a modern bistro feel.
    Adam Frost{"video":"dominance: right;\\n\ud8d2\udde2\ud8fc\uddf1\u00d8\ud8d9\udd41\ud8dc\udda1.mov"} ;^ 33) +!Afrost2024/01/27 23:49:362026/06/28 18:23:57AS15402S38530S10006S21100S2e500M521x531S36d00479x469S15402487x499S21100493x517adjective causing revulsion or a sickening feeling: he had the most disgusting rotten teeth.
    noun a feeling of discomfort in the stomach: you know chips give me indigestion.Adam Frost{"video":"dominance: right;\\n\ud8c7\udf83\ud8fc\ude11\u00d8\ud8d9\ude61\ud8ed\udde1.mov"}`] 33 !Afrost2024/01/27 23:47:552026/06/28 18:23:13AS15402S38510S10006S21100S2e500M513x516S15402488x484S21100494x502adjective arousing repulsion or strong indignation: he had gross rotten teeth | I think the decision is disgusting.Adam Frost{"video":"dominance: right;\\n\ud8c7\udf83\ud8fc\uddf1\u00d8\ud8d9\ude61\ud8ed\udde1.mov"} " ` 33 s!)frost2024/01/28 00:30:342026/05/17 23:55:14AS15400S30007S10006S2e502M536x518S2ff00482x483S15400521x474S2e502492x458adjective [predicative] having or involving a sensation of spinning around and losing one's balance: Jonathan was dizzy and needed to sit. Adam Frost{"video":"dominance: right;\\n\ud8c7\udf81\ud8f0\udc08\u00d8\ud8ed\udde3.mov"}Z_ 33u a!}frost2024/01/28 00:20:382025/11/21 18:59:40AS14c41S33d00S14c48S2fe00S20500S2b700S2b711M525x579S33b00482x483S14c41476x515S14c48485x548S2b700460x491S2b711506x524verb to eject matter from the stomach through the mouth: the sickly stench made him want to vomit | I made it as far as the bathroom and threw up my dinner.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcc2\ud8f5\udee1\ud8c7\udcc9\ud8fc\udc61\ud8d8\udde1\ud8e9\udca1\ud8e9\udcb2.mov"} ;;b 33 !)frost2024/01/28 00:39:062026/07/13 17:20:56AS14c02S38530S10006S2e300M521x541S36d00479x459S14c02483x490S2e300490x514noun [at stomach locus] the region or part of the body between the chest and thighs: pain in the stomach can be caused by any number of things.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc83\ud8fc\ude11\u00d8\ud8ed\udd21.mov"}%a 33[ !}frost2024/01/28 00:35:362025/11/21 19:05:53AS14c41S2fe00S1f548S2fe00S21404S21000S22f04M530x524S1f548488x477S14c41471x497S21000508x489S22f04505x507noun a condition in which feces are discharged from the bowels frequently and in a liquid form: a range of symptoms including diarrhea and vomiting.
    verb to pass liquid discharge from the bowels: he had diarrhea all morning.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcc2\ud8fc\udc61\ud8d7\udc29\ud8fc\udc61\ud8d9\udf85\ud8d9\ude01\ud8dc\udda5.mov"} yyd 33[ y!}frost2024/01/28 00:43:292026/05/17 23:55:38AS20340S2fe00S20348S2fe00S21400S21100S2e700M521x521S20340488x487S20348480x504S21100505x479S2e700506x496adjective [predicative] suffering pain from a part of one's body: he was sore from the long ride.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8ed\udea1.mov"}fc 33O !frost2024/01/28 00:41:102026/05/04 02:49:44AS11a20S2fe00S10006S1f720S20320S11502M515x544S11a20500x457S1f720495x491S20320500x510S11502485x529noun an area of redness and spots on a person's skin, appearing especially as a result of allergy or illness: a red itchy rash appeared on her legs | next day he broke out in a rash.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c2\udde1\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8d8\udd41\ud8c1\udfe3.mov"}/li>
  • to make or become inoperative: [no object] : the machine has broken and they can't fix it until next week | [with object] : I think I've broken the mechanism in my watch.
  • (of the amniotic fluid surrounding a fetus) to be or cause to be discharged when the sac is ruptured in the first stages of labor: [no object] : she realized her water had broken.
  • [with object] informal to open (a safe) forcibly.
  • [with object] to succeed in deciphering (a code): ciphers are easily broken by the new wonder machines.
  • [with object] to fail to observe (a law, regulation, or agreement): the district attorney says she will prosecute retailers who break the law | the legally binding contract can only be broken by mutual consent | if I don't go, I'll be breaking my promise.
    • Adam Frost{"video":"dominance: equal;\\n\ud8d8\udd71\ud8fc\udc61\ud8d8\udd79\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e7\udcc9\ud8e7\udcd1.mov"} }Ye 33) g!Afrost2024/01/28 00:46:232026/06/05 19:56:37AS1c501S38510S10006S20e00S22a00M521x515S1c501496x488S20e00479x503S22a00479x485verb
    1. to be aware of (a person or object) through touching or being touched: she felt someone touch her shoulder.
    2. to experience (an emotion or sensation): I felt a sense of excitement | we feel very strongly about freedom of expression | [no obje object] (of a person) to become tranquil and quiet: gradually I calmed down and lost my anxiety.
    3. [no object] to adopt a more steady or secure style of life, especially in a permanent job and home: one day I will settle down and raise a family.
    4. to reduce the contents of a container holding a substantial amount: we drained the swimming pool.
    Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcd1\ud8fc\udc61\ud8c7\udcd9\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"} //g 33) _!Afrost2024/01/28 00:51:572025/11/21 19:59:28AS11e41S33200S10006S20500S23f03M528x548S33100482x483S11e41478x515S23f03505x527adjective very poor or bad; disgusting: the service is usually lousy | lousy weather.
  • to estimate or assess the extent, quality, value, or effect of (something): it is hard to measure teaching ability.
    • PHONOLOGICAL VARIANTS
    measure (verb) with double touching
    noun the branch of science and technology concerned with the design, building, and use of engines, machines, and structures: he wants to study engineering | [as modifier] : an engineering degree. Adam Frost{"video":"dominance: right;\\n\ud8ce\udde1\ud8fc\udc61\ud8ce\udde9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ea\udde4.mov"} ?2b 33[ +!}frost2024/03/13 21:06:042025/02/20 23:26:42AS18201S2fe00S15a06S2fe00S21410S20e00S22f04M527x522S15a06474x498S18201481x479S20e00507x493S22f04502x508noun a food made of flour, water, and a leavening agent such as yeast mixed together and baked: a loaf of bread | Italian breads.Adam Frost{"video":"dominance: right;\\n\ud8cc\udcc2\ud8fc\udc61\ud8c8\uddc7\ud8fc\udc61\ud8d9\udf91\ud8d9\udd41\ud8dc\udda5.mov"}5a 33 s!frost2024/03/11 05:05:302026/05/30 23:28:41AS14017S2fe00S1401fS2fe00S21414S20e00S26a02S26a16M523x534S1401f479x466S14017499x474S20e00492x500S26a02477x507S26a16505x507ve c 33g !Efrost2024/03/13 21:09:032025/02/20 19:43:59AS18510S2fe00S10028S2fe00S21406S20e00S22a04S18537S20e00S22a04M521x553S10028479x447S18510496x448S20e00498x462S22a04498x476S10028479x494S18537495x495S20e00497x524S22a04497x538noun a long curved fruit that grows in clusters and has soft pulpy flesh and yellow skin when ripe: a bunch of bananas.Adam Frost{"video":"dominance: right;\\n\ud8cc\uddf1\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8db\udfc5\ud8cc\ude18\ud8d9\udd41\ud8db\udfc5.mov"} '' e 33i !Yfrost2024/03/13 21:43:032026/06/03 23:01:10AS10612S30004S10006S21800S21100S26502M531x537S2ff00482x483S10612505x512S21800506x529S21100490x519S26502472x519noun a breakfast food made from roasted grain, typically eaten with milk: a bowl of cereal | [as modifier] : a cereal box.Adam Frost{"video":"dominance: right;\\n\ud8c0\ude53\ud8f0\udc05\u00d8\ud8da\udd01\ud8d9\ude61\ud8e1\udde3.mov"}1d 333 !Efrost2024/03/13 21:18:372025/02/20 18:59:06AS11512S2fe00S1151aS2fe00S21406S20500S22124S22124S26506S26512M552x513S11512503x498S1151a467x498S22124504x488S22124474x488S26506537x497S26512448x497noun cured meat from the sides and belly of a pig, having distinct strips of fat and typically served in thin slices: crisp rashers of bacon | [as modifier] : a bacon sandwich.Adam Frost{"video":"dominance: right;\\n\ud8c1\udff3\ud8fc\udc61\ud8c1\udffb\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8db\udc85\ud8db\udc85\ud8e1\udde7\ud8e1\uddf3.mov"} "f 33A !}frost2024/03/13 21:45:422025/02/20 19:36:30AS17610S2fe00S19209S2fe00S21406S20a00S2c400M541x512S17610482x494S19209460x492S2c400501x489noun a small roundish juicy fruit
    • a small, round stone fruit that is typically bright or dark red: a bowl of cherries | [as modifier] : cherry pie.
    • a small roundish juicy fruit without a stone: juniper berries.
    Adam Frost{"video":"dominance: right;\\n\ud8cb\udc51\ud8fc\udc61\ud8cd\udeca\ud8fc\udc61\ud8d9\udf87\ud8d8\udfc1\ud8ea\udd81.mov"} ddh 33[ c!}frost2024/03/13 21:55:332025/02/20 19:22:37AS11551S2fe00S15a39S2fe00S21400S20e00S26a05M523x524S15a39487x476S11551496x485S20e00477x497S26a05483x503noun a pale yellow edible fatty substance made by churning cream and used as a spread or in cooking.Adam Frost{"video":"dominance: right;\\n\ud8c2\udc32\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc6.mov"}g 33A m!}frost2024/03/13 21:52:072025/02/20 19:47:24AS17610S2fe00S1000aS2fe00S21406S20a00S2c400M543x514S17610483x492S1000a457x499S2c400503x487noun
    1. a sweet soft red fruit with a seed-studded surface.
    2. the low-growing plant which produces the strawberry, having white flowers, lobed leaves, and runners, and found throughout north temperate regions.
    Adam Frost{"video":"dominance: right;\\n\ud8cb\udc51\ud8fc\udc61\ud8c0\udc0b\ud8fc\udc61\ud8d9\udf87\ud8d8\udfc1\ud8ea\udd81.mov"} |i 33Q'!)frost2024/03/13 21:58:572026/06/05 17:26:07AS15a28S2fe00S10006S26507M513x520S15a28488x493S26507500x481M513x520S15a28501x493S26501488x481possessive determiner [at right front locus] belonging to or associated with a person or thing: James sold his business | Patricia loved her job.
    possessive pronoun [at right front locus] used to refer to a thing or things belonging to or associated with a person or thing: her room is cleaner than his | your name is the same as hers.

    INFLECTED FORMS
    his/her/its [at left front locus]Adam Frost{"video":"dominance: right;\\n\ud8c8\udde9\ud8fc\udc61\u00d8\ud8e1\udde8.mov"} ??=j33g#!frost2024/03/13 22:04:062026/06/07 23:37:59AS20340S2fe00S20348S2fe00S21400S20500S26500S10040M511x542S20340496x511S20348490x527S26500496x492S10040496x459M514x542S20340493x511S20348487x527S26a00487x493S10040493x459adverb
    1. the calendar year immediately following the current one: we're planning on moving next year.
    2. one year after the present time: the new law will take effect next year.
    adjective
    1. relating to or occurring during the calendar year following the current one: next year's summer.
    2. relating to or occurring one year after the present time: next year's meeting.

    INFLECTED FORMS
    every year [frequentative]Adam Frost{"video":"dominance: right;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udde1\ud8c0\udc41.mov"} }k 33g y!9frost2024/03/13 22:08:492026/04/23 23:46:20AS20340S2fe00S20348S2fe00S21400S20500S26500S10e40M511x542S20340496x511S20348490x527S26500496x492S10e40496x459combined form a construction of in a year and the number two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udde1\ud8c1\udd81.mov"} tm 33g g!9frost2024/03/13 22:12:372026/04/23 23:46:40AS20340S2fe00S20348S2fe00S21400S20500S26500S14440M514x542S20340493x511S20348487x527S26500493x492S14440492x458combined form a construction of in a year and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udde1\ud8c6\uddc1.mov"}ul 33g i!9frost2024/03/13 22:10:272026/04/23 23:46:30AS20340S2fe00S20348S2fe00S21400S20500S26500S11e40M515x542S20340492x511S20348486x527S26500492x492S11e40492x459combined form a construction of in a year and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udde1\ud8c2\udf81.mov"} tn 33g g!9frost2024/03/13 22:14:202026/04/23 23:46:48AS20340S2fe00S20348S2fe00S21400S20500S26500S14c40M513x542S20340494x511S20348488x527S26500494x492S14c40489x458combined form a construction of in a year and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udde1\ud8c7\udcc1.mov"} o33gS!frost2024/03/13 22:16:142026/06/07 23:48:59AS20340S2fe00S20348S2fe00S21400S20500S26a00S10040M514x542S20340493x511S20348487x527S26a00487x493S10040493x459M511x542S20340496x511S20348490x527S26500496x492S10040496x459adverb [frequentative] once a year or every year: rent was paid yearly | sales are increasing by about 17% annually.
    adjective [frequentative] done, produced, or occurring once a year or every year: yearly visits to Africa.
    • calculated over or covering a period of a year: annual income.
    Adam Frost{"video":"dominance: right;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udfc1\ud8c0\udc41.mov"} Cq 33) a!Afrost2024/03/13 22:32:582025/02/20 19:31:42AS20310S30004S10006S20e00S22f04M518x545S2ff00482x483S22f04488x531S20310493x512noun a soft frozen food made with sweetened and flavored milk fat.
    • a portion of ice cream, especially as served or sold in a cone-shaped wafer.
    Adam Frost{"video":"dominance: right;\\n\ud8d8\udd31\ud8f0\udc05\u00d8\ud8d9\udd41\ud8dc\udda5.mov"}9p 33) {!mfrost2024/03/13 22:28:532026/06/08 16:51:00AS19200S33d00S10006S20e00S2e004M544x529S33b00482x483S19200506x510S2e004523x491noun the liquid obtained from or present in fruit or vegetables: add the juice of a lemon.
    adjective [in isolation] jealous.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\udec1\ud8f5\udee1\u00d8\ud8d9\udd41\ud8ed\udc05.mov"} %%߅Wr 335 !frost2024/03/13 22:38:202026/07/16 23:03:03AS19241S2fe00S19249S2fe00S21400S20600M527x518S19249480x497S19241474x482S20600505x488noun
    1. [often in names] a society or organization having a particular object or common factor, especially a scientific, educational, or social one: a research institute | the Institute for Advanced Studies.
    2. a school where students reside during the school term, especially a school for deaf students: before the rise of mainstream education, many deaf children attended residential schools.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\udf02\ud8fc\udc61\ud8cd\udf0a\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} ((Ts 33g K!frost2024/03/13 22:43:442025/02/20 19:42:20AS14e11S2fe00S15a1bS2fe00S21407S20500S22a05S20500M523x521S15a1b478x498S14e11482x479S22a05510x479S20500502x508noun a berry, typically green (classified as white), purple, red, or black, growing in clusters on a grapevine, eaten as fruit, and used in making wine.Adam Frost{"video":"dominance: right;\\n\ud8c7\udd52\ud8fc\udc61\ud8c8\udddc\ud8fc\udc61\ud8d9\udf88\ud8d8\udde1\ud8db\udfc6\ud8d8\udde1.mov"} &t 33C W!Afrost2024/03/13 22:46:502026/02/05 19:45:49AS1c500S30000S10006S20e00S26506M566x518S2ff00482x483S1c500505x476S20e00537x487S26506551x486verb to fail to recall or remember as if the mind were empty: he had forgotten his lines | [with clause] : she had completely forgotten how tired and hungry she was.
    • to inadvertently neglect to do, bring, or mention something: I forgot my raincoat | [with infinitive] : she forgot to lock her door | [no object] : I'm sorry, I just forgot.
    • to put out of one's mind; cease to think of or consider: forget all this romantic stuff | [no object] : for years she had struggled to forget about him.
    Adam Frost{"video":"dominance: right;\\n\ud8d2\udde1\ud8f0\udc01\u00d8\ud8d9\udd41\ud8e1\udde7.mov"} mm>v 335kc!efrost2024/03/13 22:54:302026/05/23 00:11:44AS19a20S2fe00S19a28S2fe00S21406S20600M529x514S19a20501x494S19a28471x494S20600489x486M544x521S19a20487x501S19a28457x501S2c503512x480noun
    1. the relative extent of something; a thing's overall dimensions or magnitude; howeu 33) !Afrost2024/03/13 22:50:062026/07/26 18:49:19AS15a11S30007S10006S20500S22e04M533x531S2ff00482x483S15a11510x487S22e04515x513verb
      1. to have expected or believed that something would happen or be true: I knew they'd come.
      2. to recognize or confirm something as already known or expected: "Did you see what he was wearing?" "I know!".
        • used to bring relevant information to someone's attention: you know her friend's married, right?
      Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8f0\udc08\u00d8\ud8d8\udde1\ud8dc\udd45.mov"}>we ate an early lunch.
      • (of a plant or crop) flowering or ripening before other varieties: early potatoes.
    2. happening, belonging to, or done near the beginning of a particular time or period: an early goal secured victory.
      • done or occurring near the beginning of the day: we agreed to meet at 6 a.m. to get an early start.
      • denoting or belonging to the beginning or opening stages of a historical period, cultural movement, or sphere of activity: early impressionism.
    adverb
    1. before the usual or expected time: I was planning to finish work early today.
    2. near the beginning of a particular time or period: we lost a couple of games early in the season.
      • near the beginning of the day: I wrote this piece early one morning.
    Adam Frost{"video":"dominance: right;\\n\ud8d2\ude32\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde1.mov"} 5x 33[ 1!}frost2024/03/13 23:04:482026/07/16 23:48:41AS11541S2fe00S11549S2fe00S21400S21100S27103M531x532S11541488x498S11549469x505S21100499x485S27103504x468adverb in a short time: the new database will shortly be available for consultation | the flight was hijacked shortly after takeoff.Adam Frost{"video":"dominance: right;\\n\ud8c2\udc22\ud8fc\udc61\ud8c2\udc2a\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e2\ude64.mov"}Lw 33) M!Afrost2024/03/13 22:58:022026/07/16 23:47:05AS1ce02S30004S10006S20600S34400M533x535S34400482x483S1ce02477x513S20600511x515adverb in the near future: everyone will soon know the truth | he'll be home soon.Adam Frost{"video":"dominance: right;\\n\ud8d3\udd43\ud8f0\udc05\u00d8\ud8d8\ude41\ud8f6\udd81.mov"} wy 33s m!-frost2024/03/13 23:10:512026/06/04 19:16:08AS10051S2fe00S10059S2fe00S21406S20500S23f02S23f1aS20500M531x521S10051501x479S10059470x479S23f02501x500S23f1a472x500noun a plane figure with three straight sides and three angles: an equilateral triangle. adjective shaped like a triangle; having three sides and three corners: dainty triangular sandwiches.Adam Frost{"video":"dominance: equal;\\n\ud8c0\udc52\ud8fc\udc61\ud8c0\udc5a\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8dd\udfa3\ud8dd\udfbb\ud8d8\udde1.mov"} z{ 33A !}frost2024/03/15 23:16:182025/02/20 19:17:40AS14c51S2fe00S15a39S2fe00S21400S21100S2e108M521x530S15a39498x507S14c51480x502S2e108493x470noun a food made from the pressed curds of milk: grated cheese | [as modifier] : a cheese sandwich | a slice of cheese.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd2\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8ed\udc69.mov"}z 33)k/!mfrost2024/03/13 23:17:422026/07/19 20:14:38AS10e20S30005S10006S21100S2e000M524x549S2ff00482x483S10e20509x508S2e000486x520M515x534S10e20500x466S14a20500x500S1f000486x519noun a vegetable.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c1\udd61\ud8f0\udc06\u00d8\ud8d9\ude61\ud8ed\udc01.mov"} J} 33 a!)frost2024/03/15 23:31:402025/02/20 18:11:25AS14c10S30007S10006S20600M544x518S2ff00482x483S14c10507x466S20600522x499noun a leafy vegetable with a variety of textures and flavors, typically having large, edible leaves that are often used raw in salads or cooked in various dishes.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc91\ud8f0\udc08\u00d8\ud8d8\ude41.mov"}2| 335 u!Yfrost2024/03/15 23:29:162025/02/20 18:21:39AS20320S30005S10006S26502S20500S36200M540x524S36200482x483S20320506x509S26502525x509noun a tapering orange-colored root eaten as a vegetable: roast lamb with peas and carrots | [mass noun] : grated carrot | [as modifier] : carrot cake | carrot juice.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd41\ud8f0\udc06\u00d8\ud8e1\udde3\ud8d8\udde1\ud8f9\udcc1.mov"}offlrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|BDEFHIJKLMNOPQRSTUVXYZ\]^`bcefhijkmnoqrstvxy{}~   ˆ ÈĈňƈLjȈɈʈˈ̈ΈψЈ ҈!ӈ#Ԉ$Ո%ֈ&׈'؈(و*ڈ,ۈ.ވ0߈135679;=>?@ACDEGHJKLMOPRSUWY[^ 4~ 33g !frost2024/03/15 23:38:042026/08/30 23:28:56AS15a41S2fe00S15a49S2fe00S21400S20e00S2a204S2a21cM525x533S15a49479x478S15a41497x467S2a204502x504S2a21c475x505Adam Frost{"video":"dominance: right;\\n\ud8c8\ude02\ud8fc\udc61\ud8c8\ude0a\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e7\udcc5\ud8e7\udcdd.mov"}onship: the larger the pool of available singles the greater your chance of finding someone special | do you think he's available?. noun the quality of being able to be used or obtained: turkey producers had been losing sales because of the all-year-round availability of beef | the cost and availability of housing for teachers still remains a problem. Adam Frost{"video":"dominance: right;\\n\ud8d2\ude32\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc7.mov"} ##Q33A#k!}frost2024/03/15 23:55:432026/08/15 18:50:47AS19a20S2fe00S19a28S2fe00S21406S20500S2c503M544x521S19a20487x501S19a28457x501S2c503512x480S38b00470x493 M529x514S19a20501x494S19a28471x494S20600489x486 S38b04470x493verb
    1. to ascertain the size, amount, or degree of (something) by using an instrument or device marked in standard units or by comparing it with an object of known size: the amount of water collected is measured in pints | they will measure up the room and install the cabinets.
      • to be of (a specified size or degree): the fabric measures 45 inches wide.
      • to ascertain the size and proportions of (someone) in order to make or provide clothes for them: tt 33g 3!frost2024/03/16 02:11:292026/08/05 16:18:48AS14c50S2fe00S14c58S2fe00S21400S2d50dS2d515S20500M521x535S14c58480x483S14c50492x466S2d50d500x508S2d515481x518verb
        1. to bring together into a single whole: [no object] : the utility companies are cutting costs and merging with other companies.
        2. to become part of a larger whole: traffic was merging due to construction | the goal is to have the child mainstreamed into a regular classroom.
        noun the dominant or generally accepted larger whole: companies that are bringing computers to the mainstream of American life | [as modifier] : the state government has supported greater integration of students with disabilities into mainstream schools.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd1\ud8fc\udc61\ud8c7\udcd9\ud8fc\udc61\ud8d9\udf81\ud8eb\udfee\ud8eb\udff6\ud8d8\udde1.mov"} ]] 33[ !}frost2024/03/16 02:14:452025/02/20 18:51:59AS1bb51S2fe00S15a0aS2fe00S21400S20800S26a20M520x524S15a0a489x512S1bb51481x492S20800510x502S26a20489x476noun the flesh of an animal (especially a mammal) as food: pieces of meat | place meat and poultry in the refrigerator immediately | [as modifier] : meat sandwiches | assorted meats.
        • high-quality beef taken from the hindquarters of the animal, typically cut into thick slices that are cooked by broiling or frying: he liked his steak rare.
        Adam Frost{"video":"dominance: right;\\n\ud8d1\ude72\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf81\ud8d8\udf01\ud8e1\udfe1.mov"} 88r 33Qq!Kfrost2024/03/16 02:26:542026/05/31 01:31:04AS1f540S2fe00S10006S26a00M514x521S1f540493x497S26a00487x480M508x521S1f540493x497S26500493x479reflexive pronoun [in isolation] yourself.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d7\udc21\ud8fc\udc61\u00d8\ud8e1\udfc1.mov"}K 333 =!Efrost2024/03/16 02:22:012026/05/03 21:43:41AS20350S2fe00S20358S2fe00S21406S20500S21800S21800S26506S26512M536x513S20350502x498S20358484x498S21800501x487S21800482x487S26506521x498S26512465x498noun a seasoned, ground meat product, typically encased in a skin, often cooked or smoked: smoked German sausage.
        • a hot dog.
        Adam Frost{"video":"dominance: equal;\\n\ud8d8\udd71\ud8fc\udc61\ud8d8\udd79\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8da\udd01\ud8da\udd01\ud8e1\udde7\ud8e1\uddf3.mov"} q\T33k!Kfrost2024/03/16 02:29:452026/05/23 03:05:37AS1f540S38510S10006S20600M511x519S1f540492x482S20600489x508M508x519S1f540493x482S20500496x508 S38a00464x490 S38b00470x493 M511x519S1f548492x482S20600489x508 S38b04470x493reflexive pronoun [in isolation] myself.

        PHONOLOGICAL VARIANTS
        myself with knuckles touching chestAdam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d7\udc21\ud8fc\uddf1\u00d8\ud8d8\ude41.mov"}  33Q#!Kfrost2024/03/16 02:28:142026/05/31 01:31:19AS1f540S2fe00S10006S26a07M518x517S1f540483x493S26a07497x483M516x515S1f540485x491S26507503x485reflexive pronoun [in isolation] himself/herself/itself/themselves.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d7\udc21\ud8fc\udc61\u00d8\ud8e1\udfc8.mov"} bQ 33C =!Afrost2024/03/16 02:39:332025/02/20 23:39:13AS1f540S33d00S10006S20e00S26a00M543x534S34700482x483S1f540492x505S20e00523x522S26a00516x506noun a fruit consisting of a hard or tough shell around an edible kernel, including those from trees and plants that grow underground: he was cracking nuts with his teeth | a bag of dry-roasted peanuts.Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8f5\udee1\u00d8\ud8d9\udd41\ud8e1\udfc1.mov"} 33QA!Kfrost2024/03/16 02:31:212026/05/23 03:08:15AS1f548S38510S10006S20600M511x519S1f548492x482S20600489x508M511x519S1f540492x482S20600489x508pronoun [in isolation] a phonological variant (knuckles touching chest) of myself.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d7\udc29\ud8fc\uddf1\u00d8\ud8d8\ude41.mov"} {H{I 33)!c frost2024/03/16 03:03:342026/05/23 17:46:00AS1f437S2fe00S10006S22113S34400M529x567S34400482x483S1f437507x537S22113510x525M529x567S34400482x483S1f437507x537S1f43f470x537S22113510x525S22115469x525interrogative verb a phonological variant (right handed) of do do.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d6\udfb8\ud8fc\udc61\u00d8\ud8db\udc74\ud8f6\udd81.mov"}4 33) !Afrost2024/03/16 02:54:082025/02/20 18:19:29AS10612S31410S10006S21100S2c400M546x518S2ff00482x483S10612513x490S2c400506x463noun an edible bulb with a pungent taste and smell, composed of several concentric layers, used in cooking: cook the onion in the oil until lightly colored | [as modifier] : onion rings.Adam Frost{"video":"dominance: right;\\n\ud8c0\ude53\ud8f1\udf91\u00d8\ud8d9\ude61\ud8ea\udd81.mov"}  33[ k!} frost2024/03/16 03:11:512026/07/24 20:01:34AS19201S2fe00S19209S2fe00S38006S2950aS29512M559x513S19201505x494S19209470x494S2950a528x487S29512442x487noun
        1. a long, thin strand of strand of dough, usually eaten with a sauce or in a soup: she cooked spaghetti for dinner | I ordered noodles.
        2. a dish originally from Italy consisting of dough made from durum wheat, extruded or stamped into various shapes and cooked in boiling water, and typically served with a sauce: fresh pasta with pesto, feta cheese, and pine nuts | [as modifier] : serve these pasta dishes with a green salad and crusty bread.
        Adam Frost{"video":"dominance: equal;\\n\ud8cd\udec2\ud8fc\udc61\ud8cd\udeca\ud8fc\udc61\ud8fc\udc07\ud8e5\udfeb\ud8e5\udff3.mov"} small in quantity and easy to digest: a light supper.
        • (of a foodstuff) low in fat, cholesterol, sugar, or other rich ingredients: stick to a light diet.
        • (of drink) not too sweet or rich in flavor or strongly alcoholic: a glass of light Hungarian wine.
        • (of food, especially pastry or sponge cake) fluffy or well aerated during cooking: it was delicious, the pastry light and flaky.
      • gentle or delicate: she planted a light kiss on his cheek | my breathing was steady and light.
      • (of entertainment) requiring little mental effort; not profound or serious: pop is thought of as light entertainment | some light reading.
        • not serious or solemn: his tone was light.
        • free from worry or unhappiness; cheerful: I left the island with a light heart.
    Adam Frost{"video":"dominance: equal;\\n\ud8d2\ude32\ud8fc\udc61\ud8d2\ude3a\ud8fc\udc61\ud8fc\udc07\ud8e7\udcc9\ud8e7\udcd1.mov"} ]5 33[ 1!} frost2024/03/16 03:18:012026/07/19 19:56:03AS1c551S2fe00S2035aS2fe00S21400S20e00S26a06M532x519S2035a469x504S1c551474x482S20e00502x495S26a06518x488adjective able to be used or obtained; at someone's disposal: refreshments will be available all afternoon | a slush fund available to universities.
  • SIGN VARIATIONS
    minus (verb) with index hand
    • noun
    1. the action of deducting or subtracting something: the dividend will be paid without deduction of tax.
      • an amount that is or may be deducted from something, especially from taxable income or tax to be paid: tax deductions.
    2. the process or skill of taking one number or amount away from another: subtraction of this figure from the total.
    Adam Frost{"video":"dominance: right;\\n\ud8c7\udd61\ud8fc\udc61\ud8c8\ude0a\ud8fc\udc61\ud8d9\udf96\ud8d9\udd41\ud8db\udfc5\ud8d8\udd71.mov"}S14720501x448S1f720495x474S11920494x493S14020486x523noun
    1. a financial establishment that invests money deposited by customers, pays it out when required, makes loans at interest, and exchanges currency: I paid the money straight into my bank.
    2. a stock of something available for use when required: a blood bank | building a bank of test items is the responsibility of teachers.
    3. the land alongside or sloping down to a river or lake: willows lined the bank.
    4. a slope, mass, or mound of a particular substance: a bank of snow | a bank of clouds.
    5. the cushion of a pool table: [as modifier] : a bank shot.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udec1\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8c2\udd81\ud8c6\udc21.mov"} rrJB0 33) 9!A0frost2024/03/17 21:57:242025/02/20 23:19:18AS18517S30005S10006S20e00S22113M539x539S2ff00482x483S18517512x512S22113520x503noun a round stone fruit with juicy yellow flesh and downy pinkish-yellow skin.Adam Frost{"video":"dominance: right;\\n\ud8cc\uddf8\ud8f0\udc06\u00d8\ud8d9\udd41\ud8db\udc74.mov"}D/ 33[ O!}/frost2024/03/17 21:54:492026/06/01 02:15:55AS11532S2fe00S15a37S2fe00S21400S20e00S2ea00M519x533S15a37482x468S11532489x480S20e00491x493S2ea00491x508noun
    1. a liquid dish, typically made by boiling meat, fish, or vegetables, etc., in stock or water: a bowl of tomato soup.
    2. an implement consisting of a small, shallow oval or round bowl on a long handle, used for eating, stirring, and serving food.
    Adam Frost{"video":"dominance: right;\\n\ud8c2\udc13\ud8fc\udc61\ud8c8\uddf8\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8ed\udfc1.mov"} t1 33g !1frost2024/03/17 22:02:172026/07/21 18:32:24AS15402S38517S1540aS38521S21100S21100S2e500S2e51cM525x526S21100482x512S15402500x475S1540a476x494S21100506x493adjective having a swirl pattern on the torso: she wore a swirl-patterned blouse.
    noun a swirl pattern on the torso: the dress has a beautiful swirl pattern.Adam Frost{"video":"dominance: right;\\n\ud8c7\udf83\ud8fc\uddf8\ud8c7\udf8b\ud8fc\ude02\ud8d9\ude61\ud8d9\ude61\ud8ed\udde1\ud8ed\uddfd.mov"} %%r3 333 !E3frost2024/03/17 22:22:012026/05/08 00:57:48AS19c51S2fe00S19c59S2fe00S21406S20500S26506S26512S19a58S19a50M580x514S19c51501x486S19c59469x486S19a50552x492S26506534x496S26512451x496S19a58420x492Adam Frost{"video":"dominance: equal;\\n\ud8ce\uded2\ud8fc\udc61\ud8ce\udeda\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\udde7\ud8e1\uddf3\ud8ce\ude19\ud8ce\ude11.mov"}`2 33 u!]2frost2024/03/17 22:08:202026/07/22 01:49:28AS16d10S38517S16d18S38521S20500S20500S22a04S22a14S20500S20500S2fd04M521x540S2fd04494x532S16d10504x461S16d18479x476S20500508x484S20500482x499S22a04506x498S22a14481x512S20500508x515S20500482x529adjective having a pattern of large spots on the torso: a spotted shirt.
    noun a pattern of large spots on the torso: polka dots are back in style.Adam Frost{"video":"dominance: right;\\n\ud8ca\udcf1\ud8fc\uddf8\ud8ca\udcf9\ud8fc\ude02\ud8d8\udde1\ud8d8\udde1\ud8db\udfc5\ud8db\udfd5\ud8d8\udde1\ud8d8\udde1\ud8ef\udee5.mov"}S18d20490x459S1f720490x488S20320495x507S20320495x526proper noun a state in the northeastern US, on the coast of the Atlantic Ocean; capital, Boston.
    adjective relating to or characteristic of the US state of Massachusetts or its inhabitants: the Massachusetts lobster industry.
    noun
    1. a coherent, typically large body of matter with no definite shape: a mass of curly hair | from here the trees were a dark mass.
    2. Physics the quantity of matter which a body contains, as measured by its acceleration under a given force or by the force exerted on it by a gravitational field: stellar objects of intermediate mass.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated (proper noun, adjective);\\nfingerspelled: full (noun);\\n\ud8cd\udd01\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8d8\udd41\ud8d8\udd41.mov"} ZLZ n5 33M i!E5frost2024/03/17 22:29:482025/02/20 18:18:17AS10020S33d00S10059S2fe00S20500S22a04S10051S21400S20e00S22a04M526x598S33b00482x483S10020499x506S22a04500x539S10059472x556S10051496x556S20e00493x568S22a04492x583noun a glossy red, or occasionally yellow, pulpy edible fruit that is eaten as a vegetable or in salad.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8f5\udee1\ud8c0\udc5a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc5\ud8c0\udc52\ud8d9\udf81\ud8d9\udd41\ud8db\udfc5.mov"}(4 33Q!4frost2024/03/17 22:24:592026/08/27 18:48:23AS14e20S2fe00S15a49S2fe00S21415S20e00S22a04S20350M516x545S15a49484x455S14e20491x464S20e00498x497S22a04498x512S20350498x530M519x517S10012489x502S15a28482x483
    verb [with object]
    1. to take (something) away or off from the position occupied: Customs officials removed documents from the premises.
      • to take away (somet xo6 33[ %!}6frost2024/03/17 22:35:402026/07/27 18:43:47AS15a41S2fe00S14c08S2fe00S21400S21000S26501M524x532S14c08485x501S15a41501x500S21000486x483S26501476x468preposition moving in one side and out of the other side of (an intervening barrier, opening, or enclosed space): a ten-minute drive through the tunnel brought us to the city of Whittier.
        • so as to make a hole or opening in (a physical object): the truck smashed through a brick wall.
        • moving around or from one side to the other within (a crowd or group): they threaded their way through the guests.
        • so as to be perceived from the other side of (an intervening obstacle): the sun was streaming in through the window.
        Adam Frost{"video":"dominance: right;\\n\ud8c8\ude02\ud8fc\udc61\ud8c7\udc89\ud8fc\udc61\ud8d9\udf81\ud8d9\ude01\ud8e1\udde2.mov"} n7 33 !]7frost2024/03/17 22:38:212026/07/22 01:57:18AS1ce11S38517S1ce19S38521S20500S20500S22a04S22a14S20500S20500S2fd04M521x543S2fd04495x535S1ce11498x457S1ce19480x472S20500509x487S20500483x502S22a04507x501S22a14482x515S20500509x518S20500483x532adjective having a pattern of spots on the torso: a spotted tank-top.
        noun a pattern of spots on the torso: you can't even see the spots on your coat from here.Adam Frost{"video":"dominance: right;\\n\ud8d3\udd52\ud8fc\uddf8\ud8d3\udd5a\ud8fc\ude02\ud8d8\udde1\ud8d8\udde1\ud8db\udfc5\ud8db\udfd5\ud8d8\udde1\ud8d8\udde1\ud8ef\udee5.mov"} +49 33g !9frost2024/03/17 22:56:092026/05/08 00:59:00AS14c41S2fe00S18548S2fe00S21404S22a00S18540S20500M522x535S14c41496x508S22a00503x489S18540496x472S18548478x466Adam Frost{"video":"dominance: right;\\n\ud8c7\udcc2\ud8fc\udc61\ud8cc\ude29\ud8fc\udc61\ud8d9\udf85\ud8db\udfc1\ud8cc\ude21\ud8d8\udde1.mov"}Q8 33i !Y8frost2024/03/17 22:45:382026/07/27 17:51:31AS15a10S38404S10006S20e00S26500S1f540M534x525S2ff00482x483S15a10504x498S20e00521x513S26500520x495S1f540519x468contraction why not: why don't you have dinner with us?.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd1\ud8fc\udd85\u00d8\ud8d9\udd41\ud8e1\udde1\ud8d7\udc21.mov"} NNr; 333 !E;frost2024/03/17 23:05:382026/05/08 00:59:33AS14c20S2fe00S14c48S2fe00S21414S26500S26514S18520S18548S20500M530x564S14c20507x533S14c48470x437S26500511x514S26514475x471S18520497x496S18548478x490Adam Frost{"video":"dominance: right;\\n\ud8c7\udca1\ud8fc\udc61\ud8c7\udcc9\ud8fc\udc61\ud8d9\udf95\ud8e1\udde1\ud8e1\uddf5\ud8cc\ude01\ud8cc\ude29\ud8d8\udde1.mov"}8: 33g!M!G:frost2024/03/17 22:57:202026/05/03 23:55:24AS15740S2fe00S18548S2fe00S21404S20500S22a00S18540M522x535S15740500x509S22a00503x489S18540496x472S18548478x466M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M522x535S14c41496x508S22a00503x489S18540496x472S18548478x466 S38800464x496You might be looking for add/addition.Adam Frost{"video":"dominance: right;"} Q= 33[Q!=frost2024/03/17 23:15:512026/05/23 16:34:25AS1f437S2fe00S1f43fS2fe00S38006S22113S22115M530x521S1f437508x491S1f43f471x491S22113511x479S22115470x479M511x521S1f437489x491S22113492x479pronoun, interrogative determiner [intensive] what.Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8d6\udfb8\ud8fc\udc61\ud8d6\udfc0\ud8fc\udc61\ud8fc\udc07\ud8db\udc74\ud8db\udc76.mov"}r< 333 !E33U!)>frost2024/03/17 23:17:372026/06/05 17:26:51AS1f437S2fe00S10006S22113M511x521S1f437489x491S22113492x479M535x535S14c31509x465S14c39465x465S27102520x495S27116465x495 S38a00464x490 M530x521S1f437508x491S1f43f471x491S22113511x479S22115470x479pronoun, interrogative determiner what.

        INFLECTED FORMS
        what [intensive]Adam Frost{"video":"dominance: right;\\n\ud8d6\udfb8\ud8fc\udc61\u00d8\ud8db\udc74.mov"} ,,P? 33O !e?frost2024/03/18 01:12:162026/07/22 02:11:35AS1dc03S38517S1dc0bS38511S20500S20500M539x518S1dc03509x482S1dc0b462x482S20500525x507S20500467x507adjective having a graphic or text centered on the torso: a graphic hoodie.
        noun a graphic or text centered on the torso: the graphic on his shirt is fading.Adam Frost{"video":"dominance: equal;\\n\ud8d4\ude84\ud8fc\uddf8\ud8d4\ude8c\ud8fc\uddf2\ud8d8\udde1\ud8d8\udde1.mov"} 8@3359u!7@frost2024/03/18 01:20:582026/07/23 19:39:55AS14c20S30006S14c28S30002S20320S20328S27106S27116M583x522S2ff00482x483S14c20522x484S14c28412x484S20320568x494S20328460x494S27106548x482S27116441x482M584x531S2ff00482x483S10021517x500S20320569x503S20328441x503S27106550x491S27116461x491adjective a phonological variant (5-hands) of loud.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udca1\ud8f0\udc07\ud8c7\udca9\ud8f0\udc03\ud8d8\udd41\ud8d8\udd49\ud8e2\ude67\ud8e2\ude77.mov"} MM/A33 M!Afrost2024/03/18 01:22:152026/07/23 19:38:57AS10021S30006S20328S30002S20500S20320S27106S27116M584x531S2ff00482x483S10021517x500S20320569x503S20328441x503S27106550x491S27116461x491S38b00470x493 M583x522S2ff00482x483S14c20522x484S14c28412x484S20320568x494S20328460x494S27106548x482S27116441x482 S38b04470x493adjective producing or capable of producing much noise; easily audible: they were kept awake by loud music | she had a loud voice.
        • strong or emphatic in expression: there were loud protests from the lumber barons.
        • having bright colors or bold patterns that stand out: a man in a loud checked suit.

        PHONOLOGICAL VARIANTS
        loud with 5-handsAdam Frost{"video":"dominance: right;\\n\ud8c0\udc22\ud8f0\udc07\ud8d8\udd49\ud8f0\udc03\ud8d8\udde1\ud8d8\udd41\ud8e2\ude67\ud8e2\ude77.mov"}S18d20487x457S19220492x486S20320492x509S20320492x528proper noun a state of the southern US, on the Gulf of Mexico, bounded to the west by the lower Mississippi River; capital, Jackson.
        adjective relating to or characteristic of the US state of Mississippi or its inhabitants: Mississippi blues | [person implied] : Mississippians value their musical traditions.
        noun
        1. (Miss) a title prefixed to the name of an unmarried woman or girl, or to that of a married woman retaining her maiden name for professional purposes: Miss Hazel Armstrong.
          • used in the title of the winner in a beauty contest: Miss World.
        Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated (proper noun, adjective);\\nfingerspelled: full (noun);\\n\ud8cd\udd01\ud8fc\udc61\u00d8\ud8cd\udee1\ud8d8\udd41\ud8d8\udd41.mov"} $C 33u S!Cfrost2024/03/22 18:39:202026/05/06 01:51:56AS19220S2fe00S10006S10120S1f720S11502S17620M518x556S19220497x445S10120497x468S1f720492x502S11502482x521S17620497x540proper noun a state in the northwestern US, bordering on the Canadian province of British Columbia to the north and containing part of the Rocky Mountains; capital, Boise.
        adjective relating to or characteristic of the US state of Idaho or its inhabitants: the Idahoan woods | [person implied] : a daunting task for the Idahoan.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cd\udee1\ud8fc\udc61\u00d8\ud8c0\udc81\ud8d7\udcc1\ud8c1\udfe3\ud8cb\udc61.mov"}aB 33O !Bfrost2024/03/22 18:37:382026/05/04 02:56:02AS14720S2fe00S10006S1f720S11920S14020M515x553 GD 33) !}Dfrost2024/03/22 18:40:482026/05/06 01:53:44AS19220S2fe00S10006S11920S10120M514x542S19220493x459S11920487x482S10120493x512proper noun a state in the eastern central US; capital, Indianapolis.
        adjective relating to or characteristic of the US state of Indiana or its inhabitants: some Indianan families are eligible to use school vouchers. | [person implied] : an Indianan who spent his adolescence writing songs.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8cd\udee1\ud8fc\udc61\u00d8\ud8c2\udd81\ud8c0\udc81.mov"} E 33O }!Efrost2024/03/22 18:42:292026/05/06 01:54:20AS19220S2fe00S10006S17620S18720S1f720M513x545S19220492x455S17620492x478S18720491x498S1f720487x530proper noun a state in the northern central US; capital, Des Moines.
        adjective relating to or characteristic of the US state of Iowa or its inhabitants: the sleepy Iowan town | [person implied] : the captain was an Iowan.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cd\udee1\ud8fc\udc61\u00d8\ud8cb\udc61\ud8cc\udec1\ud8d7\udcc1.mov"} XG 33O }!Gfrost2024/03/22 18:46:072026/05/06 02:20:36AS18d20S2fe00S10006S1f720S20320S20320M510x541|F 33) q!}Ffrost2024/03/22 18:44:242026/05/06 01:54:39AS14020S2fe00S10006S1f720S11920M515x540S14020486x461S1f720495x495S11920494x514proper noun a state in the central US; capital, Topeka.
        adjective relating to or characteristic of the US state of Kansas or its inhabitants: he was born to a Kansan mother | [person implied] : he's a fellow Kansan.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c6\udc21\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8c2\udd81.mov"}5S26a00488x477noun
        1. a powered flying vehicle with fixed wings and a weight greater than that of the air it displaces: the patient had recently arrived via airplane from South Africa | several airplanes will begin using a shorter runway as a result of construction activity | [as modifier] : an airplane crash.
        2. a person who operates the flying controls of an aircraft: a strike by local airline pilots | [as modifier] : the crash had been due to pilot error.
        3. a complex of runways and buildings for the takeoff, landing, and maintenance of civil aircraft, with facilities for passengers.
        4. an organization providing a regular public service of air transportation on one or more routes: the service enables travelers to search the flight schedules of multiple airlines | an international airline | [as modifier] : an airline pilot.
        Adam Frost{"video":"dominance: right;\\n\ud8ce\uded1\ud8fc\udc61\u00d8\ud8e1\udfc1.mov"} rH 33O !Hfrost2024/03/22 18:47:532026/05/06 01:56:10AS18d20S2fe00S10006S19220S16d20S11502M518x546S18d20492x455S19220497x484S16d20496x507S11502482x531proper noun a state in the northern US, bordered on the west, north, and east by Lakes Michigan, Superior, Huron, and Erie; capital, Lansing.
        adjective relating to or characteristic of the US state of Michigan or its inhabitants: Michigan lakes | [person implied] : greetings from a fellow Michigander.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8cd\udd01\ud8fc\udc61\u00d8\ud8cd\udee1\ud8ca\udd01\ud8c1\udfe3.mov"} --eJ 33O !Jfrost2024/03/22 18:50:072026/05/06 16:14:10AS18d20S2fe00S10006S19220S20320S20320M513x543_I 33O y!Ifrost2024/03/22 18:49:052026/05/06 01:51:19AS18d20S2fe00S10006S19220S11920S11920M514x554S18d20488x446S19220493x475S11920487x498S11920487x528proper noun a state in the northern central US, on the Canadian border; capital, St. Paul.
        adjective relating to or characteristic of the US state of Minnesota or its inhabitants: my Minnesotan adventure was an overall success | [person implied] : the waiter's wife was a Minnesotan.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8cd\udd01\ud8fc\udc61\u00d8\ud8cd\udee1\ud8c2\udd81\ud8c2\udd81.mov"}ion id=verb1139> verb [no object, usually with adverbial of direction]
        1. to operate and control the direction and speed of a motor vehicle: he got into his car and drove off | they drove back into town.
          • (of a motor vehicle) to travel under the control of a driver: a car drives up, and a man gets out | a stream of black cars drove by | I watched her car drive away.
          • [with object] to operate and control the direction and speed of (a motor vehicle): I drove the truck back to New York | there are endless shots of Julie driving her car along winding roads.
          • [with object] to own or use (a specified type of motor vehicle): Sue drives an old Chevy.
          • be licensed or competent to drive a motor vehicle: I take it you can drive?.
    Adam Frost{"video":"dominance: equal;\\n\ud8d8\udd22\ud8fc\udc61\ud8d8\udd2a\ud8fc\udc61\ud8fc\udc07\ud8e1\udde1\ud8e1\uddf1.mov"} K 33) -!}Kfrost2024/03/22 18:51:542026/05/06 02:20:57AS11920S2fe00S10006S14a20S14720M511x536S11920490x465S14a20496x495S14720497x514proper noun a state in the central US to the west of the Missouri River; capital, Lincoln.
    adjective relating to or characteristic of the US state of Nebraska or its inhabitants: a Nebraskan farmer | [person implied] : I am a lifelong Nebraskan.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c2\udd81\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8c6\udec1.mov"} ~L 33) u!}Lfrost2024/03/22 18:53:082026/05/06 02:22:09AS11920S2fe00S10006S14a20S10e20M511x540S11920489x461S14a20495x491S10e20496x510proper noun a state in the western US; capital, Carson City.
    adjective relating to or characteristic of the US state of Nevada or its inhabitants: the Nevadan desert | [person implied] : a typically laid-back Nevadan.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c2\udd81\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8c1\udd61.mov"} XM 33O k!Mfrost2024/03/22 18:54:242026/05/06 02:21:11AS17620S2fe00S10006S14020S1dc20S1f720M515x552S17620499x449S14020485x469S1dc20490x503S1f720494x537proper noun a state in the southern central US, north of Texas; capital, Oklahoma City.
    adjective relating to or characteristic of the US state of Oklahoma or its inhabitants: his Oklahoman drawl | [person implied] : the handsome Oklahoman remained active in both TV and film.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8cb\udc61\ud8fc\udc61\u00d8\ud8c6\udc21\ud8d4\udea1\ud8d7\udcc1.mov"} O 33u C!Ofrost2024/03/22 18:57:342026/05/04 03:02:34AS1fb20S2fe00S10006S11a20S11520S16d20S14020M515x573S1fb20499x428S11a20499x451S11520499x485S16d20498x519S14020485x543noun a large, heavy motor vehicle used for transporting goods, materials, or troops.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d7\ude41\ud8fc\udc61\u00d8\ud8c2\udde1\ud8c2\udc01\ud8ca\udd01\ud8c6\udc21.mov"}EN 33O E!Nfrost2024/03/22 18:56:132026/05/06 02:21:22AS1fb20S2fe00S10006S14a20S11920S11920M511x549S1fb20496x451S14a20496x474S11920490x493S11920490x523proper noun a state in the central southeastern US; capital, Nashville.
    adjective relating to or characteristic of the US state of Tennessee or its inhabitants: the Tennessean sons of a preacher | [person implied] : a way for us to honor a great Tennessean.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8d7\ude41\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8c2\udd81\ud8c2\udd81.mov"} rr P 33O O!Pfrost2024/03/22 18:59:082026/05/06 02:21:37AS18720S2fe00S10006S19220S20320S16d20M511x547S18720489x453S19220490x485S20320490x508S16d20489x527proper noun a state in the northern US, bordering on Lakes Superior (in the northwest) and Michigan (in the east); capital, Madison.
    adjective relating to or characteristic of the US state of Wisconsin or its inhabitants: Wisconsin cheese | [person implied] : she met her husband, Mark, and has been a Wisconsinite ever since.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8cd\udee1\ud8d8\udd41\ud8ca\udd01.mov"} qzR 33) m!}Rfrost2024/03/22 19:35:382026/05/06 16:50:52AS11520S2fe00S10006S20320S1f720M510x534S11520495x466S20320495x500S1f720490x519proper noun, adjective, noun the United States.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c2\udc01\ud8fc\udc61\u00d8\ud8d8\udd41\ud8d7\udcc1.mov"} Q 33) !}Qfrost2024/03/22 19:00:452026/05/06 03:19:06AS18720S2fe00S10006S19220S20320M511x535S18720489x465S19220490x497S20320490x520proper noun, adjective relating to or associated with Wisconsin.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8cd\udee1\ud8d8\udd41.mov"} *S 33 !eSfrost2024/03/22 19:36:562026/05/06 16:50:11AS11520S2fe00S10006S20320M508x525S11520493x476S20320493x510proper noun a country that occupies most of the southern half of North America as well as Alaska and the Hawaiian Islands; capital, Washington, DC.
    adjective relating to or characteristic of the United States or its inhabitants.
    noun a native or citizen of the United States. Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c2\udc01\ud8fc\udc61\u00d8\ud8d8\udd41.mov"} `U 33 3!)Ufrost2024/03/22 22:11:362026/02/06 20:25:35AS10e11S2fe00S10006S2c300M515x527S10e11485x497S2c300489x473adjective coming after the first in order: he is a writer first and a scientist second | a second home | French as a second language.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd52\ud8fc\udc61\u00d8\ud8ea\udd21.mov"}T 33) !}Tfrost2024/03/22 19:37:472026/05/06 02:22:19AS18720S2fe00S10006S19a20S17620M514x537S18720491x464S19a20486x497S17620492x521proper noun a state in the west central US; capital, Cheyenne.
    adjective relating to or characteristic of the US state of Wyoming or its inhabitants: a Wyoming cowboy | [person implied] : Wyomingites don't see him as a local.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8ce\udde1\ud8cb\udc61.mov"} WW^W 33 /!)Wfrost2024/03/22 22:18:442026/02/06 20:27:49AS14411S2fe00S10006S2c300M517x527S14411483x499S2c300491x474adjective coming after the third in order: the fourth and fifth centuries | there were three bedrooms, with potential for a fourth.Adam Frost{"video":"dominance: right;\\n\ud8c6\udd92\ud8fc\udc61\u00d8\ud8ea\udd21.mov"}CV 33 y!)Vfrost2024/03/22 22:16:352025/12/06 02:27:18AS11e11S2fe00S10006S2c300M515x527S11e11485x497S2c300489x473adjective coming after the second in order: the third century | the third of October | Edward the Third.Adam Frost{"video":"dominance: right;\\n\ud8c2\udf52\ud8fc\udc61\u00d8\ud8ea\udd21.mov"} a`Y 33 3!)Yfrost2024/03/22 22:24:262026/02/06 20:28:58AS18711S2fe00S10006S2c300M517x525S18711484x501S2c300491x476adjective coming after the fifth in order: her sixth novel | the sixth of the month | to the original five categories we add a sixth.Adam Frost{"video":"dominance: right;\\n\ud8cc\udeb2\ud8fc\udc61\u00d8\ud8ea\udd21.mov"}X 33 )!)Xfrost2024/03/22 22:20:062025/12/06 02:27:33AS14c11S2fe00S10006S2c300M517x526S14c11483x499S2c300491x475adjective coming after the fourth in order: the fifth century BC | her mother had just given birth to another child, her fifth | the world's fifth-largest oil exporter | the fifth of November.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc92\ud8fc\udc61\u00d8\ud8ea\udd21.mov"} [ 33 w!)[frost2024/03/22 22:30:132026/02/06 20:30:13AS1bb11S2fe00S10006S2c300M517x525S1bb11484x498S2c300491x476adjective coming after the seventh in order: in the eighth century | the eighth of September | seven men admitted conspiracy, an eighth admitted assisting an offender.Adam Frost{"video":"dominance: right;\\n\ud8d1\ude32\ud8fc\udc61\u00d8\ud8ea\udd21.mov"}bZ 33 7!)Zfrost2024/03/22 22:28:122025/12/06 02:18:09AS1a511S2fe00S10006S2c300M517x525S1a511484x498S2c300491x476adjective coming after the sixth in order: his seventh goal of the season | the seventh of June | he was the seventh of eight children.Adam Frost{"video":"dominance: right;\\n\ud8cf\uddf2\ud8fc\udc61\u00d8\ud8ea\udd21.mov"} 44W^ 33) c!A^frost2024/03/22 22:36:062026/05/28 23:20:44AS10e40S2fe00S10006S26504S2f900M508x529S10e40493x472S26504494x506S2f900495x524ranking ordinal the second finisher or position in a race or competition: he finished second.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd81\ud8fc\udc61\u00d8\ud8e1\udde5\ud8ef\udd61.mov"};] 33) +!A]frost2024/03/22 22:33:492026/05/28 23:17:43AS10040S2fe00S10006S26504S2f900M508x529S10040493x472S26504494x506S2f900495x524ranking ordinal the first finisher or position in a race or competition.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc41\ud8fc\udc61\u00d8\ud8e1\udde5\ud8ef\udd61.mov"}.\ 33 O!)\frost2024/03/22 22:31:392025/12/06 02:27:49AS1ce11S2fe00S10006S2c300M516x526S1ce11484x499S2c300490x475adjective coming after the eighth in order: the ninth century | the ninth of March.Adam Frost{"video":"dominance: right;\\n\ud8d3\udd52\ud8fc\udc61\u00d8\ud8ea\udd21.mov"} 44m` 33) !A`frost2024/03/22 22:38:472026/05/28 23:20:16AS14440S2fe00S10006S26504S2f900M511x529S14440489x471S26504491x506S2f900493x524ranking ordinal the fourth finisher or position in a race or competition: he could do no better than finish fourth.Adam Frost{"video":"dominance: right;\\n\ud8c6\uddc1\ud8fc\udc61\u00d8\ud8e1\udde5\ud8ef\udd61.mov"}W_ 33) c!A_frost2024/03/22 22:37:252026/05/28 23:20:29AS11e40S2fe00S10006S26504S2f900M512x529S11e40489x472S26504490x506S2f900492x524ranking ordinal the third finisher or position in a race or competition: Hill finished third.Adam Frost{"video":"dominance: right;\\n\ud8c2\udf81\ud8fc\udc61\u00d8\ud8e1\udde5\ud8ef\udd61.mov"} ??db 33) }!Abfrost2024/03/22 22:40:592026/05/28 23:21:56AS18740S2fe00S10006S26504S2f900M509x528S18740491x472S26504493x505S2f900495x523ranking ordinal the sixth finisher or position in a race or other competition: he could only finish sixth.Adam Frost{"video":"dominance: right;\\n\ud8cc\udee1\ud8fc\udc61\u00d8\ud8e1\udde5\ud8ef\udd61.mov"}Ua 33) _!Aafrost2024/03/22 22:39:482026/05/28 23:21:16AS14c40S2fe00S10006S26504S2f900M512x529S14c40488x471S26504493x506S2f900494x524ranking ordinal the fifth finisher or position in a race or competition: he finished fifth.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcc1\ud8fc\udc61\u00d8\ud8e1\udde5\ud8ef\udd61.mov"} nd 33) !Adfrost2024/03/22 22:50:032026/05/28 23:23:17AS1bb40S2fe00S10006S26504S2f900M511x528S1bb40490x473S26504496x505S2f900497x523ranking ordinal the eighth finisher or position in a race or competition: she finished eighth of the eleven runners.Adam Frost{"video":"dominance: right;\\n\ud8d1\ude61\ud8fc\udc61\u00d8\ud8e1\udde5\ud8ef\udd61.mov"}kc 33) !Acfrost2024/03/22 22:43:132026/05/28 23:22:36AS1a540S2fe00S10006S26504S2f900M511x528S1a540490x473S26504496x505S2f900497x523ranking ordinal the seventh finisher or position in a race or competition: he finished seventh in the tournament.Adam Frost{"video":"dominance: right;\\n\ud8cf\ude21\ud8fc\udc61\u00d8\ud8e1\udde5\ud8ef\udd61.mov"} cf 33) {!Affrost2024/03/23 15:56:182026/05/14 00:29:51AS14c20S2fe00S10006S2880bS18526M522x533S14c20479x467S2880b502x485S18526507x508proper noun a continent located south of Europe and west of Asia.
    adjective relating to Africa or its people, customs, or languages.
    noun a person from Africa. Adam Frost{"video":"dominance: right;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8e4\udf0c\ud8cc\ude07.mov"}Te 33) ]!Aefrost2024/03/22 22:53:252026/05/28 23:23:45AS1ce40S2fe00S10006S26504S2f900M511x529S1ce40489x472S26504490x506S2f900491x524ranking ordinal the ninth finisher or position in a race or competition: he came in ninth.Adam Frost{"video":"dominance: right;\\n\ud8d3\udd81\ud8fc\udc61\u00d8\ud8e1\udde5\ud8ef\udd61.mov"} PiP&i 33 ?!)ifrost2024/03/23 16:15:462026/07/22 16:36:44AS19c50S2fe00S10006S25500M514x527S19c50486x498S25500496x473verb (of an aircraft) to become airborne: the plane took off from the runway.
    noun (of an aircraft) the action of becoming airborne: the plane accelerated down the runway for takeoff.Adam Frost{"video":"dominance: right;\\n\ud8ce\uded1\ud8fc\udc61\u00d8\ud8df\udfe1.mov"}Ch 33 y!)hfrost2024/03/23 16:09:432026/07/22 16:20:59AS19c50S2fe00S10006S26a00M515x524S19c50486x49g 33) /!mgfrost2024/03/23 16:00:442026/05/08 23:36:29AS1f710S33200S10006S2e300S20500M518x542S33100482x483S1f710477x498S2e300474x515proper noun, adjective, noun dated relating to or associated with Africa.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d7\udcb1\ud8f4\udec1\u00d8\ud8ed\udd21\ud8d8\udde1.mov"}86x504S11a20500x501S20e00502x487S22a00502x470noun a cylindrical projectile that can be propelled to a great height or distance by the combustion of its contents, used typically as a firework or signal. verb [center to up loci] (of a rocket or spacecraft) to take off from a launching site: space shuttles generally blast off with a minimum of fuss. Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udde1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8db\udfc1.mov"} MM/j 33 Q!)jfrost2024/03/23 16:18:442026/07/22 16:40:12AS19c50S2fe00S10006S25504M514x528S19c50486x473S25504495x506verb [no object] (of an aircraft) to come down through the air and alight on the ground: planes landing at the rate of two a minute.: planes landing at the rate of two a minute. noun an instance of coming or bringing (an aircraft) from the air: we made a perfect landing at the airstrip.Adam Frost{"video":"dominance: right;\\n\ud8ce\uded1\ud8fc\udc61\u00d8\ud8df\udfe5.mov"} }k33){!}kfrost2024/03/23 16:39:202026/05/23 16:51:14AS19220S2fe00S10006S1dc20S1dc20M515x544S19220494x457S1dc20485x480S1dc20485x514S38b00470x493 M515x544S19210485x457S1dc10491x480S1dc10491x514 M515x543S19220494x458S19c20486x514S19c20486x481 S38b04470x493proper noun a state in the eastern central US; capital, Springfield.
    adjective relating to or characteristic of the US state of Illinois or its inhabitants: an Illinoisan farmer | [person implied] : the Illinoisan who ran the campaign.

    PHONOLOGICAL VARIANTS
    Illinois with palm facing change
    Illinois with ILY-handAdam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8cd\udee1\ud8fc\udc61\u00d8\ud8d4\udea1\ud8d4\udea1.mov"} ""Zl 33)k-!lfrost2024/03/23 16:40:472026/05/23 16:41:01AS19210S2fe00S10006S1dc10S1dc10M515x544S19210485x457S1dc10491x480S1dc10491x514M515x544S19220494x457S1dc20485x480S1dc20485x514proper noun, adjective a phonological variant (palm facing change) of Illinois.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\nfingerspelled: abbreviated;\\n\ud8cd\uded1\ud8fc\udc61\u00d8\ud8d4\ude91\ud8d4\ude91.mov"} mm 33[ !!}mfrost2024/03/23 16:52:162026/05/06 16:55:14AS14c41S2fe00S14c49S2fe00S21406S20700S2e732M525x528S14c41499x472S14c49476x475S20700493x496S2e732490x512proper noun a country that occupies most of the southern half of North America as well as Alaska and the Hawaiian Islands; capital, Washington, DC.
    adjective relating to or characteristic of the United States or its inhabitants: a leading American industrial company.
    noun
    1. a native or citizen of the United States.
    2. the English language as it is used in the United States; American English.
    Adam Frost{"video":"dominance: right;\\n\ud8c7\udcc2\ud8fc\udc61\ud8c7\udcca\ud8fc\udc61\ud8d9\udf87\ud8d8\udea1\ud8ed\uded3.mov"} RR*n 33A e!Mnfrost2024/03/23 16:55:182026/05/08 23:36:49AS1f710S30005S10006S20e00S22a04S26502S30003S20e00S22a04M523x560S2ff00482x483S1f710503x507S20e00483x526S22a04482x545S26502492x535S20e00505x526S22a04505x545proper noun a state in the southwestern US, on the border with Mexico; capital, Phoenix.
    adjective relating to or characteristic of the US state of Arizona or its inhabitants: an Arizonan summer | [person implied] : he became the 92nd Arizonan to play in the major leagues.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d7\udcb1\ud8f0\udc06\u00d8\ud8d9\udd41\ud8db\udfc5\ud8e1\udde3\ud8f0\udc04\ud8d9\udd41\ud8db\udfc5.mov"} zo33A#'!ofrost2024/03/23 17:00:382026/05/23 18:16:25AS1f720S2fe00S10006S14c20S2fe00S10006S2e300M512x540S1f720488x461S14c20489x479S2e300489x513S38b00470x493 M525x530S1f720475x515S28807499x506S14c20502x471 S38b04470x493proper noun a continent east of Europe and north of Australia.
    adjective relating to Asia or its people, customs, or languages: their discussions focused on the relations between the European Union and Asian countries.
    noun a native of Asia or a person of Asian descent: Asians made up California's fastest-growing racial or ethnic group.

    PHONOLOGICAL VARIANTS
    Asia with curved movementAdam Frost{"video":"dominance: right;\\nletter: abbreviated;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8c7\udca1\ud8fc\udc61\u00d8\ud8ed\udd21.mov"} i"r 33[ !}sfrost2024/03/23 19:20:342026/10/04 01:40:49AS20301S2fe00S20309S2fe00S38006S26500S26510M533x520S20301512x498S20309467x499S26500516x480S26510470x480noun [nonstandard] a bus.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udee1\ud8fc\udc61\ud8c6\udee9\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"}p 33A !}qfrost2024/03/23 18:18:142026/05/08 16:10:37AS18210S2fe00S18218S2fe00S21404S20500S22a04M520x519S18218481x481S18210497x487S22a04501x504Adam Frost{"video":"dominance: right;\\n\ud8cc\udcd1\ud8fc\udc61\ud8cc\udcd9\ud8fc\udc61\ud8d9\udf85\ud8d8\udde1\ud8db\udfc5.mov"}ic number 79, used especially in jewelry and decoration and to guarantee the value of currencies.
  • a deep lustrous yellow or yellow-brown color: her eyes were light green and flecked with gold.
  • coins or other articles made of gold: her ankles and wrists were glinting with gold.
    • proper noun a state in the western US, on the coast of the Pacific Ocean; capital, Sacramento.
    adjective
    1. made of or colored like gold: gold earrings | the warm gold interior of the wood-lined church.
    2. relating to the US state of California or its inhabitants: 67 percent of Californian voters backed the measure | [person implied] : a Californian by birth.
    Adam Frost{"video":"dominance: right;\\n\ud8ce\ude92\ud8f4\ude11\u00d8\ud8d8\udde1\ud8db\udfc6\ud8ce\udde1.mov"} rgs 33A /!}tfrost2024/03/23 19:35:052026/06/12 20:00:57AS15a51S2fe00S15a1aS2fe00S21400S20500S22a00M518x521S15a1a482x509S15a51495x498S22a00496x480adverb
    1. at the minimum: clean the windows at least once a week.
    2. above the minimum: he was driving more than 50 mph.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8db\udfc1.mov"} 8,t33kk!)ufrost2024/03/23 19:37:542026/06/05 17:27:20AS1f540S38510S10006S20500M508x519S1f540493x482S20500496x508S38b00470x493 M508x519S1f548493x482S20500496x508 S38b04470x493 S38a00464x490 M511x519S1f540492x482S20600489x508reflexive pronoun [at center locus] used to refer to a person as the object of a verb or preposition when also the subject of the clause: I hurt myself by accident | I kept the money for myself.

    PHONOLOGICAL VARIANTS
    myself with knuckles touching chest

    INFLECTED FORMS
    myself [in isolation]Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\uddf1\u00d8\ud8d8\udde1.mov"} nnu 33Q)!Kvfrost2024/03/23 19:42:272026/05/23 02:33:16AS1f548S38510S10006S20500M508x519S1f548493x482S20500496x508M508x519S1f540493x482S20500496x508reflexive pronoun a phonological variant (knuckles touching chest) of myself.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d7\udc29\ud8fc\uddf1\u00d8\ud8d8\udde1.mov"} Z08@HPX`hpx0 (08@HPX`hpx (08@HPX`hpxp hSSTTUUVVWWXXYYZZ[[\\]]^^__``aabbccddeeffgghhiijjkkllmmnnooqprqsrtsutvuwvxwyxzy{z|{}|~}~ iav 33Qq!)wfrost2024/03/23 19:44:232026/06/05 17:27:37AS1f540S2fe00S10006S26507M516x515S1f540485x491S26507503x485M518x517S1f540483x493S26a07497x483reflexive pronoun [at right front locus] used to refer to a person as the object of a verb or preposition when also the subject of the clause: he works for himself | she had to defend herself.

    INFLECTED FORMS
    himself/herself/itself/themselves [in isolation]Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\u00d8\ud8e1\udde8.mov"} :2w 33Q!)xfrost2024/03/23 19:46:462026/06/05 17:27:53AS1f540S2fe00S10006S26500M508x521S1f540493x497S26500493x479M514x521S1f540493x497S26a00487x480reflexive pronoun [at front locus] used to refer to a person as the object of a verb or preposition when also the subject of the clause: help yourself | see for yourself.

    INFLECTED FORMS
    yourself [in isolation]Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\u00d8\ud8e1\udde1.mov"} Jx 33A u!}yfrost2024/03/23 19:49:182026/05/26 02:51:11AS15a40S2fe00S15a48S2fe00S21400S20500S28802M519x522S15a48499x495S15a40507x478S28802482x478preposition [center to left loci] in or into the specific position immediately to one side of: the table is next to him on his left.
    adjective [center to left loci] next to or adjoining something else: the adjacent room | the area adjacent to the fire station.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e4\udf03.mov"} ssz 33) )!M{frost2024/03/23 19:55:362026/02/07 18:26:54AS15a10S2fe00S15a1aS38615S20500M514x532S15a10496x468S37800505x495S15a1a487x520noun the middle of the day at twelve o'clock: his classes let out at noon | he awoke at midday | [as modifier] : the midday sun.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd1\ud8fc\udc61\ud8c8\udddb\ud8fc\ude56\ud8d8\udde1.mov"}y 333 !izfrost2024/03/23 19:51:402026/05/06 03:19:57AS14c00S30004S10006S20500S22510S1f720S2fe00S10006S10120S17620M534x618S2ff00482x483S14c00488x513S22510512x513S1f720487x551S10120492x569S17620492x602proper noun, adjective relating to or associated with Colorado.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c7\udc81\ud8f0\udc05\u00d8\ud8d8\udde1\ud8db\uddf1\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8c0\udc81\ud8cb\udc61.mov"} ==?{ 33O i!e|frost2024/03/23 20:09:292026/05/08 16:25:47AS10e10S2fe00S15a1aS38615S20500S21b00M514x539S37800505x502S15a1a487x527S10e10493x472S21b00497x461noun twelve o'clock in the day; noon: the service starts at twelve noon | his classes let out at noon.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd51\ud8fc\udc61\ud8c8\udddb\ud8fc\ude56\ud8d8\udde1\ud8da\ude21.mov"} \\ | 33 m!U}frost2024/03/23 20:37:412026/05/14 00:33:07AS14a00S30007S10006S2e300M542x526S2ff00482x483S14a00520x482S2e300519x499proper noun a continent west of Asia and north of Africa.
    adjective relating to or characteristic of Europe or its inhabitants: twentieth-century European art | the culture and history of the European peoples. noun a native or inhabitant of Europe. Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udfc1\ud8f0\udc08\u00d8\ud8ed\udd21.mov"} z~ 33 /!Ufrost2024/03/23 20:47:382026/05/08 23:54:48AS11910S30007S10006S2e300M542x526S2ff00482x483S11910518x472S2e300519x499proper noun, adjective, noun dated relating to or associated with Norway.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udd71\ud8f0\udc08\u00d8\ud8ed\udd21.mov"}} 33 1!U~frost2024/03/23 20:45:202026/05/08 23:54:40AS1ce10S30007S10006S2e300M542x526S2ff00482x483S1ce10519x467S2e300519x499proper noun, adjective, noun dated relating to or associated with Finland.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d3\udd51\ud8f0\udc08\u00d8\ud8ed\udd21.mov"} {{ 33 /!Ufrost2024/03/23 20:49:402026/05/08 23:54:57AS20310S30007S10006S2e300M542x526S2ff00482x483S20310520x482S2e300519x499proper noun, adjective, noun dated relating to or associated with Sweden.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d8\udd31\ud8f0\udc08\u00d8\ud8ed\udd21.mov"} 7) 33) !Afrost2024/03/23 20:53:242026/05/06 17:01:35AS10043S38511S10006S21100S23b04M519x525S10043489x475S21100482x500S23b04498x504proper noun a country in East Asia, the fourth largest and the most populous in the world; capital, Beijing.
    adjective relating to China or its language, culture, or people: the Chinese province of Shaanxi | prospects for the Chinese economy.
    noun
    1. a native or inhabitant of China, or a person of Chinese descent.
    2. the Sino-Tibetan language of China.
    3. a Chinese meal: a takeout Chinese washed down with Chardonnay.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc44\ud8fc\uddf2\u00d8\ud8d9\ude61\ud8dd\ude25.mov"} JJp 33[ {!)frost2024/03/23 21:01:232026/06/01 16:55:44AS11a20S2fe00S15a18S2fe00S21406S20e00S22a00M515x531S15a1848 33g !frost2024/03/23 20:57:192026/05/06 17:21:11AS10051S2fe00S10059S2fe00S21406S22a03S22a15S20500M537x520S10051501x499S10059470x499S22a03524x481S22a15464x481proper noun, adjective, noun relating to or associated with India.Adam Frost{"video":"dominance: equal;\\n\ud8c0\udc52\ud8fc\udc61\ud8c0\udc5a\ud8fc\udc61\ud8d9\udf87\ud8db\udfc4\ud8db\udfd6\ud8d8\udde1.mov"}z 33 ;!Ufrost2024/03/23 20:55:112026/07/22 02:13:02AS20320S2fe00S10006S23b04M519x513S20320481x488S23b04500x492noun a half-year term in a school or college, typically lasting fifteen to eighteen weeks: the opening week of Harvard's autumn semester.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8dd\ude25.mov"}9S29904504x500
    proper noun
    1. a country in East Asia that occupies the northern part of the peninsula of Korea; capital, Pyongyang.
    adjective
    1. relating to or characteristic of North Korea or its people: the North Korean leader.
    noun
    1. a native or inhabitant of North Korea: North Koreans place flowers before the statues.
    USAGE
    This sign is not commonly known especially since there isn't much communication with Deaf members within. Instead, most users will use the two signs north and Korea to mean this country specifically.
    Adam Frost{"video":"dominance: right;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8e6\udd65.mov"} c 33 !Ufrost2024/03/23 21:03:402026/05/08 23:55:36AS16d20S2fe00S10006S2480aM524x510S16d20476x490S2480a496x492proper noun, adjective relating to or associated with Colorado.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udd01\ud8fc\udc61\u00d8\ud8de\udf0b.mov"} oo  33g !Afrost2024/03/23 21:06:322026/05/08 23:55:47AS18d20S2fe00S18d28S2fe00S21406S20500S23b04S23b1cM543x518S18d20501x483S18d28480x483S23b04524x497S23b1c458x497noun a building in which objects of historical, scientific, artistic, or cultural interest are stored and exhibited: [as name] : the Museum of Modern Art | the museum is noted for its fine fossil collection | [as modifier] : a museum curator.
    proper noun a state in the western US, on the Canadian border to the east of the Rocky Mountains; capital, Helena.
    adjective relating to or characteristic of the US state of Montana or its inhabitants: a Montanan winter | [person implied] : a successful entrepreneur and pioneer Montanan.Adam Frost{"video":"dominance: equal;\\nletter: integrated;\\n\ud8cd\udd01\ud8fc\udc61\ud8cd\udd09\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8dd\ude25\ud8dd\ude3d.mov"}  33 #!frost2024/04/06 02:50:542026/05/31 01:46:16AS33b00S34400M518x530S33b00482x471S34410495x516S2ff10482x501affix used to mark something as explosive or having a sudden change.Adam Frost{"video":"dominance: equal;\\n\ud8f5\ude21\ud8f6\udd81.mov"}  33[ !}frost2024/03/23 21:12:142026/07/28 18:21:14AS15a40S2fe00S15a48S2fe00S38006S26500S26510M523x524S15a40510x497S15a48479x497S26500509x476S26510478x476noun
    1. a bounded area where people or vehicles travel from one place to another: we went a different way home.
    2. a method, style, or manner of doing something: there are two ways of approaching this problem.
    Adam Frost{"video":"dominance: equal;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc07\ud8e1\udde1\ud8e1\uddf1.mov"} } 335 S!frost2024/03/23 21:17:562026/05/19 04:00:22AS1fb40S2fe00S1fb48S2fe00S21400S20600M520x516S1fb48481x495S1fb40490x484S20600498x505noun [nonstandard] a truck.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d7\ude61\ud8fc\udc61\ud8d7\ude69\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"}` 33 3!frost2024/04/06 15:00:352026/05/08 23:56:08AS14a50S2fe00S14c59S2fe00S21400S20500M514x519S14c59487x493S14a50496x481adjective having formally agreed to marry: she was engaged to a lecturer | the newly engaged couple.
    noun a formal agreement to get married: she'd broken off her engagement to Paul. Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c7\udc11\ud8fc\udc61\ud8c7\udcda\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1.mov"} " 33[ !}frost2024/03/23 21:49:292026/05/08 16:28:54AS1ce20S2fe00S1ce28S2fe00S38006S27102S27116M531x537S1ce20509x463S1ce28469x463S27102511x497S27116475x497Adam Frost{"video":"dominance: equal;\\n\ud8d3\udd61\ud8fc\udc61\ud8d3\udd69\ud8fc\udc61\ud8fc\udc07\ud8e2\ude63\ud8e2\ude77.mov"}" 33[ !}frost2024/03/23 21:27:112026/06/01 17:00:08AS11030S2fe00S11038S2fe00S38000S26a00S26a10M519x546S11030498x471S11038488x519S26a00492x454S26a10481x502noun a short narrow board with two small wheels fixed to the bottom of either end, on which (as a recreation or sport) a person can ride in a standing or crouching position, propelling themselves by occasionally pushing one foot against the ground.Adam Frost{"video":"dominance: right;\\n\ud8c1\ude31\ud8fc\udc61\ud8c1\ude39\ud8fc\udc61\ud8fc\udc01\ud8e1\udfc1\ud8e1\udfd1.mov"} mc 33 !Ufrost2024/03/23 21:52:052026/05/08 23:56:29AS11920S2fe00S10006S24509M525x517S11920475x491S24509496x483proper noun a mountainous European country on the northern and western coastline of Scandinavia, on the Norwegian Sea and the Arctic Ocean; capital, Oslo.
    adjective relating to Norway or its people or language.
    noun
    1. a native or inhabitant of Norway, or a person of Norwegian descent.
    2. the North Germanic language of Norway.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udd81\ud8fc\udc61\u00d8\ud8de\uddea.mov"} ND 33 a!)frost2024/03/23 21:54:542026/05/06 17:13:38AS10600S30004S10006S20600M533x536S2ff00482x483S10600491x510S20600511x514proper noun a country on the Baltic Sea, between Sweden and Russia; capital, Helsinki.
    adjective relating to the Finns or their language.
    noun
    1. the Finno-Ugric language of the Finns, spoken in Finland and in parts of Russia and Sweden.
    2. a native or inhabitant of Finland or a person of Finnish descent.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\ude41\ud8f0\udc05\u00d8\ud8d8\ude41.mov"} %%a 33O 9!Yfrost2024/03/23 22:01:252026/05/06 01:49:51AS19c11S33010S10006S20500S22a05S19a20M572x559S2ff00482x483S19c11511x502S22a05536x527S19a20544x539noun
    1. a yellow precious metal, the chemical element of atomj 333 {!Efrost2024/03/23 21:58:272026/05/13 23:59:59AS1f040S2fe00S1f048S2fe00S21406S20500S26a06S26a12S1f440S1f448M579x514S1f040501x493S1f048470x493S26a06533x487S26a12453x487S1f440550x493S1f448421x493proper noun a country in East Asia occupying a chain of islands in the Pacific roughly parallel with the east coast of the Asian mainland; capital, Tokyo.
      adjective relating to Japan or its language, culture, or people.
      noun
      1. a native or inhabitant of Japan, or a person of Japanese descent.
      2. the language of Japan.
      Adam Frost{"video":"dominance: equal;\\n\ud8d6\ude41\ud8fc\udc61\ud8d6\ude49\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\udfc7\ud8e1\udfd3\ud8d6\udfc1\ud8d6\udfc9.mov"}ection id=noun1179> noun
      1. a native or inhabitant of North or South Korea, or a person of Korean descent.
      2. a native or inhabitant of South Korea: he coached the South Koreans for the Olympics.
      3. the language of Korea, which has its own writing system (Hangul) and different standardized official forms used in North Korea and South Korea.
      USAGE
      Excluding the dated sign for Korea, this sign is the only generally known sign associated with the region. As a result, most users will use this sign to mean the entire region and the two signs south and Korea to mean the country of South Korea specifically.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8f0\udc08\u00d8\ud8d8\udde1\ud8dd\udfa4\ud8cc\udcd1\ud8f0\udc07\ud8d8\udde1.mov"} AAbX 33 !)frost2024/03/23 22:17:582026/05/06 02:36:41AS10001S2ff00S10006S2e300M519x548S2ff00482x483S10001498x492S2e300489x521proper noun, adjective relating to or associated with Hawaii.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc02\ud8ef\udfa1\u00d8\ud8ed\udd21.mov"}_ 33 k!Ufrost2024/03/23 22:16:212026/05/08 23:56:46AS11501S2ff00S10006S2e300M519x548S2ff00482x483S11501494x495S2e300489x521proper noun a state of the US comprising a group of over twenty islands in the North Pacific Ocean; capital, Honolulu (on Oahu).
      • an inhabitant of Hawaii.
      • a member of the Indigenous people of Hawaii; a Native Hawaiian.
      • the Austronesian language of Hawaii.
      adjective relating to Hawaii, its people, or their language.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c1\udfe2\ud8ef\udfa1\u00d8\ud8ed\udd21.mov"} ))S 33Ak!frost2024/03/23 22:21:262026/06/01 17:07:48AS14c12S2fe00S10018S2fe00S21400S20500S2c500M520x537S10018503x507S14c12481x490S2c500480x463M520x534S1f548496x510S14c12481x493S2c500480x466noun a phonological variant (index base hand) of helicopter.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udc93\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8ea\udde1.mov"} z33A#=!}frost2024/03/23 22:22:152026/06/01 17:06:31AS14c12S2fe00S1f548S2fe00S21400S20500S2c500M520x534S1f548496x510S14c12481x493S2c500480x466S38b00470x493 M520x537S10018503x507S14c12481x490S2c500480x463 S38b04470x493noun a type of aircraft which derives both lift and propulsion from one or more sets of horizontally revolving overhead rotors.

      PHONOLOGICAL VARIANTS
      helicopter with index base handAdam Frost{"video":"dominance: right;\\n\ud8c7\udc93\ud8fc\udc61\ud8d7\udc29\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8ea\udde1.mov"} 00L 33i u!Yfrost2024/03/23 22:33:122026/05/06 17:18:05AS1f510S30000S10006S20500S2f900S26b02M518x518S2ff00482x483S1f510493x478S20500495x465S2f900495x458S26b02470x458proper noun a country in southern Asia that occupies the greater part of the Indian subcontinent; capital, New Delhi.
      adjective relating to India or its people, customs, or languages: the company is said to enter the Indian market soon.
      noun a native or inhabitant of India, or a person of Indian descent: I hope this will inspire a new generation of Indians to enter the world of science.Adam Frost{"video":"dominance: right;\\n\ud8d6\udff1\ud8f0\udc01\u00d8\ud8d8\udde1\ud8ef\udd61\ud8e2\udc23.mov"} >331 !Kfrost2024/03/23 22:34:512026/05/23 17:02:16AS19200S30000S10006S2330aM546x539S2ff00482x483S19200517x488S2330a520x509M517x528S1ed27484x472S29904503x496 M538x549S2ff00482x483S19200517x488S27102522x509proper noun, adjective, noun relating to or associated with Italy.
      noun a phonological variant (cross movement) of Pepsi.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8cd\udec1\ud8f0\udc01\u00d8\ud8dc\udf2b.mov"} tt 33k%!)frost2024/03/23 22:38:562026/05/23 17:01:40AS1ed27S2fe00S10006S29904M517x528S1ed27484x472S29904503x496M546x539S2ff00482x483S19200517x488S2330a520x509proper noun a country in southern Europe; capital, Rome.
      adjective relating to Italy, its people, or their language: the Italian Ministry of Culture | an Italian pasta manufacturer | my dad is Italian.
      noun
      1. a native or inhabitant of Italy, or a person of Italian descent: the great religious paintings of the Italians | many Italians eat there.
      2. the Romance language of Italy, descended from Latin: a mathematical treatise written in Italian.

      SIGN VARIATIONS
      Italy with cross movementAdam Frost{"video":"dominance: right;\\n\ud8d6\udd08\ud8fc\udc61\u00d8\ud8e6\udd65.mov"} ]] 33C -!mfrost2024/03/23 22:40:052026/05/09 00:01:44AS19200S31410S10006S20e00S2e004M556x518S2ff00482x483S19200517x493S20e00521x478S2e004535x473proper noun, adjective, noun dated relating to or associated with Japan.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\udec1\ud8f1\udf91\u00d8\ud8d9\udd41\ud8ed\udc05.mov"} 9 33 e!)frost2024/03/23 22:47:272026/10/06 18:15:09AS1dc20S2fe00S10006S29904M518x532S1dc20482x46 33) %!mfrost2024/03/23 22:43:402026/10/06 18:28:10AS14010S31410S10006S20500S2e106M569x532S2ff00482x483S14010517x481S2e106548x492
      proper noun dated
      1. Korea (sense 1).
      adjective dated
      1. Korean (sense 1).
      noun dated
      1. a Korean (sense 1).
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc11\ud8f1\udf91\u00d8\ud8d8\udde1\ud8ed\udc67.mov"}495x459S11a20500x478S14020486x512proper noun a state in the south central US; capital, Little Rock.
      adjective relating to or characteristic of the US state of Arkansas or its inhabitants: the nature that dominated the Arkansan landscape | [person implied] : a sixth-generation Arkansan.
      noun
      1. (the ark) (in the Bible) the ship built by Noah to save his family and two of every kind of animal from the Flood; Noah's ark.
        • a vessel or sanctuary that serves as protection against extinction: a starship ark built by their android protectors.
      2. short for Ark of the Covenant.
        • (also Holy Ark) a chest or cupboard housing the Torah scrolls in a synagogue.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated (proper noun, adjective);\\nfingerspelled: full (noun);\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8c2\udde1\ud8c6\udc21.mov"}0483x466S19a20490x485S18d20492x509M559x515S36d00479x511S1ea11514x489S1ea19458x489S2ea30544x485S2ea48441x485 M538x517S20320517x502S20328469x502S26a00511x484S26a10462x484noun
      1. a room or building equipped for gymnastics, games, and other physical exercise.
        • a membership organization that provides a range of facilities designed to improve and maintain physical fitness and health: we got guest passes to Suzanne's gym.
      2. physical education: I'm taking just one more semester of gym.

      SIGN VARIATIONS
      gym with index-over-thumb hands
      gym with fistsAdam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d6\ude01\ud8fc\udc61\u00d8\ud8ce\udde1\ud8cd\udd01.mov"} y 33g !! frost2024/03/23 22:49:112026/10/06 18:14:31AS15a11S30007S10006S20500S23f03S18210S30006S20500M557x526S2ff00482x483S15a11510x487S23f03534x493S18210508x511
      proper noun
      1. a region in eastern Asia that forms a peninsula between the Sea of Japan (East Sea) and the Yellow Sea, now divided into the countries of North Korea and South Korea.
      2. a country in East Asia, occupying the southern part of the peninsula of Korea; capital, Seoul.
      adjective
      1. relating to North or South Korea or its people or language.
      2. relating to or characteristic of South Korea or its people: the 1956 South Korean film classic.
      proper noun an island country off the southeastern coast of China; capital, Taipei.
      adjective relating to or characteristic of Taiwan or its people: internationally successful Taiwanese filmmakers.
      noun the people of Taiwan collectively: the Taiwanese can apply their expertise in making complex components for small spaces.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd32\ud8f5\udee1\u00d8\ud8e4\ude43.mov"}} 33C !Afrost2024/03/23 22:55:592026/05/06 18:36:13AS20311S33d00S10006S23004S26602M537x541S33b00482x483S20311516x513S23004489x523S26602481x516proper noun, adjective, noun relating to or associated with Taiwan.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd32\ud8f5\udee1\u00d8\ud8dc\ude05\ud8e1\ude43.mov"} ^^ 33[ !}frost2024/03/23 23:08:052026/05/06 02:23:06AS19a50S2fe00S15a3aS2fe00S21400S21100S27106M529x520S15a3a472x503S19a50471x487S21100498x493S27106514x480proper noun
      1. (also New York State) a state in the northeastern US; capital, Albany.
      2. (also New York City) a major city and port in southeastern New York, situated on the Atlantic coast at the mouth of the Hudson River.
      adjective
      1. relating to or characteristic of the US state of New York or its inhabitants: the New York apple orchards | [person implied] : New Yorkers were coping with flooding in some areas.
      2. relating to or characteristic of the US city of New York or its inhabitants: New York pizza | [person implied] : he was a New Yorker at heart.
      Adam Frost{"video":"dominance: right;\\n\ud8ce\ude11\ud8fc\udc61\ud8c8\uddfb\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e2\ude67.mov"} LL0 33[ '!}frost2024/03/23 23:09:072026/07/22 16:14:13AS19a30S2fe00S15a1aS2fe00S21404S21100S27106M531x521S15a1a477x479S19a30470x488S21100500x494S27106516x481noun an underground electric railroad.
      proper noun an American fast-food chain that primarily sells submarine sandwiches.Adam Frost{"video":"dominance: right;\\n\ud8ce\uddf1\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8d9\udf85\ud8d9\ude61\ud8e2\ude67.mov"} hh 33[ o!}frost2024/03/23 23:15:362026/05/06 18:38:59AS14c51S2fe00S2035aS2fe00S20e00S22f00S18551M519x532S2035a481x512S14c51492x506S22f00490x490S18551490x469proper noun a country that occupies the eastern part of the Scandinavian peninsula; capital, Stockholm.
      adjective relating to Sweden, its people, or their language.
      noun
      1. a native or inhabitant of Sweden, or a person of Swedish descent.
      2. the North Germanic language of Sweden, also spoken in parts of Finland.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd2\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udd41\ud8dc\udda1\ud8cc\ude32.mov"} ||! 33) =!kfrost2024/03/24 18:40:412026/05/06 02:23:29AS1f720S2fe00S10006S11a20S14020M515x542S1f720/ 33) !}frost2024/03/24 18:38:582026/05/06 02:23:17AS1f720S2fe00S10006S1dc20S1f720M512x534S1f720492x466S1dc20488x485S1f720492x519proper noun a state in the southeastern US, on the Gulf of Mexico; capital, Montgomery.
      adjective relating to or characteristic of the US state of Alabama or its inhabitants: Alabamian cuisine | [person implied] : a lifelong Alabamian.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8d4\udea1\ud8d7\udcc1.mov"}offlrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|bdfijk l m n o rstuvwxz{|~ ! " # $ %'()*+,-.123456!9":#;$<%=&>(@)A*B+C,D-E.F/G0H1I2J3K4L5M6N7O8P9Q:R;S<T>U@XAYBZC[D\E]F^G_H`IaKcLdNeOgQhRiSjUkWmYoZp\q]r^s_t`uavbwcxdyezf{g|h}i~kln?3S15a00494x513S24b04490x544adjective
      1. of poor quality or a low standard: a bad diet | bad eyesight.
        • (of a person) not able to do a particular thing well: I'm so bad at names | a bad listener.
        • not appropriate in a particular situation: morning was a bad time to ask Andy about anything.
      2. not such as to be hoped for or desired; unpleasant or unwelcome: bad weather | we had bad luck.
        • (of something causing pain, danger, or other unwelcome consequences) severe or serious: bad headaches | a bad crash | a bad mistake.
        • unfavorable; adverse: bad reviews.
        • (bad for) having a harmful effect on: soap was bad for his face.
      3. failing to conform to standards of moral virtue or acceptable conduct: the bad guys | bad behavior.
      4. (of a part of the body) injured, diseased, or painful: a bad back.
        • [as complement] (of a person) unwell: I tr 9" 33O -!frost2024/03/24 18:42:022026/05/06 02:23:48AS16d20S2fe00S10006S17620S1dc20S17620M512x547S16d20495x453S17620496x477S1dc20488x497S17620496x531proper noun a state in the central US; capital, Denver.
          adjective relating to or characteristic of the US state of Colorado or its inhabitants: Coloradan geological and natural features | [person implied] : this Coloradan has a promising future.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8ca\udd01\ud8fc\udc61\u00d8\ud8cb\udc61\ud8d4\udea1\ud8cb\udc61.mov"} J# 33) !}frost2024/03/24 18:43:432026/05/06 02:24:14AS10120S2fe00S10006S14a20S1dc20M513x542S10120497x459S14a20497x493S1dc20488x512proper noun a state of the US on the coast of the Atlantic Ocean; capital, Dover.
          adjective relating to or characteristic of the US state of Delaware or its inhabitants: farming is still a bedrock of rural Delawarean identity | [person implied] : we want every Delawarean to be ready and safe.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c0\udc81\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8d4\udea1.mov"} #$ 33u Q!frost2024/03/24 18:45:002026/05/04 03:07:20AS16d20S2fe00S10006S17620S11920S10120S17620M511x562S16d20494x438S17620495x462S11920489x482S10120495x512S17620495x546noun a building or complex of buildings containing a number of individually owned apartments or houses.
          • each of the individual apartments or houses in a condominium complex: a high-rise condo.
          Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8ca\udd01\ud8fc\udc61\u00d8\ud8cb\udc61\ud8c2\udd81\ud8c0\udc81\ud8cb\udc61.mov"} % 33 Y!efrost2024/03/24 18:46:072026/05/05 16:57:59AS10120S2fe00S10006S1fb20M508x527S10120492x474S1fb20493x508noun the central area or main business and commercial area of a town or city: the heart of Pittsburgh's downtown.
          adjective of, in, or characteristic of the central area or main business and commercial area of a town or city: downtown Chicago | a downtown bar.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c0\udc81\ud8fc\udc61\u00d8\ud8d7\ude41.mov"} .& 33) U!}frost2024/03/24 18:50:372026/05/06 02:24:04AS1ce20S2fe00S10006S1dc20S1f720M515x542S1ce20493x459S1dc20485x493S1f720489x527proper noun a state forming a peninsula of the southeastern US; capital, Tallahassee.
          adjective relating to or characteristic of the US state of Florida or its inhabitants: a famous Floridian businessman | [person implied] : it made me very proud to be a Floridian.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8d3\udd61\ud8fc\udc61\u00d8\ud8d4\udea1\ud8d7\udcc1.mov"} _(33)7!ofrost2024/03/24 18:54:172026/09/27 18:31:24AS1f000S2fe00S10006S19a20S18d20M518x534S1f000_' 33 u!efrost2024/03/24 18:52:242026/05/06 02:24:25AS1f000S2fe00S10006S1f720M515x517S1f000486x483S1f720495x502proper noun a state in the southeastern US, on the coast of the Atlantic Ocean; capital, Atlanta.
          adjective relating to the US state of Georgia: Georgia peaches | [person implied] : many Georgians live in rural areas.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8d6\ude01\ud8fc\udc61\u00d8\ud8d7\udcc1.mov"}ied medication but felt bad the next morning.
      5. (of food) decayed; putrid: everything in the fridge went bad.
        • (of the atmosphere) polluted; unhealthy: bad air.
      6. [as complement] regretful, guilty, or ashamed about something: she feels bad about ending their engagement | I feel bad that our business is benefiting from something so horrible.
      7. worthless; not valid: he ran up 87 bad checks.
      adverb
      1. in an unsatisfactory, inadequate, or unsuccessful way: the war was going badly | a badly managed company.
        • in an unfavorable way: try not to think badly of me.
        • in an unacceptable or unpleasant way: she realized she was behaving rather badly.
      2. to a great or serious degree; severely: the building was badly damaged by fire | I wanted a baby so badly.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc1\ud8f0\udc05\u00d8\ud8df\udc25.mov"} kk) 33 Y!efrost2024/03/24 18:58:172026/05/07 17:08:16AS11502S2fe00S10006S14020M515x525S11502485x476S14020486x495proper noun
        1. a special administrative region on the southeastern coast of China, a British dependency until 1997; capital, Victoria
        2. (1880–1968), a US writer, social reformer, and academic; full name Helen Adams Keller. Blind and deaf from an early age, she learned how to read, type, and speak with the help of her tutor, Anne Sullivan (1866–1936).
        adjective relating to Hong Kong or its inhabitants: a group of Hong Kongese businessmen.
        noun a native or inhabitant of Hong Kong: I am a Hong Kongese who has lived in the United States for ten years | more than 740,000 Hongkongers visited Japan last year.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c1\udfe3\ud8fc\udc61\u00d8\ud8c6\udc21.mov"} z* 33 +!efrost2024/03/24 19:12:542026/05/06 02:24:36AS14020S2fe00S10006S19a20M518x527S14020483x473S19a20490x507proper noun a state in the southeastern US; capital, Frankfort.
        adjective relating to or characteristic of the US state of Kentucky or its inhabitants: a Kentuckian airline pilot | [person implied] : a Kentuckian who grew up going to the Derby.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c6\udc21\ud8fc\udc61\u00d8\ud8ce\udde1.mov"} XK+ 33 M!efrost2024/03/24 19:16:272026/05/06 01:48:41AS1dc20S2fe00S10006S1f720M512x525S1dc20488x476S1f720492x510proper noun
        1. a state in the southern US, on the Gulf of Mexico; capital, Baton Rouge.
        2. a city on the Pacific coast of southern California.
        adjective
        1. relating to or characteristic of the US state of Louisiana or its inhabitants: Louisianan soul food | [person implied] : a Louisianan who had been loyal to the Southern cause.
        2. relating to or characteristic of the US city of Los Angeles or its inhabitants: LA sports fans | [person implied] : the council's handling of the process was met with criticism from many Angelenos |.
        Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8d7\udcc1.mov"} aa, 33O !frost2024/03/24 19:17:422026/05/04 03:07:58AS1dc20S2fe00S10006S1f720S14020S14a20M515x551S1dc20491x449S1f720495x483S14020486x502S14a20500x536noun a large body of water surrounded by land: boys were swimming in the lake | [in names] : Lake Superior.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8c6\udc21\ud8c6\udfe1.mov"} ==Dž?- 33O G!frost2024/03/24 19:19:112026/05/04 03:08:14AS1dc20S2fe00S10006S17620S1ce20S1fb20M515x554S1dc20485x447S17620493x481S1ce20493x501S1fb20494x535noun a room or space directly under the roof of a house or other building, which may be used for accommodations or storage: the best way to prevent this heat loss is by insulating the loft | [as modifier] : loft conversions.
        • a gallery in a church or hall: a choir loft.
        • a large, open area over a shop, warehouse, or factory, sometimes converted into living space.
        Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8cb\udc61\ud8d3\udd61\ud8d7\ude41.mov"} . 33 q!efrost2024/03/24 19:21:412026/05/06 02:32:11AS18d10S2fe00S10006S17620M510x523S18d10490x478S17620494x507proper noun a state in the central US, bounded on the east by the Mississippi River; capital, Jefferson City.
        adjective relating to or characteristic of the US state of Missouri or its inhabitants: the Missourian newspaper | [person implied] : his mother was a lively Missourian.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8cd\udcf1\ud8fc\udc61\u00d8\ud8cb\udc61.mov"} #/ 33 }!efrost2024/03/24 19:24:582026/05/06 02:33:16AS11920S2fe00S10006S16d20M511x525S11920489x475S16d20494x505proper noun a state in the eastern central US, on the coast of the Atlantic Ocean; capital, Raleigh.
        adjective relating to or characteristic of the US state of North Carolina or its inhabitants: a North Carolinian news anchor | [person implied] : the only North Carolinian on the team.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c2\udd81\ud8fc\udc61\u00d8\ud8ca\udd01.mov"} $0 33 !efrost2024/03/24 19:27:122026/05/06 02:37:42AS11920S2fe00S10006S10120M511x530S11920489x470S10120495x500proper noun a state in the northern central US, on the border with Canada; capital, Bismarck.
        adjective relating to or characteristic of the US state of North Dakota or its inhabitants: a rural North Dakotan town | [person implied] : a North Dakotan with a high tolerance for paperwork.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c2\udd81\ud8fc\udc61\u00d8\ud8c0\udc81.mov"}  1 33 Q!efrost2024/03/24 19:30:382026/05/06 03:03:49AS11920S2fe00S10006S11502M515x523S11920494x478S11502485x508proper noun a state in the northeastern US, on the coast of the Atlantic Ocean; capital, Concord.
        adjective relating to or characteristic of the US state of New Hampshire or its inhabitants: New Hampshire politics | [person implied] : a committed New Hampshirite.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c2\udd81\ud8fc\udc61\u00d8\ud8c1\udfe3.mov"} .2 33) U!}frost2024/03/24 19:32:312026/05/06 03:03:38AS11920S2fe00S10006S19220S2a20cM519x533S11920492x468S19220498x514S2a20c482x498proper noun a state in the northeastern US, on the coast of the Atlantic Ocean; capital, Trenton.
        adjective relating to or characteristic of the US state of New Jersey or its inhabitants.: the New Jersey beaches | [person implied] : he is married to a New Jerseyan.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c2\udd81\ud8fc\udc61\u00d8\ud8cd\udee1\ud8e7\udccd.mov"} *3 33 !efrost2024/03/24 19:33:452026/05/06 03:03:25AS11920S2fe00S10006S18d20M511x528S11920490x473S18d20491x503proper noun a state in the southwestern US, on the border with Mexico; capital, Santa Fe.
        adjective relating to or characteristic of the US state of New Mexico or its inhabitants: all the primary dishes in New Mexican cuisine contain chilies | [person implied] : I was a southern New Mexican.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c2\udd81\ud8fc\udc61\u00d8\ud8cd\udd01.mov"} 04 33u k!frost2024/03/24 19:35:092026/05/04 03:34:41AS17620S2fe00S10006S16d20S14a20S1f720S11920M511x554S17620495x446S16d20494x466S14a20496x490S1f720491x509S11920490x528noun a very large expanse of sea, in particular each of the main areas into which the sea is divided geographically: the Atlantic Ocean.
        • (usually the ocean) the sea: [as modifier] : the ocean floor.
        Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cb\udc61\ud8fc\udc61\u00d8\ud8ca\udd01\ud8c6\udfe1\ud8d7\udcc1\ud8c2\udd81.mov"} -5 33O #!frost2024/03/24 19:37:042026/05/06 03:03:15AS17620S2fe00S10006S11502S19220S17620M518x539S17620496x461S11502482x481S19220497x500S17620496x523proper noun a state in the northeastern US, bordering on Lake Erie; capital, Columbus.
        adjective relating to or characteristic of the US state of Ohio or its inhabitants: the Ohioan electorate | [person implied] : an Ohioan living in Paris.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cb\udc61\ud8fc\udc61\u00d8\ud8c1\udfe3\ud8cd\udee1\ud8cb\udc61.mov"}   r6 33 !efrost2024/03/24 19:38:422026/05/06 16:19:47AS14051S2fe00S10006S1f720M516x522S14051485x479S1f720493x507proper noun a state in the northeastern US; capital, Harrisburg.
        adjective relating to or characteristic of the US state of Pennsylvania or its inhabitants: Pennsylvania farms | [person implied] : Pennsylvanians have strong Dutch roots.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c6\udc52\ud8fc\udc61\u00d8\ud8d7\udcc1.mov"} [S7 33 ]!efrost2024/03/24 19:41:082026/05/05 17:02:14AS14051S2fe00S10006S11a20M516x529S14051485x471S11a20498x499noun
        1. an island of the Greater Antilles in the Caribbean; capital, San Juan.
        2. the professional maintenance of a favorable public image by a company or other organization or a famous person: public relations is often looked down on by the media | [as modifier] : a public relations officer | a public relations exercise.
        Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c6\udc52\ud8fc\udc61\u00d8\ud8c2\udde1.mov"} {8 33u !frost2024/03/24 19:42:042026/05/04 03:51:58AS11a20S2fe00S10006S19220S10e20S14a20S11a20M511x570S11a20490x430S19220490x464S10e20490x487S14a20490x521S11a20490x540noun a large natural stream of water flowing in a channel to the sea, a lake, or another such stream: the River Danube | the Mekong River | [as modifier] : river pollution.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c2\udde1\ud8fc\udc61\u00d8\ud8cd\udee1\ud8c1\udd61\ud8c6\udfe1\ud8c2\udde1.mov"} {9 33 i!)frost2024/03/24 19:44:212026/05/06 03:03:02AS11a20S2fe00S10006S19220M511x527S11a20490x474S19220490x508proper noun a state in the northeastern US, on the coast of the Atlantic Ocean; capital, Providence.
        adjective relating to or characteristic of the US state of Rhode Island or its inhabitants: Rhode Island seafood | [person implied] : Rhode Islanders bask in the summer heat.Adam Frost{"video":"dominance: right;\\n\ud8c2\udde1\ud8fc\udc61\u00d8\ud8cd\udee1.mov"} U: 33 a!efrost2024/03/24 19:45:422026/05/06 03:02:51AS20320S2fe00S10006S16d20M509x520S20320493x481S16d20492x500proper noun a state of the southeastern US on the coast of the Atlantic Ocean; capital, Columbia.
        adjective relating to or characteristic of the US state of South Carolina or its inhabitants: the airline launched direct flights to the South Carolinian city | [person implied] : the soft-spoken South Carolinian impressed his teammates.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8ca\udd01.mov"} 8; 33O 9!frost2024/03/24 19:46:552026/05/06 03:02:40AS11520S2fe00S10006S1fb20S1f720S11502M515x546S11520500x455S1fb20500x489S1f720495x512S11502485x531proper noun a state in the western US; capital, Salt Lake City.
        adjective relating to or characteristic of Utah or its inhabitants: this movie deals with uniquely Utahn themes | [person implied] : Utahns are used to snow—they practically relish it.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c2\udc01\ud8fc\udc61\u00d8\ud8d7\ude41\ud8d7\udcc1\ud8c1\udfe3.mov"} < 33 A!efrost2024/03/24 19:49:492026/05/06 03:02:22AS10e20S2fe00S10006S1f720M510x525S10e20495x476S1f720490x510proper noun a state of the eastern US, on the coast of the Atlantic Ocean; capital, Richmond.
        adjective relating to or characteristic of the US state of Virginia or its inhabitants: a Virginian family | [person implied] : a Virginian who did social work.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c1\udd61\ud8fc\udc61\u00d8\ud8d7\udcc1.mov"} (r(E> 33] =!frost2024/03/24 20:07:282026/02/10 18:59:35AS1ce10S2fe00S10006M511x515S1ce10489x485exclamation used to affirm that a situation, action, or state is satisfactory or acceptable: “Does this look right to you?” "Perfect."Adam Frost{"video":"dominance: right;\\n\ud8d3\udd51\ud8fc\udc61\u00d8.mov"} = 33g 3!frost2024/03/24 19:57:572026/05/09 00:02:29AS18720S2fe00S10006S26506S10e20S2fe00S10006S1f720M520x541S18720484x460S26506505x473S10e20486x492S1f720481x526proper noun a state of the eastern US; capital, Charleston.
        adjective relating to or characteristic of the US state of West Virginia or its inhabitants: the West Virginian wilderness | [person implied] : a West Virginian holding a doctorate degree.Adam Frost{"video":"dominance: right;\\nletter: integrated (for West);\\nfingerspelled: abbreviated (for Virginia);\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8e1\udde7\ud8c1\udd61\ud8fc\udc61\u00d8\ud8d7\udcc1.mov"} JW@ 33 !)frost2024/03/24 20:11:352026/05/19 04:26:13AS15a00S30004S10006S24b04M518x570S2ff00482x4882? 33] !frost2024/03/24 20:09:172026/02/10 19:20:11AS1f540S2fe00S10006M508x512S1f540493x488adjective describing a positive state of satisfaction, comfort, or well-being: after my morning workout, I feel good.
        exclamation used to express approval or a positive evaluation of something: "We're ready to go." "Ok, great."Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\u00d8.mov"} plans to build a bypass.
      3. Computing to compile (a program, database, index, etc.): you can build database applications without writing any code.
      4. to make stronger or more intense: we built up confidence in our abilities.
        • to establish and develop (a business or situation) over a period of time: they need to build a strong relationship with journal users | people scrimp and save to build a better life for their children.
      noun
      1. a structure with a roof and walls, such as a house, school, store, or factory.
      2. the process or business of constructing something: the building of highways | [as modifier] : building materials.

      PHONOLOGICAL VARIANTS
      build with flat handsAdam Frost{"video":"dominance: right;\\n\ud8c1\udff3\ud8fc\udc61\ud8c1\udffb\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8dd\udc45\ud8dd\udc51.mov"}3S10010492x461S20600511x474proper noun a country in central Europe, on the Baltic Sea in the north; capital, Berli.
      adjective relating to Germany, its people, or their language: a German couple from the city of Hamburg | a German beer festival | the author of the book is German.
      • having characteristics of or attributed to Germans or Germany: she had an almost Germanic regard for order.
      noun
      1. a native or inhabitant of Germany, or a person of German descent: he had four sisters who were all married to Germans.
      2. a West Germanic language used in Germany, Austria, and parts of Switzerland, and by communities in the US and elsewhere: a richly illustrated catalog, available in German and English, accompanies the exhibition.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc11\ud8f0\udc01\u00d8\ud8d8\ude41.mov"} 11KA 335 '!Yfrost2024/03/24 20:15:052026/02/13 19:12:43AS15a01S38611S10006S21410S21100S2e500M518x529S37602496x472S15a01491x500S21100483x515noun
      1. a nation with its own government, occupying a particular territory: the country's increasingly precarious economic position.
        • (the country) the people of a nation: the whole country took to the streets.
      2. (often the country) districts and small settlements outside large towns, cities, or the capital: the airfield is right out in the country | [as modifier] : a country lane.
      3. short for country music.
      4. a political and administrative division of a state, providing certain local governmental services.
      adjective in, relating to, or characteristic of the countryside rather than the town: remote rural areas.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc2\ud8fc\ude52\u00d8\ud8d9\udf91\ud8d9\ude61\ud8ed\udde1.mov"} uB 335 {!Yfrost2024/03/24 20:17:482026/02/13 19:19:08AS19a01S38611S10006S21410S21100S2e500M521x527S37602499x473S19a01480x494S21100481x513noun a nation with its own government, occupying a particular territory: the country's increasingly precarious economic position.
      • (the country) the people of a nation: the whole country took to the streets.
      Adam Frost{"video":"dominance: right;\\n\ud8ce\uddc2\ud8fc\ude52\u00d8\ud8d9\udf91\ud8d9\ude61\ud8ed\udde1.mov"} hhC 33O s!frost2024/03/27 17:52:062026/05/09 00:03:05AS1f721S30007S10006S2880cS30005S14c27M544x537S2ff00482x483S1f721514x471S2880c532x488S14c27507x510proper noun the largest state of the US, in the extreme northwest of North America, with coasts on the Arctic and North Pacific Oceans and on the Bering Sea; capital, Juneau.
      adjective relating to or characteristic of the US state of Alaska: he loved the unique Alaskan scenery | [person implied] : Alaskans are incredibly proud of their state.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d7\udcc2\ud8f0\udc08\u00d8\ud8e4\udf0d\ud8f0\udc06\ud8c7\udca8.mov"} TKD 335 o!frost2024/03/27 17:54:132026/06/01 01:43:56AS16d20S2fe00S2031aS2fe00S21400S20600M520x519S16d20480x482S2031a481x504S20600498x497noun a building used for public Christian worship: they came to church with me.
      • (Church) a particular Christian organization, typically one with its own clergy, buildings, and distinctive doctrines: the Church of England.
      • (the Church) the hierarchy of clergy of a Christian organization, especially the Roman Catholic Church or the Church of England: Isobel would enter the Church as a deacon.
      • institutionalized religion as a political or social force: the separation of church and state.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udd01\ud8fc\udc61\ud8d8\udd3b\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} ss E 33 k!)frost2024/03/27 17:56:472026/05/06 18:40:54AS1f702S38517S10006S20600M528x522S36d00479x478S1f702509x488S20600506x511proper noun a country in northern North America, the second largest country in the world; capital, Ottawa.
      adjective relating to or characteristic of Canada or its inhabitants: the Canadian government's economic policies | a culture that is distinctly Canadian.
      noun a native or inhabitant of Canada: a 27-year-old Canadian from Ontario | more than four million Canadians play hockey.Adam Frost{"video":"dominance: right;\\n\ud8d7\udca3\ud8fc\uddf8\u00d8\ud8d8\ude41.mov"} F 33A ?!Mfrost2024/03/27 17:57:402026/05/09 00:03:21AS16d10S30005S10006S20e00S22a04S26502S30003S20e00S22a04M520x565S2ff00482x483S16d10503x507S20e00484x531S22a04483x550S26502493x540S20e00506x531S22a04506x550noun a restaurant or dining room in a school or a business in which customers serve themselves or are served from a counter and pay before eating.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udcf1\ud8f0\udc06\u00d8\ud8d9\udd41\ud8db\udfc5\ud8e1\udde3\ud8f0\udc04\ud8d9\udd41\ud8db\udfc5.mov"} 2G 33 !Qfrost2024/03/27 18:05:032026/05/09 00:04:47AS16d10S2fe00S16d18S2fe00S38006S2df06S2df1eS15a40S2fe00S15a48S2fe00S38005S26902S26916M524x553S16d10506x476S16d18479x476S2df06503x448S2df1e479x448S15a40512x526S15a48476x501S26902491x534S26916491x509noun a room, typically in a school, in which a class of students is taught: during a forum the classroom is arranged into groups of five to six students | I believe my production experience is invaluable in the classroom | [as modifier] : newer programs often combine classroom learning with hands-on field trips.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udcf1\ud8fc\udc61\ud8ca\udcf9\ud8fc\udc61\ud8fc\udc07\ud8ec\udfa7\ud8ec\udfbf\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc06\ud8e1\udf63\ud8e1\udf77.mov"} }H 33k!7frost2024/03/27 18:08:502026/05/23 17:55:09AS15a11S2fe00S15a19S2fe00S21406S20e00S27100S27114M549x520S15a11502x497S15a19477x497S20e00495x483S27100509x480S27114452x480M524x518S15a11501x495S15a19476x495S20600489x482noun a phonological variant (alternating movement) of town.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c8\uddd2\ud8fc\udc61\ud8c8\uddda\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8e2\ude61\ud8e2\ude75.mov"} I 33g Y!frost2024/03/27 18:11:392026/05/23 18:00:31AS15a11S2fe00S15a19S2fe00S21406S20500S2e106S2e112M524x536S15a11501x465S15a19476x465S2e106502x493S2e112476x491noun a group of houses and associated buildings.
      • a group of people living in the same place or having a particular characteristic in common: the Deaf community | Rhode Island's Japanese community.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8fc\udc61\ud8c8\uddda\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ed\udc67\ud8ed\udc73.mov"} '-'xK33W-!frost2024/03/29 16:20:472026/07/27 18:57:54AS11512S2fe00S1151aS2fe00S21400S20e00S23604S23610M548x522S11512494x478S1151a477x487S20e00494x507S23604509x505S23610452x505S38b00470x493 M548x520S15a12492x480S15a1a478x489S20e00494x505S23604509x503S23610452x503 S38b04470x493verb
      1. to construct (something) by putting parts or material together: the ironworks were built in 1736.
        • to commission, finance, and oversee the building of (something): the county councilVOJ 33 e!Ufrost2024/03/27 18:23:512026/05/13 23:59:11AS14710S2fe00S10006S2480cM509x527S14710492x473S2480c493x499proper noun the largest country in South America, in the east-central part of the continent, on the Atlantic Ocean; capital, Brasilia.
          adjective relating to Brazil.
          noun a native or inhabitant of Brazil.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udeb1\ud8fc\udc61\u00d8\ud8de\udf0d.mov"}482x483S1f010493x500S20e00508x518S22f04501x533proper noun a country in southeastern Europe; capital, Athens.
          adjective relating to Greece, its people, or their language: they sailed around the Greek islands | Zoe is a first name of Greek origin.
          noun
          1. a native or inhabitant of modern Greece, or a person of Greek descent: the subject is an emotional one for many Greeks.
          2. a Greek-speaking person in the ancient world, especially a native of one of the city states of Greece and the eastern Mediterranean: the Greeks defeated the Persians under Darius at the Battle of Marathon | visitors will have a glimpse into the daily lives of ancient Greeks.
          3. the ancient or modern language of Greece.
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d6\ude11\ud8f4\udec1\u00d8\ud8d9\udd41\ud8dc\udda5.mov"} siL 33 +!)frost2024/03/29 16:30:102026/05/06 18:43:22AS11e02S38511S10006S2990aM527x516S36d00479x484S11e02462x493S2990a495x502proper noun a country in northwestern Europe, on the Jutland peninsula and many islands, between the North and the Baltic seas; capital, Copenhagen.
          adjective relating to Denmark or its people or language: the series was critically acclaimed as one of the best Danish dramas | the chair is made of Danish timbers such as oak, ash, or walnut.
          noun
          1. a native or inhabitant of Denmark, or a person of Danish descent: the site was occupied by the Danish | the boys are hoping for a win against the Danish.
          2. the North Germanic language of Denmark: all the narration is in Danish.
          Adam Frost{"video":"dominance: right;\\n\ud8c2\udf43\ud8fc\uddf2\u00d8\ud8e6\udd6b.mov"} zN 33O 5!Yfrost2024/03/29 16:45:132026/05/07 16:58:50AS15a21S30007S10006S20500S2d207S20500M551x528S2ff00482x483S15a21510x487S2d207528x509S20600506x472proper noun, adjective, noun dated relating to or associated with Australia.Adam Frost{"video":"dominance: right;\\n\ud8c8\udde2\ud8f0\udc08\u00d8\ud8d8\udde1\ud8eb\udec8\ud8d8\udde1.mov"}M 33 1!Ufrost2024/03/29 16:32:062026/05/09 00:05:05AS10110S30007S10006S2e300M542x526S2ff00482x483S10110519x468S2e300519x499proper noun, adjective, noun dated relating to or associated with Denmark.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c0\udc71\ud8f0\udc08\u00d8\ud8ed\udd21.mov"} O 33g Y!frost2024/03/29 16:51:262026/05/06 03:44:08AS11011S2fe00S11019S2fe00S21414S20500S21800S21800M530x519S11019498x493S11011474x493S21800470x482S21800512x482proper noun a republic in central Europe; capital, Vienna.
          adjective relating to or characteristic of Austria or its people.
          noun a native or inhabitant of Austria, or a person of Austrian descent.Adam Frost{"video":"dominance: right;\\n\ud8c1\ude12\ud8fc\udc61\ud8c1\ude1a\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1\ud8da\udd01\ud8da\udd01.mov"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx \\ Q 33O !Yfrost2024/03/29 17:01:232026/05/07 16:25:00AS15a22S30000S10006S20500S2d201S20500M551x518S2ff00482x483S15a22495x482S20600492x469S2d201525x475proper noun, adjective, noun relating to or associated with Cuba.Adam Frost{"video":"dominance: right;\\n\ud8c8\udde3\ud8f0\udc01\u00d8\ud8d8\udde1\ud8eb\udec2\ud8d8\udde1.mov"}P 33# _!=frost2024/03/29 16:56:452026/05/29 22:00:29AS15a40S2fe00S15a48S2fe00S21406S20500S2a208S2a210S18521S2fe00S18529S2fe00S38006S2d300S2d311M543x548S15a40500x469S15a48487x469S2a208512x453S2a210465x453S18521510x529S18529464x529S2d300504x502S2d311458x502noun a store where books are sold.Adam Frost{"video":"dominance: equal;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e7\udcc9\ud8e7\udcd1\ud8cc\ude02\ud8fc\udc61\ud8cc\ude0a\ud8fc\udc61\ud8fc\udc07\ud8eb\udf21\ud8eb\udf32.mov"} !![R 33? E!Qfrost2024/03/29 17:16:552026/02/11 00:17:42AS18507S33d00S10006S20500S15a40S2fe00S15a48S2fe00S38005S26902S26916M524x586S33b00482x483S18507502x510S15a40512x559S15a48476x534S26902491x567S26916491x542noun a room in which meals are eaten: we need more chairs in the dining room | [as modifier] : a dining-room table.
          • a room in a house in which means are eaten: mom set the table in the dining room.
          • a room in a public eating space: the main building has a dining room, kitchen, and TV lounge.
          Adam Frost{"video":"dominance: right;\\n\ud8cc\udde8\ud8f5\udee1\u00d8\ud8d8\udde1\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc06\ud8e1\udf63\ud8e1\udf77.mov"} vS 33 E!)frost2024/03/29 17:20:212026/05/06 18:46:14AS10620S30000S10006S20600M534x518S2ff00482x483S10620487x465S20600512x474proper noun a country in northeastern Africa, on the Mediterranean Sea; capital, Cairo.
          adjective relating to Egypt or its people.
          • relating to the culture or language of ancient Egypt: an Egyptian obelisk.
          noun
          1. a native of ancient or modern Egypt, or a person of Egyptian descent.
          2. the Afro-Asiatic language used in ancient Egypt.
          Adam Frost{"video":"dominance: right;\\n\ud8c0\ude61\ud8f0\udc01\u00d8\ud8d8\ude41.mov"} D3U 33 o!frost2024/03/29 18:26:032026/05/03 22:01:08AS10001S30005S10009S30003S20500S20500S2bd07S2bd12M547x540S2ff00482x483S10001506x510S10009474x510S2bd07519x502S2bd12454x502adjective known about by many people: the country is famous for its natural beauty | a famous star.Adam Frost{"video":"dominance: equal;\\n\ud8c0\udc02\ud8f0\udc06\ud8c0\udc0a\ud8f0\udc04\ud8d8\udde1\ud8d8\udde1\ud8e9\udee8\ud8e9\udef3.mov"}8T 33g !frost2024/03/29 17:22:172026/05/06 18:46:27AS15a11S2fe00S15a19S2fe00S21406S20500S22f05S22f13M537x518S15a11501x482S15a19476x482S22f13464x497S22f05516x497proper noun, adjective, noun relating to or associated with Egypt.Adam Frost{"video":"dominance: equal;\\n\ud8c8\uddd2\ud8fc\udc61\ud8c8\uddda\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8dc\udda6\ud8dc\uddb4.mov"} NNwzW 33 M!)frost2024/03/29 19:32:472026/05/06 18:47:59AS10010S30000S10006S20600M533x518S2ff00482x48W?V33s!frost2024/03/29 18:27:552026/08/13 05:27:32AS14452S2fe00S1445aS2fe00S21414S20e00S26a02S26a16M526x533S14452474x482S1445a495x467S20e00494x513S26a02477x506S26a16509x506M532x535S14450503x484S1445c486x504S20e00493x472S26a00505x465S26a14469x479noun a multi-lane divided highway, especially one with controlled access: the crash led to all lanes of the freeway being closed for over an hour.
          • a divided four-lane road or highway.
          • [to left and right loci] a freeway, especially with left-hand traffic.

          SIGN VARIATIONS
          freeway (right-hand traffic)Adam Frost{"video":"dominance: right;\\n\ud8c6\uddd3\ud8fc\udc61\ud8c6\udddb\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8e1\udfc3\ud8e1\udfd7.mov"}34x511S14720501x489S14728485x489S26506519x495S26512466x495noun
          1. a continuous vertical structure that encloses or divides an area of land: a garden wall | farmland traversed by drystone walls.
            • a side of a building or room, typically forming part of the building's structure: a bedroom wall.
            • any high vertical surface, especially one that is imposing in scale: the eastern wall of the valley.
          2. a door drawn across an aperture on a groove or suspended from a track, rather than turning on hinges: the master bedroom has sliding doors to a sun terrace.
          verb to separate a vertical surface into two parts by moving them apart: the elevator doors opened.
          affix used to represent the location of a continuous vertical surface: he wants to build the fence here.Adam Frost{"video":"dominance: equal;\\n\ud8c6\udec1\ud8fc\udc61\ud8c6\udec9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\udde7\ud8e1\uddf3.mov"} 5mY 33C I!mfrost2024/03/29 19:39:132026/05/09 00:05:34AS1f010S33200S10006S20e00S22f04M526x547S33100bGX 33 !frost2024/03/29 19:35:212026/05/06 18:48:27AS14c41S2fe00S14c49S2fe00S21400S20700S22511S22517M531x530S14c49494x503S14c41481x482S20700475x505S22517513x493S22511469x471proper noun, adjective, noun relating to or associated with Germany.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcc2\ud8fc\udc61\ud8c7\udcca\ud8fc\udc61\ud8d9\udf81\ud8d8\udea1\ud8db\uddf2\ud8db\uddf8.mov"}479x501S18702510x505S2bd00517x477proper noun
          1. a state of the northwestern US, on the coast of the Pacific Ocean; capital, Olympia.
          2. (also Washington, D.C.) the capital of the US.
            • used in reference to the US government: they warned of serious consequences if Washington said no.
          3. (1732–99), 1st president of the US 1789–97.
          adjective
          1. relating to or characteristic of the US state of Washington or its inhabitants: the Washingtonian forests | [person implied] : Washingtonians enjoy all four seasons in a moderate climate.
          2. relating to or characteristic of the US capital city of Washington or its inhabitants: Washingtonian memoirs | [person implied] : a well-connected Washingtonian.
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cc\udea3\ud8fc\udde8\u00d8\ud8d8\udde1\ud8e9\udee1.mov"} eeZ 33 !frost2024/03/29 19:46:212026/07/27 20:50:20AS14c11S38517S14c19S38511S20600S20600S27104S27110M549x525S14c11503x498S14c19473x498S20600518x491S20600462x491S27104509x476S27110452x476noun a day of festivity or recreation when no work is done: December 25 is an official public holiday.
          • [as modifier] characteristic of a holiday; festive: a holiday atmosphere.
          proper noun
          1. a district in Los Angeles, the principal center of the US movie industry.
            • the US movie industry and the lifestyles of the people associated with it: he was never seduced by the glitz and money of Hollywood.
          2. a resort city in southeastern Florida, north of Miami, on the Atlantic Ocean.
          Adam Frost{"video":"dominance: right;\\n\ud8c7\udc92\ud8fc\uddf8\ud8c7\udc9a\ud8fc\uddf2\ud8d8\ude41\ud8d8\ude41\ud8e2\ude65\ud8e2\ude71.mov"} =~==\ 33C !Afrost2024/03/29 20:13:502026/05/07 16:15:41AS19a11S33200S10006S20e00S2c600M518x538S33100482x483S19a11472x500S20e00480x526S2c600457x511proper noun the western coastal provinces of the Netherlands.Adam Frost{"video":"dominance: right;\\n\ud8ce\uddd2\ud8f4\udec1\u00d8\ud8d9\udd41\ud8ea\ude41.mov"}~[ 33i %! frost2024/03/29 19:51:452026/07/23 20:01:18AS1ea11S38507S1ea19S38501S2ea30S2ea48M559x515S36d00479x511S1ea11514x489S1ea19458x489S2ea30544x485S2ea48441x485noun a gym.Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\\n\ud8d5\udfd2\ud8fc\udde8\ud8d5\udfda\ud8fc\udde2\ud8ed\udff1\ud8ee\udc09.mov"} }}] 33C m!mfrost2024/03/29 23:43:002026/05/09 00:05:48AS11502S38600S10006S20e00S23304M541x534S37606459x466S11502463x474S20e00496x475S23304511x471noun an institution providing medical and surgical treatment and nursing care for sick or injured people.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c1\udfe3\ud8fc\ude41\u00d8\ud8d9\udd41\ud8dc\udf25.mov"} OO-^33A#w!)frost2024/03/29 23:49:162026/05/23 18:04:27AS12d02S2fe00S10018S2fe00S21410S20500S22116M522x524S12d02486x478S10018507x494S22116478x477S38b00470x493 M522x524S11502486x486S10018507x494S22116478x477 S38b04470x493noun an establishment providing accommodations, meals, and other services for travelers and tourists: a five-star hotel | [as modifier] : a hotel room.

          PHONOLOGICAL VARIANTS
          hotel with thumb not extendedAdam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c4\udce3\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf91\ud8d8\udde1\ud8db\udc77.mov"} &&V_ 33Ak!)frost2024/03/29 23:50:482026/05/23 18:05:11AS11502S2fe00S10018S2fe00S21410S20500S22116M522x524S11502486x486S10018507x494S22116478x477M522x524S12d02486x478S10018507x494S22116478x477noun a phonological variant (thumb not extended) of hotel.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c1\udfe3\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf91\ud8d8\udde1\ud8db\udc77.mov"} xx` 335 !efrost2024/03/29 23:54:382026/05/07 04:26:58AS1f522S2fe00S15a39S2fe00S21400S20600M523x516S15a39500x493S1f522501x484S20600478x497proper noun a country in the Middle East, between the Caspian Sea and the Persian Gulf; capital, Tehran.
          adjective relating to Iran or its people.
          • relating to or denoting the group of Indo-European languages that includes Persian (Farsi), Pashto, Avestan, and Kurdish.
          noun a native or inhabitant of Iran, or a person of Iranian descent.Adam Frost{"video":"dominance: right;\\n\ud8d7\udc03\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} xla33i!efrost2024/03/29 23:58:332026/07/23 21:03:29AS11e40S2fe00S15a3aS2fe00S21400S20500M514x519S15a3a487x507S11e40490x482S38b00470x493 M512x519S11e40489x481S2f900491x514 S38b04470x493 M525x519S15a3a476x507S11e40479x482S20600503x501verb [with object] to bring (a vehicle that one is driving) to a halt and leave it temporarily, typically in a parking lot or by the side of the road: he parked his car outside her house | [no object ] : he couldn't find anywhere to park.

          PHONOLOGICAL VARIANTS
          park right-handed

          DERIVATIVES
          parking [frequentative]Adam Frost{"video":"dominance: right;\\n\ud8c2\udf81\ud8fc\udc61\ud8c8\uddfb\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1.mov"} __b 33A o!)frost2024/03/30 00:29:172026/06/01 02:38:16AS19240S2fe00S20356S2fe00S21400S21100S2ea32M516x518S20356485x494S19240486x482S21100503x504noun a piece of land surrounded by water: the island of Crete | [as modifier] : this island nation.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\udf01\ud8fc\udc61\ud8d8\udd77\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8ed\udff3.mov"} c 33A /!Mfrost2024/03/30 00:34:032026/05/09 00:06:31AS19210S30005S10006S20e00S22a04S26502S30003S20e00S22a04M521x567S2ff00482x483S19210500x511S20e00485x533S22a04484x552S26502494x542S20e00507x533S22a04507x552proper noun a country in the Middle East, on the Mediterranean Sea; capital (not recognized as such by the United Nations), Jerusalem.
          • the ancient land or kingdom of Israel.
          adjective relating to modern or ancient Israel, its people, language, or religion.
          noun a native or inhabitant of Israel in modern or ancient times, or a person of Israeli descent.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\uded1\ud8f0\udc06\u00d8\ud8d9\udd41\ud8db\udfc5\ud8e1\udde3\ud8f0\udc04\ud8d9\udd41\ud8db\udfc5.mov"} d 33i g!Yfrost2024/03/30 00:40:382026/05/07 16:51:55AS14c00S30004S10006S20e00S22f04S18507M518x596S2ff00482x483S14c00489x506S20e00495x539S22f04489x553S18507493x569noun
          1. a Semitic language used by the ancient Hebrews and in modern Israel.
          2. the monotheistic religion of the Jewish people.
          3. a member of the people and cultural community whose traditional religion is Judaism: Levin is a practicing Orthodox Jew | the king of Persia allowed the Jews to return to their homeland.
          proper noun, adjective, noun relating to or associated with Israel.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc81\ud8f0\udc05\u00d8\ud8d9\udd41\ud8dc\udda5\ud8cc\udde8.mov"} ==?e 33[ Q!qfrost2024/03/30 00:49:352026/05/07 15:29:19AS10e12S30000S10006S20500S2c600S20500S2c600M531x518S2ff00482x483S10e12497x487S2c600497x456S2c600512x456proper noun a country in southwestern North America, with extensive coastlines on the Gulf of Mexico and the Pacific Ocean, bordered by the US on the north; capital, Mexico City.
          adjective relating to Mexico or its people: authentic Mexican cuisine.
          noun a native or inhabitant of Mexico, or a person of Mexican descent: urban scenes depicting the daily life of Mexicans.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd53\ud8f0\udc01\u00d8\ud8d8\udde1\ud8ea\ude41\ud8d8\udde1\ud8ea\ude41.mov"} ss f 33 w!-frost2024/03/30 01:15:352026/05/14 00:18:57AS15a11S2fe00S15a18S2fe00S21406S20e00S23f02S18210S20500M533x522S15a18468x482S15a11479x479S20e00503x492S23f02505x501S18210481x505proper noun an island country in the South Pacific Ocean, east of Australia; capital, Wellington.
          adjective relating to New Zealand or its inhabitants.
          noun a native or inhabitant of New Zealand: a chance for the average New Zealander to feel part of the Olympic Games.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8dd\udfa3\ud8cc\udcd1\ud8d8\udde1.mov"} KK1g 335 g!efrost2024/03/30 01:23:052026/07/23 21:01:31AS11e40S2fe00S15a3aS2fe00S21400S20600M525x519S15a3a476x507S11e40479x482S20600503x501noun the action of parking a vehicle: parking on the street can be difficult | [as modifier] : a parking space.
          • space for leaving vehicles temporarily, typically in a parking lot or by the side of the road: problems including poor access, lack of privacy, and inadequate parking | a paved driveway provides parking for three cars.
          Adam Frost{"video":"dominance: right;\\n\ud8c2\udf81\ud8fc\udc61\ud8c8\uddfb\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} MEh 33[Q !}frost2024/03/30 01:33:392026/08/02 04:40:56AS18527S2fe00S1852fS2fe00S38006S2b700S2b711M525x526S18527506x499S1852f475x499S2b700504x475S2b711478x475M511x526S18527492x499S2b700490x475verb
          1. to bring into a particular state or condition: he is putting himself at risk.
          2. [center to front loci] a phonological variant (two handed) of put.
          Adam Frost{"video":"dominance: equal;\\n\ud8cc\ude08\ud8fc\udc61\ud8cc\ude10\ud8fc\udc61\ud8fc\udc07\ud8e9\udca1\ud8e9\udcb2.mov"} pi 33A q!Mfrost2024/03/30 01:35:442026/05/09 00:06:47AS11a00S30005S10006S20e00S22a04S26502S30003S20e00S22a04M518x574S2ff00482x483S11a00502x506S20e00482x540S22a04481x559S26502491x549S20e00504x540S22a04504x559noun a place where people pay to sit and eat meals that are cooked and served on the premises: in the past five years numerous cafes, restaurants, bars, and shops have opened | she stopped to have lunch in an Italian restaurant.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\uddc1\ud8f0\udc06\u00d8\ud8d9\udd41\ud8db\udfc5\ud8e1\udde3\ud8f0\udc04\ud8d9\udd41\ud8db\udfc5.mov"} Aik 33g u!frost2024/03/30 01:42:012026/07/29 18:28:01AS14720S2fe00S14728S2fe00S21406S20500S26506S26512M5l;j 33A 3!!frost2024/03/30 01:38:442026/04/23 21:47:27AS10000S30005S10006S20e00S22a04S26502S30003S20e00S22a04M518x574S2ff00482x483S10000496x506S20e00476x540S22a04475x559S26502485x549S20e00498x540S22a04498x559noun a restaurant.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8f0\udc06\u00d8\ud8d9\udd41\ud8db\udfc5\ud8e1\udde3\ud8f0\udc04\ud8d9\udd41\ud8db\udfc5.mov"}S2035a483x510S11051488x494S2e73a492x476proper noun an island of the British Isles, lying west of Great Britain.
          • relating to or associated with Ireland (proper noun).
          • relating to or associated with Northern Ireland (proper noun).
          adjective relating to Ireland, its people, or the Celtic language traditionally and historically spoken there: the Irish government | the traditional Irish folk music scene.
          noun
          1. a native or inhabitant of Ireland, or a person of Irish descent.
          2. the Celtic language that is the first official language of the Republic of Ireland.
          proper noun, adjective relating to or associated with Idaho.Adam Frost{"video":"dominance: right;\\n\ud8c1\ude52\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf81\ud8ed\udedb\ud8d8\udde1.mov"} qq l 33A K!)frost2024/03/30 01:58:352026/05/09 00:07:02AS14051S2fe00S2035aS2fe00S21400S2e736S20500M518x527S2035a483x512S14051487x490S2e736489x473noun the head of a school, college, or other educational institution: I was appointed principal of the new school.
          proper noun a country in Southeast Asia that consists of an archipelago of more than 7,000 islands that are separated from the Asian mainland by the South China Sea; capital, Manila.
          adjective relating to the Philippines, the Filipinos, or their language.
          noun
          1. a native or inhabitant of the Philippines, or a person of Filipino descent.
          2. the national language of the Philippines, a standardized form of Tagalog.
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc52\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf81\ud8ed\uded7\ud8d8\udde1.mov"} In 33g !Afrost2024/03/30 02:05:272026/05/09 00:07:31AS20320S2fe00S15a18S2fe00S21406S20500S22a04S20500M522x517S15a18479x487S20320492x483S22a04509x497S20500495x506noun an organized political community or area forming part of a federal republic: Texas is one of the 50 states.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d8\udd41\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8db\udfc5\ud8d8\udde1.mov"}m 33 q!Ufrost2024/03/30 02:00:452026/05/09 00:07:22AS17620S2fe00S10006S2e500M512x523S17620493x477S2e500489x496proper noun a state in the northwestern US, on the coast of the Pacific Ocean; capital, Salem.
          adjective relating to or characteristic of the US state of Oregon or its inhabitants: the Oregonian landscape | [person implied] : every Oregonian has a personal stake in this project.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cb\udc61\ud8fc\udc61\u00d8\ud8ed\udde1.mov"} [p 33 !)frost2024/03/30 02:10:132026/08/06 16:47:40AS2031cS2fe00S10006S23604M520x533S2031c493x498S37801499x467S23604481x516noun a portable container for carrying belongings or other items, especially by hand: his suitcase is in the trunk.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd3d\ud8fc\udc61\u00d8\ud8dd\udc45.mov"}zo 33 g!)frost2024/03/30 02:06:592026/05/06 03:08:28AS10620S2fe00S10006S23b04M522x518S10620479x482S23b04503x497proper noun a state in the southern US, on the border with Mexico, with a coastline on the Gulf of Mexico; capital, Austin.
          adjective relating to the state of Texas or its inhabitants: a Texan ranch | his Texan accent | [person implied] : the Texan threw his hat in the air.Adam Frost{"video":"dominance: right;\\n\ud8c0\ude61\ud8fc\udc61\u00d8\ud8dd\ude25.mov"} q 33C Y!Afrost2024/03/30 02:17:072026/05/07 15:35:44AS14402S38600S10006S20e00S23304M541x534S37606459x466S14402462x472S20e00496x475S23304511x471proper noun a country in northern Great Britain and the United Kingdom; capital, Edinburgh.
          adjective relating to Scotland or its people: the Scottish Highlands | Scottish dancing.
          noun a native or inhabitant of Scotland, or a person of Scottish descent.Adam Frost{"video":"dominance: right;\\n\ud8c6\udd83\ud8fc\ude41\u00d8\ud8d9\udd41\ud8dc\udf25.mov"} !![r 33M G!Afrost2024/03/30 02:30:252026/05/09 00:07:39AS14051S2fe00S2035aS2fe00S21400S20500S11a51S20500M522x527S2035a479x496S14051483x474S11a51495x501noun an island of the Greater Antilles in the Caribbean; capital, San Juan.
          • a native or inhabitant of the Caribbean island of Puerto Rico, or a person of Puerto Rican descent: the young Puerto Rican sees his boss as uncaring.
          adjective relating to or characteristic of the Caribbean island of Puerto Rico: his paintings are tied deeply to his Puerto Rican heritage.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc52\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8c2\ude12\ud8d8\udde1.mov"} tt 33[ )!)frost2024/03/30 02:44:562026/05/09 00:08:10AS11a40S2fe00S11a48S2fe00S38006S2dd06S2dd16M524x537S11a40509x507S11a48477x507S2dd06508x464S2dd16476x464noun a river.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\ude01\ud8fc\udc61\ud8c2\ude09\ud8fc\udc61\ud8fc\udc07\ud8ec\udee7\ud8ec\udef7.mov"}s 33[ +!)frost2024/03/30 02:39:292026/05/09 00:08:02AS17650S2fe00S17658S2fe00S38007S2c100S2c111M525x532S17650509x502S17658475x516S2c100499x469S2c111477x483noun an ocean.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cb\udc91\ud8fc\udc61\ud8cb\udc99\ud8fc\udc61\ud8fc\udc08\ud8ea\udc61\ud8ea\udc72.mov"} RR@v 33) !mfrost2024/03/30 02:52:102026/05/09 00:08:26AS18702S38507S10006S20500S2bd00M539x523S36d00n;u 33? Y!}frost2024/03/30 02:47:592026/05/09 00:08:18AS18710S30004S10006S20500S1ed40S2fe00S1ed48S2fe00S38006S2f900S2f900M530x574S2ff00482x483S18710491x513S1ed40504x547S1ed48471x547S2f900517x569S2f900472x569noun a body of water contained within distinct boundaries: the lake froze completely during the winter | she stepped into a puddle and soaked her shoes.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cc\udeb1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8d6\udd21\ud8fc\udc61\ud8d6\udd29\ud8fc\udc61\ud8fc\udc07\ud8ef\udd61\ud8ef\udd61.mov"}ong is the charging cable?.
        • (of a journey) covering a great distance: I went for a long walk.
      2. lasting or taking a great amount of time: a long and distinguished career | she took a long time to dress.
        • (after a noun of duration and in questions) lasting or taking a specified amount of time: the debates will be 90 minutes long.
      3. relatively great in extent: write a long report | a long list of candidates.
        • (after a noun of extent and in questions) having a specified extent: the statement was three pages long.
      adverb for a long time: we hadn't known them long enough.
      • in questions about a period of time: how long have you been working?.
      • at a time distant from a specified event or point of time: the work was compiled long after his death.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc51\ud8fc\ude71\u00d8\ud8d9\ude61\ud8e1\udde4.mov"} (( x 33C !mfrost2024/03/30 03:04:562026/05/09 00:10:04AS11511S30006S10006S20e00S22114M551x525S2ff00482x483S11511513x498S20e00531x495S22114525x488proper noun, adjective relating to or associated with Utah.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c1\udff2\ud8f0\udc07\u00d8\ud8d9\udd41\ud8db\udc75.mov"}Ew 33 k!1frost2024/03/30 03:00:032026/05/09 00:09:46AS18702S38507S10006S20500S2b700S10120S2fe00S10006S16d20M539x552S36d00479x472S18702510x476S2b700517x448S10120523x499S16d20522x532proper noun a federal district of the US, coextensive with the city of Washington, situated on the Potomac River with boundaries on the states of Virginia and Maryland.Adam Frost{"video":"dominance: right;\\nletter: integrated (for Washington);\\nfingerspelled: abbreviated (for DC);\\n\ud8cc\udea3\ud8fc\udde8\u00d8\ud8d8\udde1\ud8e9\udca1\ud8c0\udc81\ud8fc\udc61\u00d8\ud8ca\udd01.mov"} vvy 33g !5frost2024/03/30 03:09:152026/05/09 00:10:14AS10e21S30007S10006S20500S22a04S11920S30006S20500M550x529S2ff00482x483S10e21513x482S22a04537x503S11920515x503proper noun a country in Southeast Asia, with a coastline on the South China Sea; capital, Hanoi.
      adjective relating to Vietnam, its people, or their language.
      noun
      1. a native or inhabitant of Vietnam, or a person of Vietnamese descent.
      2. the language of Vietnam.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c1\udd62\ud8f0\udc08\u00d8\ud8d8\udde1\ud8db\udfc5\ud8c2\udd81\ud8f0\udc07\ud8d8\udde1.mov"} MM/z 33i /!efrost2024/03/30 15:51:312026/05/07 15:43:20AS14c50S38547S14c58S38541S20600S20600M545x530S36d10479x470S14c50521x486S14c58455x486S20600456x519S20600522x519proper noun, adjective, noun dated relating to or associated with Russia.Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcd1\ud8fc\ude28\ud8c7\udcd9\ud8fc\ude22\ud8d8\ude41\ud8d8\ude41.mov"} F<{ 33O o!Yfrost2024/03/30 15:58:542026/05/07 15:42:52AS10012S30004S10006S20e00S26506S28108M554x527S2ff00482x483S10012498x512S26536533x519S28108534x492proper noun a country in northern Asia and eastern Europe; capital, Moscow.
      adjective relating to Russia, its people, or their language.
      noun
      1. a native or inhabitant of Russia, or a person of Russian descent.
      2. the East Slavic language of Russia.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8f0\udc05\u00d8\ud8d9\udd41\ud8e1\udde7\ud8e4\udc69.mov"} rr | 33) I!Afrost2024/03/30 16:04:532026/05/14 00:50:26AS10011S33200S10006S20500S2c601M537x534S33100482x483S10011502x504S2c601518x492proper noun a country in Southeast Asia, on the Gulf of Thailand; capital, Bangkok.
      adjective relating to Thailand, its people, or their language.
      noun
      1. a native or inhabitant of Thailand.
        • a member of the largest ethnic group in Thailand.
        • a person of Thai descent.
      2. the Tai language that is the official language of Thailand.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f4\udec1\u00d8\ud8d8\udde1\ud8ea\ude42.mov"} rr } 33C /!Afrost2024/03/30 16:09:512026/05/07 15:45:07AS1f540S33200S10006S20e00S22f00M544x530S33100482x483S1f540495x506S20e00525x507S22f00519x491proper noun, adjective, noun dated relating to or associated with Poland.Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8f4\udec1\u00d8\ud8d9\udd41\ud8dc\udda1.mov"} **R~ 33[ w!qfrost2024/03/30 16:15:042026/05/07 15:44:15AS18541S38511S10006S20500S2d508S38517S20500M524x517S36d00479x484S18541465x498S2d508490x493S20500514x502proper noun a country in central Europe with a coastline on the Baltic Sea; capital, Warsaw.
      adjective relating to Poland, its inhabitants, or their language.
      noun
      1. a native or inhabitant of Poland, or a person of Polish descent: thousands of Poles commute daily to Germany for work | the Poles can finish second if they beat Sweden.
      2. the West Slavic language of Poland.
      Adam Frost{"video":"dominance: right;\\n\ud8cc\ude22\ud8fc\uddf2\u00d8\ud8d8\udde1\ud8eb\udfe9\ud8fc\uddf8\ud8d8\udde1.mov"} ! 33) c!Afrost2024/03/30 16:21:192026/05/07 15:46:12AS15a11S30007S10006S20500S2e100M550x532S2ff00482x483S15a11510x487S2e100527x503proper noun a country that comprises approximately four fifths of an island of the British Isles, lying west of Great Britain; capital, Dublin.
      adjective relating to the Republic of Ireland, its people, or the Celtic language traditionally and historically spoken there: the Irish government | the traditional Irish folk music scene.
      noun
      1. a native, inhabitant, or descendant of the Republic of Ireland.
      2. the Celtic language that is the first official language of the Republic of Ireland.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8f0\udc08\u00d8\ud8d8\udde1\ud8ed\udc61.mov"} ==? 33C !Afrost2024/03/30 16:40:142026/05/14 00:57:08AS1f502S33d00S10006S20e00S22f04M536x535S33b00482x483S1f502492x506S20e00517x507S22f04511x521proper noun an island country in the North Atlantic Ocean, just south of the Arctic Circle, at the northern end of the Mid-Atlantic Ridge; capital, Reykjavik.
      adjective relating to Iceland or its language.
      noun
      1. a native or inhabitant of Iceland, or a person of Icelandic descent: the ship was owned by an Icelander.
      2. the North Germanic language of Iceland, which is very similar to Old Norse.
        3. Adam Frost{"video":"dominance: right;\\n\ud8d6\udfe3\ud8f5\udee1\u00d8\ud8d9\udd41\ud8dc\udda5.mov"} >>ƅ> 33C !Afrost2024/03/30 16:46:272026/02/15 21:34:28AS17600S2ff00S10006S26a04S14c00M542x536S2ff00482x483S17600520x491S26a04515x509S14c00489x505noun a special administrative region on the southeastern coast of China, a British dependency until 1997; capital, Victoria.
        • a native or inhabitant of Hong Kong: the new generation of Hong Kongese are interested in style, pop culture, and fashion | I am a Hongkonger who has lived in the United States for ten years.
        adjective relating to Hong Kong or its inhabitants: a group of Hong Kongese businessmen.Adam Frost{"video":"dominance: right;\\n\ud8cb\udc41\ud8ef\udfa1\u00d8\ud8e1\udfc5\ud8c7\udc81.mov"} \ 33 !)frost2024/03/30 17:10:212026/05/07 16:28:07AS15a10S30000S10006S20600M531x518S2ff00482x483S15a10494x468S20600509x473proper noun, adjective, noun relating to or associated with Iraq.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd1\ud8f0\udc01\u00d8\ud8d8\ude41.mov"} \i 33A 3!}frost2024/03/30 17:35:572026/05/07 16:02:53AS11051S2fe00S2035aS2fe00S21400S2e73aS20500M517x525  33[ !}frost2024/03/30 17:12:512026/05/07 16:07:39AS15a40S2fe00S15a58S2fe00S21406S21100S2d500M517x527S15a58490x487S15a40504x500S21100504x484S2d500484x474proper noun an island country in the Caribbean Sea, southeast of Cuba; official capital, Kingston.
        adjective relating to Jamaica or its people: lush Jamaican locations | a Jamaican cop who refuses to play by the rules.
        noun a native or inhabitant of Jamaica, or a person of Jamaican descent: we used to play soccer with the Jamaicans.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude19\ud8fc\udc61\ud8d9\udf87\ud8d9\ude61\ud8eb\udfe1.mov"}nd quieter | putting a new team together is a slow process.
        • taking a long time to perform a specified action: she was a slow reader | [with infinitive] : large organizations can be slow to change.
        • lasting or taking a long time: a slow process | the journey home was slow.
        • [attributive] not allowing or intended for fast travel: the slow lane.
      3. [predicative or as complement] (of a clock or watch) showing a time earlier than the correct time: the clock was five minutes slow.
      4. not prompt to understand, think, or learn: he's so slow, so unimaginative.
      5. uneventful and rather dull: a slow and mostly aimless narrative.
        • (of business) with little activity; slack: sales were slow.
      adverb at a slow speed; not quickly: they moved forward slowly.
      2. Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\ude71\u00d8\ud8d9\ude61\ud8e1\udde4.mov"} ;;A 33% !}frost2024/03/30 17:42:582026/05/09 00:10:27AS11920S2fe00S10006S22a00S11051S2fe00S2035aS2fe00S21400S2e73aS20500M517x548S11920490x468S22a00497x452S2035a483x533S11051488x517S2e73a492x499proper noun a part of the United Kingdom that occupies the northeastern part of the island of Ireland and comprises six of the counties of Ulster; capital, Belfast.
      adjective relating to Northern Ireland or its people.
      noun a native, inhabitant, or descendant of Northern Ireland.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udd81\ud8fc\udc61\u00d8\ud8db\udfc1\ud8c1\ude52\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf81\ud8ed\udedb\ud8d8\udde1.mov"} $ 33C !Afrost2024/03/30 19:20:542026/05/07 16:09:42AS1ed02S38511S10006S20e00S2330aM521x540S36d00479x460S1ed02468x468S20e00471x496S2330a466x510proper noun, adjective, noun relating to or associated with Switzerland.Adam Frost{"video":"dominance: right;\\n\ud8d6\udce3\ud8fc\uddf2\u00d8\ud8d9\udd41\ud8dc\udf2b.mov"}X 33) e!Afrost2024/03/30 19:18:322026/05/07 16:08:59AS16d02S38510S10006S20e00S2330aM513x533S16d02487x468S20e00491x488S2330a487x503proper noun a mountainous, landlocked country in central Europe; capital, Berne.
      adjective relating to Switzerland or its people.
      noun a native or inhabitant of Switzerland, or a person of Swiss descent.Adam Frost{"video":"dominance: right;\\n\ud8ca\udce3\ud8fc\uddf1\u00d8\ud8d9\udd41\ud8dc\udf2b.mov"} 22J 335 i! frost2024/03/30 19:25:322026/05/07 16:13:46AS14c10S30006S14c18S30002S28805S2881dS18510S18518M574x537S2ff00482x483S14c10520x484S14c18457x484S28805529x517S2881d451x517S18510549x522S18518426x522proper noun a country in western Europe, on the North Sea; capital, Amsterdam; seat of government, The Hague.
      adjective relating to the Netherlands, its people, or their language.
      noun
      1. a native or inhabitant of the Netherlands, or a person of Dutch descent.
      2. the West Germanic language of the Netherlands.
      Adam Frost{"video":"dominance: equal;\\n\ud8c7\udc91\ud8f0\udc07\ud8c7\udc99\ud8f0\udc03\ud8e4\udf06\ud8e4\udf1e\ud8cc\uddf1\ud8cc\uddf9.mov"} $ 33 /!- frost2024/03/30 19:26:542026/05/09 00:21:48AS18710S30004S10006S20500S14c50S2fe00S14c58S2fe00S38005S22510S22510S26500S26510M527x631S2ff00482x483S18710491x514S14c50503x600S14c58474x580S22510504x585S22510475x565S26500508x568S26510479x548noun a flowing body of water: they built a bridge across the river.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cc\udeb1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8c7\udcd1\ud8fc\udc61\ud8c7\udcd9\ud8fc\udc61\ud8fc\udc06\ud8db\uddf1\ud8db\uddf1\ud8e1\udde1\ud8e1\uddf1.mov"} u 33?%3!} frost2024/03/30 19:31:152026/06/14 02:40:43AS18710S30004S10006S20500S14c50S2fe00S14c58S2fe00S38005S2c100S2c111M527x633S2ff00482x483S18710491x514S14c50503x602S14c58474x580S2c100497x570S2c111481x548S38b00470x493 M544x565S2ff00482x483S15a20503x508S26500518x515S26510475x550S18227518x488S1822f472x523S22113525x481S22115463x516 S38b04470x493noun an open body of water with prominent waves: the ship sailed across the open ocean.
      PHONOLOGICAL VARIANTS
      ocean with flat-handsAdam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cc\udeb1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8c7\udcd1\ud8fc\udc61\ud8c7\udcd9\ud8fc\udc61\ud8fc\udc06\ud8ea\udc61\ud8ea\udc72.mov"} tt 33) E!A frost2024/03/30 19:36:572026/05/07 16:19:06AS1ea11S38511S10006S2ef02S20500M521x526S36d00479x475S1ea11465x484S2ef02471x507proper noun a country in southwestern Europe, occupying the greater part of the Iberian peninsula; capital, Madrid.
      adjective relating to Spain or its people: the breed was originally brought here by Spanish colonists in the 16th century | the Spanish island of Menorca | many of the crew were Spanish.
      noun a native or inhabitant of Spain, or a person of Spanish descent.Adam Frost{"video":"dominance: right;\\n\ud8d5\udfd2\ud8fc\uddf2\u00d8\ud8ee\udda3\ud8d8\udde1.mov"} i 33 !efrost2024/03/31 16:47:402026/05/06 03:50:11AS14020S2fe00S10006S20320M515x525S14020486x476S20320500x510proper noun, adjective relating to or associated with Kansas.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c6\udc21\ud8fc\udc61\u00d8\ud8d8\udd41.mov"}r 33) !A frost2024/03/30 20:14:502026/05/07 15:36:19AS20310S2fe00S10006S37609S26a02M521x526S37609489x475S20310479x482S26a02507x499proper noun, adjective, noun relating to or associated with Scotland.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd31\ud8fc\udc61\u00d8\ud8fb\udc4a\ud8e1\udfc3.mov"} F 33 C!efrost2024/03/31 16:48:532026/05/07 17:14:31AS10120S2fe00S10006S16d20M509x527S10120493x473S16d20492x507proper noun Washington DC.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c0\udc81\ud8fc\udc61\u00d8\ud8ca\udd01.mov"} >>ƅ>33)?!frost2024/03/31 16:50:212026/05/23 16:49:10AS19220S2fe00S10006S19c20S19c20M515x543S19220494x458S19c20486x514S19c20486x481M515x544S19220494x457S1dc20485x480S1dc20485x514 S38a00464x490 S38b00470x493 M514x543S19210486x458S19c10486x514S19c10486x481 S38b04470x493proper noun, adjective a phonological variant (ILY-hand) of Illinois.

      PHONOLOGICAL VARIANTS
      Illinois with palm facing changeAdam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\nvisible: sign;\\n\ud8cd\udee1\ud8fc\udc61\u00d8\ud8ce\udea1\ud8ce\udea1.mov"} M"MQ 33)k+!frost2024/03/31 16:54:152026/05/23 18:14:51AS1f720S2fe00S10006S28807S14c20M525x530S1f720475x515S28807499x506S14c20502x471M512x540S1f720488x461S14c20489x479S2e300489x513proper noun, adjective, noun a phonological variant (curved movement) of Asia.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\nvisible: sign;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8e4\udf08\ud8c7\udca1.mov"}Z 33)k-!frost2024/03/31 16:52:012026/05/26 02:41:12AS19210S2fe00S10006S19c10S19c10M514x543S19210486x458S19c10486x514S19c10486x481M515x543S19220494x458S19c20486x514S19c20486x481proper noun, adjective a phonological variant (palm facing change) of Illinois.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\nvisible: sign;\\n\ud8cd\uded1\ud8fc\udc61\u00d8\ud8ce\ude91\ud8ce\ude91.mov"} 4 33g !frost2024/03/31 17:52:562026/05/09 01:35:06AS18251S2fe00S15a38S2fe00S21400S20500S26500S20500M521x518S15a38480x491S18251486x498S26500507x489S20500496x482Adam Frost{"video":"dominance: right;\\n\ud8cc\udd12\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udde1\ud8d8\udde1.mov"}/ 33[ %!}frost2024/03/31 17:45:122026/07/28 17:36:53AS11051S2fe00S11059S2fe00S38006S27106S27116M537x535S11051508x466S11059464x466S27106518x495S27116465x495noun the action of transporting someone or something or the process of being transported: the era of global mass transportation. Adam Frost{"video":"dominance: right;\\n\ud8c1\ude52\ud8fc\udc61\ud8c1\ude5a\ud8fc\udc61\ud8fc\udc07\ud8e2\ude67\ud8e2\ude77.mov"}20341S2034fM548x529S14c41492x472S14c4f452x473S26505518x498S26515478x499S20341527x508S2034f488x508S38b00470x493 M553x534S1dc41495x467S1dc4f447x476S26505514x494S26515474x495S1e141528x504S1e14f484x509 M539x534S1ea10507x513S1ea18471x513S26500515x498S26510471x498S1e140515x467S1e148462x467 S38b04470x493adjective
      1. moving or capable of moving at high speed: a fast and powerful car.
        • performed or taking place at high speed; taking only a short time: the journey was fast and enjoyable.
        • performing or able to perform a particular type of action quickly: a fast reader.

        PHONOLOGICAL VARIANTS
        fast with L-hands
        fast with snapping movement
      2. [predicative or as complement] (of a clock or watch) showing a time ahead of the correct time: I keep my watch fifteen minutes fast.
        3.  O e6 33C !Afrost2024/03/31 18:04:192026/07/26 19:13:46AS15a50S38630S10006S21100S26503M515x523S37602485x484S15a50503x494S21100502x477S26503489x491adjective
        1. moving or operating, or designed to do so, only at a low speed; not quick or fast: airships were slow and noisy, as planes got quicker a% 33C e!Afrost2024/03/31 18:00:312026/07/24 19:28:17AS10050S38630S10006S21100S26503M519x524S37602482x481S10050504x494S21100500x476S26503486x488adjective
          1. measuring a great distance from end to end: a long corridor | long black hair | the line for tickets was long.
            • (after a measurement and in questions) measuring a specified distance from end to end: a boat 150 feet long | how l
              PHONOLOGICAL VARIANTS
              fast with L-hands
              fast with snapping movement
            • very fast: the rabbit was very fast.
          adverb
          1. at high speed: he was driving too fast.
            • within a short time: they think they're going to get rich fast.

            PHONOLOGICAL VARIANTS
            fast with L-hands
            fast with snapping movement
          2. very quickly: the student is progressing very quickly.
          Adam Frost{"video":"dominance: right;\\n\ud8c7\udcc2\ud8fc\udc61\ud8c7\udcd0\ud8fc\udc61\ud8fc\udc07\ud8e1\udde6\ud8e1\uddf6\ud8d8\udd62\ud8d8\udd70.mov"} ..z33'+!-frost2024/03/31 18:36:292026/08/02 19:16:50AS14c41S2fe00S14c4fS2fe00S38006S26505S26515S_33'9[!-frost2024/03/31 18:35:362026/08/02 19:12:47AS1dc41S2fe00S1dc4fS2fe00S38006S26505S26515S1e141S1e14fM553x534S1dc41495x467S1dc4f447x476S26505514x494S26515474x495S1e141528x504S1e14f484x509M548x529S14c41492x472S14c4f452x473S26505518x498S26515478x499S20341527x508S2034f488x508adjective, adverb a phonological variant (L-hands) of fast (adjective senses 1 and 2, adverb sense 1).Adam Frost{"video":"dominance: right;\\n\ud8d4\udec2\ud8fc\udc61\ud8d4\uded0\ud8fc\udc61\ud8fc\udc07\ud8e1\udde6\ud8e1\uddf6\ud8d5\udca2\ud8d5\udcb0.mov"}students should be able to read with a large degree of independence.
        2. used to give or ask advice or suggestions: you should go back to bed | what should I wear?.
        3. used to indicate what is probable: the bus should arrive in a few minutes.
        4. used to emphasize how striking an event is or was: you should have seen Marge's face.
        5. to be obliged to; expressing necessity: you must show your ID card | it must not be over 2,000 words | she said she must be going.
          • expressing insistence: you must try some of this fish | if you must smoke you could at least go in the living room.

        PHONOLOGICAL VARIANTS
        need left-handed

        INFLECTED FORMS
        need [in isolation]Adam Frost{"video":"dominance: right;\\n\ud8c0\ude61\ud8fc\udc61\u00d8\ud8dc\udd45.mov"}the greatest wits of all time.
        • the progress of time as affecting people and things: things were getting better as time passed.
        • time or an amount of time as reckoned by a conventional standard: it's eight o'clock Eastern Standard Time.
      3. a point of time as measured in hours and minutes past midnight or noon: the time is 9:30.
        • a moment or definite portion of time allotted, used, or suitable for a purpose: the scheduled departure time | should we set a time for the meeting?.
        • (often time for/to do something) the favorable or appropriate time to do something; the right moment: it was time to go | it's time for bed.
        • (one's time) one's lifetime: I've known a lot of women in my time | if I had my time again I wouldn't do anything different.
        • (one's time) the successful, fortunate, or influential part of a person's life or career: in my time that was unheard of.
        • (one's time) the z33'9o!Ofrost2024/03/31 18:44:342026/08/02 19:15:23AS1ea10S2fe00S1ea18S2fe00S38006S26500S26510S1e140S1e148M539x534S1ea10507x513S1ea18471x513S26500515x498S26510471x498S1e140515x467S1e148462x467M548x529S14c41492x472S14c4f452x473S26505518x498S26515478x499S20341527x508S2034f488x508adjective, adverb a phonological variant (snapping movement) of fast (adjective senses 1 and 2, adverb sense 1).Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8d5\udfd1\ud8fc\udc61\ud8d5\udfd9\ud8fc\udc61\ud8fc\udc07\ud8e1\udde1\ud8e1\uddf1\ud8d5\udca1\ud8d5\udca9.mov"} | 33A Y!}frost2024/03/31 18:49:482026/02/17 00:43:50AS10010S2fe00S15a18S2fe00S21406S2e700S20500M515x530S15a18485x493S10010498x471S2e700500x505noun
          1. a period of time equal to a twenty-fourth of a day or 60 minutes: [as modifier, usually with preceding numeral] : a twelve-hour operation | an extra hour of daylight | rates have ranged from $9 to $32 an hour.
            • the distance traveled in one hour: Ocean City is less than an hour away.
          2. a fixed period of time for an activity, such as work, use of a building, etc.: the dinner hour | shortened working hours.
          Adam Frost{"video":"dominance: right;\\n\ud8c0\udc11\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8ed\udea1\ud8d8\udde1.mov"} ::[ 33A s!!frost2024/03/31 18:52:412026/04/23 23:47:41AS11e10S2fe00S15a18S2fe00S21406S2e700S20500M518x530S15a18482x493S11e10495x471S2e700497x505combined form a construction of hour (sense 1) and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf51\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8ed\udea1\ud8d8\udde1.mov"}c 33A !!frost2024/03/31 18:51:392026/04/23 23:47:29AS10e10S2fe00S15a18S2fe00S21406S2e700S20500M515x530S15a18485x493S10e10498x471S2e700500x505combined form a construction of hour (sense 1) and the number two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c1\udd51\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8ed\udea1\ud8d8\udde1.mov"} D"DZ 33A q!!frost2024/03/31 18:54:382026/04/23 23:48:04AS14c10S2fe00S15a18S2fe00S21406S2e700S20500M516x530S15a18485x493S14c10493x470S2e700500x505combined form a construction of hour (sense 1) and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udc91\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8ed\udea1\ud8d8\udde1.mov"}Z 33A q!!frost2024/03/31 18:53:382026/04/23 23:47:55AS14410S2fe00S15a18S2fe00S21406S2e700S20500M517x530S15a18484x493S14410495x470S2e700499x505combined form a construction of hour (sense 1) and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udd91\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8ed\udea1\ud8d8\udde1.mov"} 99[ 33A s!! frost2024/03/31 18:56:492026/04/23 23:48:21AS1a510S2fe00S15a18S2fe00S21406S2e700S20500M515x529S15a18485x492S1a510492x472S2e700500x504combined form a construction of hour (sense 1) and seven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\uddf1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8ed\udea1\ud8d8\udde1.mov"}d 33A !!frost2024/03/31 18:55:542026/04/23 23:48:11AS18710S2fe00S15a18S2fe00S21406S2e700S20500M515x529S15a18485x492S18710496x471S2e700500x504combined form a construction of hour (sense 1) and the number six.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udeb1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8ed\udea1\ud8d8\udde1.mov"} 8!8e! 33A !!"frost2024/03/31 18:58:482026/04/23 23:48:39AS1ce10S2fe00S15a18S2fe00S21406S2e700S20500M517x530S15a18483x493S1ce10495x471S2e700498x505combined form a construction of hour (sense 1) and the number nine.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d3\udd51\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8ed\udea1\ud8d8\udde1.mov"}[ 33A s!!!frost2024/03/31 18:57:572026/04/23 23:48:31AS1bb10S2fe00S15a18S2fe00S21406S2e700S20500M515x529S15a18485x492S1bb10492x472S2e700500x504combined form a construction of hour (sense 1) and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d1\ude31\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8ed\udea1\ud8d8\udde1.mov"} appropriate or expected time for something, in particular childbirth or death: he seemed old before his time | Kelly realized her time was near.
        • the normal rate of pay for time spent working: if called out on weekends, they are paid time and a half.
      4. time as allotted, available, or used: we need more time | it would be a waste of time.
        • informal a prison sentence: he was doing time for fraud.
      5. an instance of something happening or being done; an occasion: this is the first time I have gotten into debt | the nurse came in four times a day.
        • an event, occasion, or period experienced in a particular way: she was having a rough time of it | we had a good time.

      INFLECTED FORMS
      time [in isolation]Adam Frost{"video":"dominance: right;\\n\ud8c0\ude91\ud8fc\ude71\ud8d8\udd7b\ud8fc\udc61\ud8d8\udde1.mov"} X0"33ks!)#frost2024/03/31 19:00:462026/06/05 17:28:16AS10620S2fe00S10006S22e04M511x524S10620489x477S22e04494x506S38b00470x493 M511x524S10628490x477S22e14489x506 S38b04470x493 S38a00464x490 M513x524S10620487x477S23004488x506verb
      1. to require (something): I need help now | [with present participle] : this shirt needs washing | [with infinitive] : they need to win tomorrow.
        • (not need something) not want to be subjected to something: I don't need your sarcasm.
      modal verb
      1. used to indicate obligation, duty, or correctness, typically when criticizing someone's actions: he should have been careful | I think we should trust our people more | you shouldn't have gone.
        • indicating a desirable or expected state: by now  q# 33 '!W$frost2024/03/31 19:03:052026/07/27 20:03:33AS14720S2fe00S10006S19220M511x523S14720491x478S19220490x504adjective sexually or romantically attracted to both men and women, or to more than one sex or gender: I am a bi woman who has been in a relationship with a man.
          noun a person who is sexually or romantically attracted to both men and women, or to more than one sex or gender: the group described itself as promoting the rights of lesbians, bisexuals, and gay men.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udec1\ud8fc\udc61\u00d8\ud8cd\udee1.mov"} m$ 33? ]!]%frost2024/03/31 19:05:222026/05/03 22:02:24AS14c20S2fe00S14c28S2fe00S21406S20500S2df06S2df1eS18537S1853fS20500M525x545S14c20502x514S14c28476x514S2df06502x486S2df1e479x486S18537501x456S1853f481x456noun, adjective a family or relating to.Adam Frost{"video":"dominance: equal;\\n\ud8c7\udca1\ud8fc\udc61\ud8c7\udca9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ec\udfa7\ud8ec\udfbf\ud8cc\ude18\ud8cc\ude20\ud8d8\udde1.mov"} )h)F;& 33) +!A'frost2024/03/31 19:12:062026/07/27 19:53:51AS1a012S33200S10006S21100S2c500M562x528S33100482x483S2c500522x489S1a012493x508noun a child or young person: she collected the kids from school.Adam Frost{"video":"dominance: right;\\n\ud8cf\udc13\ud8f4\udec1\u00d8\ud8d9\ude61\ud8ea\udde1.mov"}%33!!)&frost2024/03/31 19:09:362026/08/08 23:24:03AS18220S2fe00S10006S22f04M513x517S18220488x484S22f04488x503M552x514S15a50505x487S15a58484x487S2920a521x498S29212449x498noun a young human being below the age of puberty or below the legal age of majority: she'd been playing tennis since she was a child.
          • a son or daughter of any age: when the last child leave home, parents can feel somewhat redundant.

          DERIVATIVES
          children (plural noun)Adam Frost{"video":"dominance: right;\\n\ud8cc\udce1\ud8fc\udc61\u00d8\ud8dc\udda5.mov"} 55B( 33g '!)frost2024/03/31 19:22:042025/03/04 18:49:07AS10050S2fe00S15a38S2fe00S21400S20500S26500S20500M517x519S15a38483x482S10050488x489S26500503x495S20500497x483verb to develop a deep romantic or sexual attachment to someone: I've fallen in love with you | we were slowly falling in love.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc51\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udde1\ud8d8\udde1.mov"}' 33 !(frost2024/03/31 19:14:492026/06/16 19:53:29AS1f70aS38511S1f702S38511S20500S20500S21800S21800M521x520S1f70a463x500S1f702480x500S21800481x489S21800459x489S36d00479x481noun a regular companion with whom a person has a romantic or sexual relationship: she took her partner to the party | some of the students came with their boyfriend/girlfriend.Adam Frost{"video":"dominance: right;\\n\ud8d7\udcab\ud8fc\uddf2\ud8d7\udca3\ud8fc\uddf2\ud8d8\udde1\ud8d8\udde1\ud8da\udd01\ud8da\udd01.mov"} vv) 33A m!}*frost2024/03/31 19:23:412026/05/03 22:03:03AS1f740S2fe00S1f748S2fe00S21406S20500S27120M521x517S1f748479x502S1f740501x502S27120481x484verb to be in a regular romantic or sexual relationship: they’ve been together for about a year.Adam Frost{"video":"dominance: equal;\\n\ud8d7\udce1\ud8fc\udc61\ud8d7\udce9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e2\ude81.mov"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx           ! "!#"$#%$&%'&(')(*)+*,+-,.-/.0/102132435465768798:9;:<;=<>=?>@?A@BACBDCEDFEGFHGIHJIKJLKMLNMONPOQPRQSRTSUTVUWVXWYXZY[Z\[]\^]_^`_ ++مQ* 335 {!+frost2024/03/31 19:26:462026/07/27 19:57:13AS10110S2fe00S10118S2fe00S21406S20600M517x522S10110501x479S10118483x479S20600489x511noun a social or romantic appointment or engagement: he was on a date with someone he met in class.
          • a person with whom one has a social or romantic engagement: my date isn't going to show, it seems.
          verb to go out with (someone in whom one is romantically or sexually interested): a few years ago, I dated the ex of a friend | [no object] : they have been dating for more than a year.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c0\udc71\ud8fc\udc61\ud8c0\udc79\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"} they caught the last bus | she's the youngest of five children.
          • met with or encountered after any others: the last house in the village.
          • the lowest in importance or rank: finishing in last place | [as complement] : he came last in the race.
          • (the last) the least likely or suitable: the last thing she needed was a husband | addicts are often the last people to face up to their problems.
        • immediately preceding in order; previous in a sequence or enumeration: their last album | this last point is critical.
        • only remaining: it's our last hope.
      adverb (especially in enumerating points) as the final item in a sequence: and last, I'd like to thank you all for coming.
      noun last position in a race, contest, or ranking: he finished last in the race.Adam Frost{"video":"dominance: right;\\n\ud8cd\udf01\ud8fc\udc61\ud8cd\udf0a\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8db\udfc5.mov"} regarded collectively: one of his generation's finest songwriters.
      • the average period, generally considered to be about thirty years, during which children are born and grow up, become adults, and begin to have children of their own: the same families have lived here for generations.
      • a set of members of a family regarded as a single step or stage in descent: [as modifier, in combination] : a third-generation Canadian.
      • (future generations) all future generations of people: the victims' names are recorded for posterity.
      • (generation line) lineal descent from an ancestor: a Dutch nobleman of ancient lineage | [count noun] : great families and their lineages.
      • (generation line) a person, plant, or animal that is descended from a particular ancestor: Shakespeare's last direct descendant.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8fc\udde8\ud8c8\uddcb\ud8fc\udc61\ud8e9\udee1\ud8e9\udef2\ud8ef\udee1.mov"} yI, 33 !)-frost2024/04/03 19:55:052026/02/19 18:41:31AS1540bS2fe00S10006S26b00M514x523S1540b489x499S26b00487x477noun a game in which ten wooden or plastic pins are set up at the end of a track (typically one of several in a large, automated alley) and bowled down with hard rubber or plastic balls, historically from spinning the ball by flicking the wrist.Adam Frost{"video":"dominance: right;\\n\ud8c7\udf8c\ud8fc\udc61\u00d8\ud8e2\udc21.mov"}w+ 33)k9!M,frost2024/04/01 17:43:162026/10/07 16:05:52AS10650S38630S2035aS2fe00S20500M515x520S10650488x494S2035a500x486S20500485x481M521x520S10650494x494S2035a506x486S20600479x481noun
      1. the indefinite continued progress of existence and events in the past, present, and future regarded as a whole: travel through space and time | our conception of time | one of  00L- 33g ;!.frost2024/04/04 00:26:172026/05/28 19:18:35AS14750S2fe00S14758S2fe00S21406S20500S26506S26512M534x511S14750502x489S14758485x489S26506519x496S26512467x496noun the lower surface of a room, on which one may walk: he dropped the cup and it smashed on the floor | the kitchen floor.
        • (plural shelves) a flat surface, attached to a wall or forming part of a piece of furniture, on which one may place objects for storage or display: place the book on the shelf.
        Adam Frost{"video":"dominance: equal;\\n\ud8c6\udef1\ud8fc\udc61\ud8c6\udef9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\udde7\ud8e1\uddf3.mov"} i. 33g u!/frost2024/04/04 00:33:172026/05/03 22:04:38AS14750S2fe00S14758S2fe00S21406S20600S2450aS24512M533x522S14750501x478S14758484x478S2450a502x504S24512467x504noun flat surfaces, attached to a wall or forming part of a piece of furniture, on which one may place objects for storage or display: the shelves next to the window.Adam Frost{"video":"dominance: equal;\\n\ud8c6\udef1\ud8fc\udc61\ud8c6\udef9\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41\ud8de\uddeb\ud8de\uddf3.mov"} ."/33#!0frost2024/04/06 15:06:172026/07/28 20:05:40AS1ce50S2fe00S14c59S2fe00S21400S20500M515x526S14c59485x500S1ce50493x474S38b00470x493 M515x536S14c59485x510S1ce50493x484S2e736490x465 S38b04470x493 S38a00464x490 M524x526S14c59494x500S1ce50502x474S20600477x495noun a person to whom someone is engaged to be married: he went back to the valley to marry his fiancée.

        PHONOLOGICAL VARIANTS
        fiancé with circular movement

        INFLECTED FORMS
        fiancé [in isolation]Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d3\udd91\ud8fc\udc61\ud8c7\udcda\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1.mov"}p` flrx~ &,28>DJPV\bhntz "(.4:@FLR^X`djpv|kqrtvxyz{|}~    !"#$&()*,-./012357Š8Ê9Ċ:Ŋ;Ɗ=NJ>Ȋ?ɊAʊDˊF̊HΊKЊMъNҊOӊPԊS؊UيWۊX܊Z݊\ފ]ߊ^`bcdefgjilmoqsuwy{}~    vv0 33A m!}1frost2024/04/06 14:57:412026/05/19 04:28:27AS17150S2fe00S1713fS2fe00S21400S20500S22e00M517x522S1713f483x502S17150497x499S22e00500x478verb [no object] to make an offer of marriage to someone: I have already proposed to Sarah.Adam Frost{"video":"dominance: right;\\n\ud8ca\udeb1\ud8fc\udc61\ud8ca\udea0\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8dc\udd41.mov"} RR*1 33 g!}2frost2024/04/06 15:14:462026/08/04 19:12:49AS14c02S38536S14c0aS38532S2d507S2d51fS20700M551x531S36d00479x469S14c02497x488S14c0a472x491S2d507531x493S2d51f450x496S20700493x516adjective (of a woman or female animal) having a child or young developing in the uterus: she was six months pregnant | a pregnant woman.
        verb to become pregnant with (a child): she was conceived when her father was 49.
        • [no object] (of a woman) to become pregnant: five months ago Wendy conceived.
        Adam Frost{"video":"dominance: right;\\n\ud8c7\udc83\ud8fc\ude17\ud8c7\udc8b\ud8fc\ude13\ud8eb\udfe8\ud8ec\udc00\ud8d8\udea1.mov"} F2 33 e!)3frost2024/04/06 15:21:512026/08/04 19:01:38AS14c03S38530S10006S26500M521x526S36d00479x475S14c03485x500S26500494x483adjective (of a woman) being visibly pregnant: she was heavily pregnant with her second child.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc84\ud8fc\ude11\u00d8\ud8e1\udde1.mov"} WW%3 33A +!}4frost2024/04/06 15:23:402026/02/20 19:37:33AS15a02S2fe00S15a0aS2fe00S21414S20e00S2d200M535x512S15a0a465x492S15a02479x497S2d200509x489verb
        1. to begin life by leaving the womb: she was born in Seattle | he was born of Greek parents | I was born with a sense of curiosity | a newly born baby.
        2. to produce a baby from the womb: she had carried him and birthed him.
        noun the event of a baby being born: he was blind from birth | despite a difficult birth he's fit and healthy.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8eb\udec1.mov"} 44G533C!o6frost2024/04/06 15:29:562026/06/16 19:48:48AS15a32S38622S15a3aS38624S20600M539x512S37806487x505S15a3a512x500S15a32484x488S20600462x497M537x520S37806485x506S15a3a510x501S15a32482x489S27122464x481noun a phonological variant (touching movements) of baby.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c8\uddf3\ud8fc\ude63\ud8c8\uddfb\ud8fc\ude65\ud8d8\ude41.mov"}|4 33A Y!}5frost2024/04/06 15:27:232026/02/20 21:21:12AS20301S2fe00S15a0aS2fe00S21400S20e00S2d200M528x512S15a0a472x488S20301478x491S2d200502x489verb to have a baby to emerge from the womb: she gave birth after twelve hours of labor.
        noun the physical emergence of a baby from the womb: your father was in the hospital room during the birth.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd22\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8eb\udec1.mov"} CC7 33) g!A8frost2024/04/06 15:44:392025/02/25 19:04:45AS14c27S30004S10006S20500S2b901M548x535S2ff00482x483S14c27504x508S2b901522x481noun the mother of one's father or mother: my grandmother is ill | [as name] : to dearest Grandmother, with love and gratitude | [as title] : Grandmother Asha.Adam Frost{"video":"dominance: right;\\n\ud8c7\udca8\ud8f0\udc05\u00d8\ud8d8\udde1\ud8e9\udd62.mov"}6 33) o!A7frost2024/04/06 15:42:502026/02/20 21:28:05AS14c20S30007S10006S20500S2b901M547x518S2ff00482x483S14c20515x472S2b901521x445noun the father of one's father or mother.Adam Frost{"video":"dominance: right;\\n\ud8c7\udca1\ud8f0\udc08\u00d8\ud8d8\udde1\ud8e9\udd62.mov"} #8339!79frost2024/04/06 15:47:042026/06/17 16:50:17AS14c20S30007S14c2fS30004S20500S20500S2b901S2b910M547x535S2ff00482x483S14c20515x472S14c2f470x508S2b901521x445S2b910452x481M548x562S2ff00482x438S14c27504x463S2b901522x436S2ff00482x527S14c20515x514S2b901521x488noun a phonological variant (two handed) of grandparent.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udca1\ud8f0\udc08\ud8c7\udcb0\ud8f0\udc05\ud8d8\udde1\ud8d8\udde1\ud8e9\udd62\ud8e9\udd71.mov"} ss 9 33} =!w:frost2024/04/06 16:18:112026/05/04 03:52:43AS1f000S2fe00S10006S11a20S1f720S11920S10120S15a11S30007S15a3aS2fe00S20500S22a03S15a32S38622S20500M533x552S1f000485x336S11a20499x355S1f720494x389S11920493x408S10120499x438S2ff00482x483S15a11510x478S37806477x545S15a3a502x540S15a32474x527S22a03508x517noun the son of one's son or daughter: he was proud of his four grandsons.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d6\ude01\ud8fc\udc61\u00d8\ud8c2\udde1\ud8d7\udcc1\ud8c2\udd81\ud8c0\udc81\ud8c8\uddd2\ud8f0\udc08\ud8c8\uddfb\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8c8\uddf3\ud8fc\ude63\ud8d8\udde1.mov"} oo : 33} E!w;frost2024/04/06 16:37:042026/05/04 03:53:18AS1f000S2fe00S10006S11a20S1f720S11920S10120S15a10S30005S15a3aS2fe00S20500S22a03S15a32S38622S20500M527x566S1f000485x336S11a20499x355S1f720494x389S11920493x408S10120499x438S2ff00482x483S15a10506x508S37806475x559S15a3a500x554S15a32472x542S22a03490x524noun the daughter of one's son or daughter: I have a granddaughter who is two.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d6\ude01\ud8fc\udc61\u00d8\ud8c2\udde1\ud8d7\udcc1\ud8c2\udd81\ud8c0\udc81\ud8c8\uddd1\ud8f0\udc06\ud8c8\uddfb\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8c8\uddf3\ud8fc\ude63\ud8d8\udde1.mov"}  ; 331 i!Gnoun children of one's son or daughter.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d6\ude01\ud8fc\udc61\u00d8\ud8c2\udde1\ud8d7\udcc1\ud8c2\udd81\ud8c0\udc81\ud8c8\ude11\ud8fc\udc61\ud8c8\ude19\ud8fc\udc61\ud8fc\udc07\ud8e5\udecb\ud8e5\uded3.mov"} M= 33K [!>frost2024/04/06 17:05:102026/05/09 00:22:35AS14c20S30007S10006S20500S1dc40S2fe00S15a18S2fe00S21406S20500S22a04S20500M538x568S2ff00482x483S14c20515x472S15a18488x539S1dc40501x523S22a04517x550S20500503x557noun the father of one's spouse.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c7\udca1\ud8f0\udc08\u00d8\ud8d8\udde1\ud8d4\udec1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8db\udfc5\ud8d8\udde1.mov"}< 33K w!=frost2024/04/06 17:01:552026/05/09 00:22:26AS14c27S30004S10006S20500S1dc40S2fe00S15a18S2fe00S21406S20500S22a04S20500M530x586S2ff00482x483S14c27504x508S15a18488x557S1dc40501x541S22a04517x568S20500503x575noun the mother of one's husband or wife: he was waiting for his wife and mother-in-law at the airport.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c7\udca8\ud8f0\udc05\u00d8\ud8d8\udde1\ud8d4\udec1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8db\udfc5\ud8d8\udde1.mov"} %> 33I !?frost2024/04/06 17:13:062026/05/09 00:22:45AS1dc20S30007S1dc0aS2fe00S20500S22a03S1dc41S21400S1dc40S2fe00S15a18S2fe00S21406S20500S22a04S20500M535x613S2ff00482x483S1dc20511x471S22a03513x513S1dc0a505x536S1dc41488x521S15a18488x584S1dc40501x568S22a04517x595S20500503x602noun the brother of one's husband or wife: my wife and brother-in-law had their German nationality restored.
        • the husband of one's sibling or sibling-in-law: he was driving home with his sister and brother-in-law.
        Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d4\udea1\ud8f0\udc08\ud8d4\ude8b\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8d4\udec2\ud8d9\udf81\ud8d8\udde1\ud8d4\udec1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8db\udfc5\ud8d8\udde1.mov"} ]]? 33U o!@frost2024/04/06 17:20:042026/05/09 00:22:57AS1dc27S30005S1dc0aS2fe00S20500S22a03S1dc41S21400S20500S1dc40S2fe00S15a18S2fe00S21406S20500S22a04S20500M532x624S2ff00482x483S1dc27509x501S1dc0a493x547S22a03500x524S1dc41476x532S15a18485x595S1dc40498x579S22a04513x606S20500500x613noun the sister of one's husband or wife.
        • the wife of one's sibling or sibling-in-law.
        Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d4\udea8\ud8f0\udc06\ud8d4\ude8b\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8d4\udec2\ud8d9\udf81\ud8d8\udde1\ud8d4\udec1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8db\udfc5\ud8d8\udde1.mov"} j"A 33 q!UBfrost2024/04/06 17:26:142026/05/09 00:23:15AS1f720S30005S10006S27102M549x543S2ff00482x483S1f720510x515S27102534x503noun the sister of one's father or mother, or the wife or female partner of one's uncle or aunt: she was brought up by her aunt and uncle | [as title] : Aunt Susan.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d7\udcc1\ud8f0\udc06\u00d8\ud8e2\ude63.mov"}@ 33 Q!UAfrost2024/04/06 17:24:032026/05/09 00:23:07AS11520S30007S10006S27102M553x518S2ff00482x483S11520518x459S27102538x461noun the brother of one's father or mother, or the husband or male partner of one's aunt or uncle: he visited his uncle | [as title] : Uncle Alfred.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udc01\ud8f0\udc08\u00d8\ud8e2\ude63.mov"} D 33 i!UEfrost2024/04/06 17:30:142026/05/09 00:23:41AS16d10S30005S10006S2e00cM535x561S2ff00482x483S16d10516x509S2e00c514x533noun a daughter of one's uncle or aunt.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udcf1\ud8f0\udc06\u00d8\ud8ed\udc0d.mov"}C 33 _!UDfrost2024/04/06 17:28:222026/05/09 00:23:33AS16d10S30007S10006S2e00cM541x529S2ff00482x483S16d10522x477S2e00c520x501noun a son of one's uncle or aunt.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udcf1\ud8f0\udc08\u00d8\ud8ed\udc0d.mov"}B 33 c!UCfrost2024/04/06 17:27:392026/05/09 00:23:24AS16d10S30006S10006S2e00cM541x544S2ff00482x483S16d10522x492S2e00c520x516noun a child of one's uncle or aunt.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udcf1\ud8f0\udc07\u00d8\ud8ed\udc0d.mov"} U{F 33 #!UGfrost2024/04/06 17:32:512026/05/09 00:23:59AS11911S30007S10006S2e00cM544x536S2ff00482x483S11911516x484S2e00c523x508noun a son of one's brother or sister, or of one's brother-in-law or sister-in-law: he held up his little nephew in his arms.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udd72\ud8f0\udc08\u00d8\ud8ed\udc0d.mov"}'E 33 {!UFfrost2024/04/06 17:31:312026/05/09 00:23:51AS11911S30005S10006S2e00cM540x567S2ff00482x483S11911512x515S2e00c519x539noun a daughter of one's brother or sister, or of one's brother-in-law or sister-in-law: having never married or had children, he left his inheritance to his two nieces.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udd72\ud8f0\udc06\u00d8\ud8ed\udc0d.mov"} L8L`H 33[ !}Ifrost2024/04/06 17:51:302026/08/05 17:15:09AS19240S2fe00S19249S2fe00S21400S20e00S22a04M524x529S19249477x471S19240503x475S22a04510x514S20e00510x497adjective
        1. coming after all others in time or order:DG33O!YHfrost2024/04/06 17:49:342026/07/30 22:16:22AS14e01S30004S10006S20e00S22a07S20301M549x535S2ff00482x483S14e01492x508S22a07519x504S20301528x487M518x572S2ff00482x483S15410494x510S22a04495x539S20310494x557combining form old (adjective) -er.Adam Frost{"video":"dominance: right;\\n\ud8c7\udd42\ud8f0\udc05\u00d8\ud8d9\udd41\ud8db\udfc8\ud8d8\udd22.mov"}6512M543x509S18241501x492S18249475x492S26506528x495S26512458x495verb
          1. [with object] to cause to move or be apart: both owners were trying to separate the dogs | they were separated by the war.
            • [no object] to become detached or disconnected: the second stage of the rocket failed to separate.
            • [no object] to stop living together as a couple: after her parents separated she was brought up by her mother.
            • to form a distinction or boundary between (people, places, or things): only a footpath separated their garden from the shore.
          2. to divide into constituent or distinct elements: [no object] : the processed milk had separated into curds and whey | [with object] : separate the eggs and beat the egg yolks | the organ loft separating off the choir.
            • [with object] to extract or remove for use or rejection: the skins are separated from the juice before fermentation.
            • < __?4K 33g !Lfrost2024/04/06 18:08:502026/05/09 01:44:02AS10041S2fe00S10049S2fe00S21407S26502S26516S20500M534x515S10049485x485S10041496x485S26502519x498S26516467x498Adam Frost{"video":"dominance: right;\\n\ud8c0\udc42\ud8fc\udc61\ud8c0\udc4a\ud8fc\udc61\ud8d9\udf88\ud8e1\udde3\ud8e1\uddf7\ud8d8\udde1.mov"}oJ 33u !}Kfrost2024/04/06 18:06:352026/02/26 18:50:47AS15a02S38507S15a0aS2fe00S2bd00S2bd11S2fd00M573x528S36d00479x495S15a0a520x516S15a02546x502S2bd00548x472S2bd11527x486noun all of the people born and living at about the same time,jI 33i 1!YJfrost2024/04/06 17:55:492026/07/30 22:35:54AS18201S38517S10006S20e00S22a00S1f502M537x539S36d00479x519S18201512x522S20e00521x507S22a00520x489S1f502519x462combining form young -er.Adam Frost{"video":"dominance: right;\\n\ud8cc\udcc2\ud8fc\uddf8\u00d8\ud8d9\udd41\ud8db\udfc1\ud8d6\udfe3.mov"}i>[with object] distinguish between; consider individually: we cannot separate his thinking from his activity | his position separates him from those who might share his interests | we need to separate fact from speculation.
          adjective forming or viewed as a unit apart or by itself: this raises two separate issues | he regards the study of literature as quite separate from life.
          • not joined or touching physically: hostels with separate quarters for men and women.
          • different; not together: melt the white and dark chocolate in separate bowls.
          adverb (of two or more people or things) separated by a distance; at a specified distance from each other in time or space: two stone gateposts some thirty feet apart | his parents are now living apart.
          noun
          1. the action or state of moving or being moved apart: the damage that might arise from the separation of parents and children.
            • t AAM 33O A!Nfrost2024/04/06 19:08:312026/05/09 01:53:23AS13311S38517S13319S38511S20500S20500M532x518S13311504x491S13319471x491S20500522x482S20500469x482verb to retire (sense 2).Adam Frost{"video":"dominance: equal;\\nletter: integrated;\\n\ud8c4\udf32\ud8fc\uddf8\ud8c4\udf3a\ud8fc\uddf2\ud8d8\udde1\ud8d8\udde1.mov"}5L 33g !Mfrost2024/04/06 18:14:512026/05/19 04:30:27AS10041S2fe00S10049S2fe00S21407S26a02S26a16S20600M532x517S10049484x483S10041495x483S26a02518x490S26a16468x490verb to repeatedly clash due to incompatible differences: they're always clashing.
              adjective [predicative] having origins in multiple ancestral or biological lines: she's mixed: German, Russian, Italian, and French.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc42\ud8fc\udc61\ud8c0\udc4a\ud8fc\udc61\ud8d9\udf88\ud8e1\udfc3\ud8e1\udfd7\ud8d8\ude41.mov"} kN 33O A!eOfrost2024/04/06 19:11:582026/05/09 01:54:35AS1dc11S38517S1dc19S38511S20500S20500M539x516S1dc11505x486S1dc19473x486S20500529x484S20500462x484verb to retire (sense 2).Adam Frost{"video":"dominance: equal;\\n\ud8d4\ude92\ud8fc\uddf8\ud8d4\ude9a\ud8fc\uddf2\ud8d8\udde1\ud8d8\udde1.mov"} --OO 33O !ePfrost2024/04/06 19:13:412026/05/19 04:30:52AS14c11S38517S14c19S38511S20500S20500M529x517S14c11502x490S14c19472x490S20500519x483S20500471x483verb
              1. to stop working or carrying out regular activities for a period of rest or recreation: we're too busy to take a break.
              2. [no object] to leave one's job and cease to work, typically upon reaching the normal age for leaving employment: he retired from the navy in 1966.
                • (of an athlete) to cease to play competitively: he retired from football several years ago.
              Adam Frost{"video":"dominance: equal;\\n\ud8c7\udc92\ud8fc\uddf8\ud8c7\udc9a\ud8fc\uddf2\ud8d8\udde1\ud8d8\udde1.mov"} QQ+P 33O A!eQfrost2024/04/06 19:14:312026/07/27 19:44:02AS14c11S38517S14c19S38511S20600S20600M539x517S14c11502x490S14c19472x490S20600517x483S20600461x483noun
              1. an extended period of leisure and recreation, especially one spent away from home or in traveling: he took a vacation in the south of France | people come here on vacation | [as modifier] : a vacation home.
                • a holiday.
              2. the period of one's life after leaving one's job and ceasing to work: a man nearing retirement.
                • the period of one's life after leaving one's job and ceasing to work: he spent much of his retirement traveling in Europe.
                • the action or fact of ceasing to play a sport competitively.
              Adam Frost{"video":"dominance: equal;\\n\ud8c7\udc92\ud8fc\uddf8\ud8c7\udc9a\ud8fc\uddf2\ud8d8\ude41\ud8d8\ude41.mov"} ^8^S 33g _!Tfrost2024/04/06 19:28:232026/07/30 21:19:41AS18241S2fe00S18249S2fe00S21406S20500S26506S2͂"R 33[ !}Sfrost2024/04/06 19:25:312026/08/28 21:43:40AS14c30S2fe00S15a48S2fe00S38006S22a04S18537M518x538S15a48483x488S14c30494x462S22a04500x496S18537498x511Adam Frost{"video":"dominance: right;\\n\ud8c7\udcb1\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8cc\ude18.mov"}Q33!KRfrost2024/04/06 19:21:572026/06/17 16:56:51AS15a50S2fe00S10006S2a208M518x522S15a50483x495S2a208495x478M528x530S15a50509x503S15a38478x503S2a208505x470S2a218473x470verb, adjective, noun a phonological variant (right handed) of die.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c8\ude11\ud8fc\udc61\u00d8\ud8e7\udcc9.mov"} talk about how sobriety was more than staying straight or dry.
          2. (of an alcoholic drink) not sweet: a dry, medium-bodied red wine.
          verb
          1. become dry: allow 24 hours for the paint to dry | come in out of the rain and dry off.
            • [with object] cause to become dry: they had washed and dried their hair.
            • [with object] wipe tears from (the eyes): she dried her eyes and blew her nose.
            • [with object] preserve by allowing or encouraging evaporation of moisture from: I use several methods to dry the flowers and foliage I use in my arrangements | the natural sugars in the fruit will be concentrated when it is dried.
          2. to assert a firm, unyielding stance; to bring discussion or engagement to a decisive close; typically signed with greater tension in movement.
          Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8f0\udc05\u00d8\ud8d9\udd41\ud8e1\udde7\ud8c0\ude53.mov"}a04475x559S26502485x549S20e00498x540S22a04498x559adjective
          1. unmarried or not involved in a stable sexual relationship: a single mother.
          2. designed or suitable for one person: a single bed.
          3. denoting an alcoholic drink that consists of one measure of liquor: a single whiskey.
          noun
          1. (singles) people who are unmarried or not involved in a stable sexual relationship: [as modifier] : a singles bar.
          2. a bedroom, especially in a hotel, that is suitable for one person.
          3. a single measure of liquor.
          4. a short record or CD featuring one main song or track.
          5. Baseball a hit that allows the batter to reach first base safely.
          6. (singles) (especially in tennis and badminton) a game or competition for individual players, not pairs or teams.
          Adam Frost{"video":"dominance: right;\\n\ud8c0\udc11\ud8f0\udc06\u00d8\ud8d9\udd41\ud8db\udfc5\ud8e1\udde3\ud8f0\udc04\ud8d9\udd41\ud8db\udfc5.mov"}0350S20358M530x534S14c50506x503S14c58471x503S22a00512x484S22a10476x484S20350511x466S20358475x466verb to assume responsibility for or be obligated for.
          • to legally take (another's child) and bring it up as one's own: there are many people eager to adopt a baby.
          • to act as host at (an event) or for (a television or radio program): Canada was asked to host a Commonwealth conference in Ottawa.
          • be taught or examined in (a subject): some degrees require a student to take a secondary subject.
          adjective [attributive]
          1. as a result of being legally adopted: meet my adopted daughter.
          2. as a result of the adoption of another's child: he is the adoptive father of his wife's three children.
          Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcd1\ud8fc\udc61\ud8c7\udcd9\ud8fc\udc61\ud8fc\udc07\ud8db\udfc1\ud8db\udfd1\ud8d8\udd71\ud8d8\udd79.mov"} ooU 33[ W!}Vfrost2024/04/06 19:38:062026/04/23 22:02:45AS16d51S2fe00S16d39S2fe00S21400S20800S2880aM519x520S16d39490x497S16d51481x500S20800487x488S2880a497x480verb to undo a marriage; to divorce.Adam Frost{"video":"dominance: right;\\n\ud8ca\udd32\ud8fc\udc61\ud8ca\udd1a\ud8fc\udc61\ud8d9\udf81\ud8d8\udf01\ud8e4\udf0b.mov"}T 33g y!AUfrost2024/04/06 19:35:352026/05/19 04:31:48AS10110S2fe00S10118S2fe00S21406S20500S2df08S2df10M541x515S10110501x485S10118483x485S2df08520x485S2df10459x485verb [with object] to legally dissolve one's marriage with (someone): [no object] : they divorced eight years later | he divorced his first wife after 10 months.Adam Frost{"video":"dominance: equal;\\nletter: integrated;\\n\ud8c0\udc71\ud8fc\udc61\ud8c0\udc79\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ec\udfa9\ud8ec\udfb1.mov"} :W 33A {!!Xfrost2024/04/06 19:46:022026/08/02 19:56:42AS10010S30005S10006S20e00S22a04S26502S30003S20e00S22a04M518x574S2ff00482x483S10010496x506S20e00476x540S22փBV 33' O!-Wfrost2024/04/06 19:45:042026/05/19 05:48:45AS18537S2fe00S1853fS2fe00S38006S26506S26512S1f730S1f738M560x514S18537502x487S1853f479x487S26506523x497S26512462x497S1f730540x497S1f738440x497verb to gradually grow faint and disappear: hopes of peace had faded · figurative.Adam Frost{"video":"dominance: equal;\\n\ud8cc\ude18\ud8fc\udc61\ud8cc\ude20\ud8fc\udc61\ud8fc\udc07\ud8e1\udde7\ud8e1\uddf3\ud8d7\udcd1\ud8d7\udcd9.mov"}s: he shared the pie with her | all members of the band equally share the band's profits.
          • to use, occupy, or enjoy (something) jointly with another or others: they once shared a house in the Hamptons | [no object] : there weren't enough plates so we had to share.
          • to tell someone about (something, especially something personal): she had never shared the secret with anyone before.
          • to post or repost (something) on a social media site or application: the app lets you share your photos on Facebook, Twitter, and Tumblr.
          noun an instance of posting or reposting something on a social media site or application: there have been 25,000 shares on Twitter and 117 likes on Facebook as of 7:30 p.m..

          DERIVATIVES
          partner nounAdam Frost{"video":"dominance: right;\\n\ud8c8\ude02\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e7\udd85.mov"} II3X 33 -!UYfrost2024/04/06 19:50:292026/07/28 18:54:21AS1dc02S30004S10006S20500M529x526S2ff00482x483S1dc02499x502adjective denoting or relating to women who are sexually or romantically attracted to other women, or to sexual attraction or activity between women: a lesbian relationship | issues affecting the lesbian community | in her early twenties she came out as lesbian | gay and lesbian rights.
          noun a woman who is sexually or romantically attracted to other women; a gay woman: gay men and lesbians had suffered historic discrimination.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d4\ude83\ud8f0\udc05\u00d8\ud8d8\udde1.mov"} 66^Z 33C W!A[frost2024/04/06 19:55:242026/08/05 23:05:57AS10010S30004S10006S20e00S22f04M526x546S2ff00482x483S10010486x508S20e00507x518S22f04501x532adjective sad because one has no friends or company: lonely old people whose families do not care for them.
          • without companions; solitary: passing long lonely hours looking onto the street.
          Adam Frost{"video":"dominance: right;\\n\ud8c0\udc11\ud8f0\udc05\u00d8\ud8d9\udd41\ud8dc\udda5.mov"}cY 33Qu!)Zfrost2024/04/06 19:52:332026/07/31 23:07:13AS1dc02S2fe00S10006S2c300M517x525S1dc02483x501S2c300491x475M524x519S1dc41477x489S2c307499x481pronoun [to front locus] their turn (pronoun).
          verb [center to front locus] their turn (verb).Adam Frost{"video":"dominance: right;\\n\ud8d4\ude83\ud8fc\udc61\u00d8\ud8ea\udd21.mov"} c\ 33Qu!)]frost2024/04/06 19:58:072026/07/31 23:09:00AS1dc40S2fe00S10006S2a208M525x515S1dc40475x485S2a208502x487M524x519S1dc41477x489S2c307499x481pronoun [to right locus] their turn (pronoun).
          verb [center to right locus] their turn (verb).Adam Frost{"video":"dominance: right;\\n\ud8d4\udec1\ud8fc\udc61\u00d8\ud8e7\udcc9.mov"}[ 33)Qw!A\frost2024/04/06 19:56:022026/07/31 23:08:19AS1dc02S38510S10006S2c305S20500M526x520S1dc02475x496S2c305499x480S20500508x506M524x519S1dc41477x489S2c307499x481pronoun [to center locus] their turn (pronoun).
          verb [front to center locus] their turn (verb).Adam Frost{"video":"dominance: right;\\n\ud8d4\ude83\ud8fc\uddf1\u00d8\ud8ea\udd26\ud8d8\udde1.mov"} NN.] 33 O!)^frost2024/04/06 20:06:252026/08/01 18:10:09AS1dc10S2fe00S10006S2e104M525x515S1dc10475x485S2e104502x487adjective (of goods) having had a previous owner; not new: a secondhand car.
          adverb on the basis that something has had a previous owner: tips on the pitfalls to avoid when buying secondhand.Adam Frost{"video":"dominance: right;\\n\ud8d4\ude91\ud8fc\udc61\u00d8\ud8ed\udc65.mov"} SS)^ 33O !_frost2024/04/06 20:08:262026/07/31 23:16:24AS20320S2fe00S10006S1fb20S14a20S14051M516x543S20320498x458S1fb20498x477S14a20498x500S14051485x519noun a flat surface, especially one in a series, on which to place one's foot when moving from one level to another: the bottom step of the staircase | a flight of marble steps.
          • a doorstep: there was a pint of milk on the step.
          • a rung of a ladder.
          combining form denoting a relationship resulting from a remarriage: stepmother.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8d7\ude41\ud8c6\udfe1\ud8c6\udc52.mov"} HH$` 33' !-afrost2024/04/06 20:15:092026/05/19 06:02:48AS14c50S2fe00S14c58S2fe00S38006S22a00S22a10S2D_ 33[ O!}`frost2024/04/06 20:09:432026/05/19 06:01:36AS10041S2fe00S10049S2fe00S21400S20e00S22a05M529x528S10041487x478S10049471x473S20e00505x503S22a05516x514verb to make an opening, incision, or wound in (something) with a sharp-edged tool or object: he cut his toe on a sharp stone | when fruit is cut open, it turns brown.
          adjective [attributive] having one parent in common: half brother | half sister.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc42\ud8fc\udc61\ud8c0\udc4a\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8db\udfc6.mov"} activity: arrange the children in pairs so that each person has a partner | she and her dance partner were on the show for seven weeks.
          • a person or group that takes part with another or others in doing something: China is a major trading partner for Australia and the US.
          • any of a number of individuals with interests and investments in a business or enterprise, among whom expenses, profits, and losses are shared: a partner in a prosperous legal practice | a junior partner.
        2. either member of a married couple or of an established unmarried couple: she lived with her partner.
          • a person with whom one has sex; a lover: make sure that you or your partner are using an effective method of contraception.
        Adam Frost{"video":"dominance: right;\\n\ud8c8\ude02\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e7\udd85\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"}ht people.
      2. not under the influence of drugs or alcohol.
      3. (of an alcoholic drink) undiluted; neat: straight brandy.
      adverb
      1. in a straight line; directly: he was gazing straight at her | keep going straight.
        • with no delay or diversion; immediately: after dinner we went straight back to our hotel | I fell into bed and went straight to sleep.
      2. in or into a level, even, or upright position: hang the picture straight | sit up straight!.
      3. correctly; clearly: I'm so tired I can hardly think straight.
        • honestly and directly: I told her straight—the kid's right.
      4. without a break; continuously: he remembered working sixteen hours straight.
      noun
      1. a heterosexual person.
      2. (in poker) a continuous sequence of five cards.
      Adam Frost{"video":"dominance: right;\\n\ud8c6\udeb1\ud8f4\udec1\u00d8\ud8d8\udde1\ud8e1\udde1.mov"} <<hGb 33 q!%cfrost2024/04/06 21:26:582026/08/06 19:56:21AS15a41S2fe00S15a0aS2fe00S21400S20e00S2a404S15a40S2fe00S15a48S2fe00S38006S22a04S22a14M524x555S15a0a476x487S15a41491x476S20e00476x473S2a404499x446S15a40510x508S15a48478x508S22a04510x540S22a14478x540noun
      1. either of a pair of people engaged together in the sameea33[m/!}bfrost2024/04/06 21:21:212026/08/06 20:43:00AS15a41S2fe00S15a0aS2fe00S21400S20e00S2a404M524x527S15a0a476x515S15a41491x504S20e00476x501S2a404499x474M524x555S15a0a476x487S15a41491x476S20e00476x473S2a404499x446S15a40510x508S15a48478x508S22a04510x540S22a14478x540verb [with object] to have a portion of (something) with another or other0482x483S14c00491x501S26500526x503S18501521x484M549x532S33100482x483S14c00491x501S26a00522x503S18501521x484
        noun
        1. a wild carnivorous mammal of the dog family, living and hunting in packs.
          • used in names of mammals similar or related to the wolf, e.g. maned wolf, Tasmanian wolf.
        2. used figuratively to refer to a rapacious, ferocious, or voracious person or thing: he calls the media ravening wolves.
          • informal a man who habitually seduces women: he's the archetypal wolf in Armani threads.
        3. (in myth or fiction) a person who changes for periods of time into a wolf, typically when there is a full moon.
        INFLECTED FORMS
        wolf [in isolation]
        Adam Frost{"video":"dominance: right;\\n\ud8c7\udc81\ud8f4\udec1\u00d8\ud8e1\udde1\ud8cc\udde2.mov"} SGc 33 U!Udfrost2024/04/06 21:30:512026/07/28 19:28:30AS1f00eS30004S10006S20500M518x540S2ff00482x483S1f00e495x511adjective
        1. sexually or romantically attracted to people of one's own sex (used especially of a man): the city's gay and lesbian people | a gay couple | my friend is gay.
          • relating to or used by gay people: a gay bar | the gay vote can decide an election.
        2. derogatory, mainly offensive foolish, stupid, or unimpressive: making students wait for the light is kind of a gay rule.
        noun a person who is gay (typically referring to a man): the capital is a popular destination for gays and lesbians from all over the world.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d6\ude0f\ud8f0\udc05\u00d8\ud8d8\udde1.mov"} jjd 33) +!oefrost2024/04/06 21:31:242026/07/28 19:43:52AS1f000S2fe00S10006S1f720S19a20M518x529S1f000483x471S1f720492x490S19a20490x509adjective
        1. gay.
        2. dated lighthearted and carefree: Nan had a gay disposition and a very pretty face.
          • brightly colored; showy; brilliant: a gay profusion of purple and pink sweet peas.
        noun a gay person.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d6\ude01\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8ce\udde1.mov"} ^e 33o U!ffrost2024/04/07 01:25:202026/05/09 00:34:49AS15a10S30005S15a3aS2fe00S20500S22a03S15a32S38622S20500S1dc40S2fe00S15a18S2fe00S21406S20500S22a04S20500M527x616S2ff00482x483S15a10506x508S37806475x559S15a3a500x554S15a32472x542S22a03490x524S15a18485x587S1dc40498x571S22a04513x598S20500500x605noun the wife of one's child.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c8\uddd1\ud8f0\udc06\ud8c8\uddfb\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8c8\uddf3\ud8fc\ude63\ud8d8\udde1\ud8d4\udec1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8db\udfc5\ud8d8\udde1.mov"} AA;f 33 c!/gfrost2024/04/07 01:30:542026/05/04 03:56:28AS10120S2fe00S10006S17620M508x525S10120492x475S17620492x509verb
        1. to perform (an action, the precise nature of which is unspecified): she knew what to do | what can I do for you?.
        2. to affirm an action or statement previously mentioned: "you like to swim." "I do".
        noun an illness or condition that disrupts normal physical or mental functions: skin disorders | eating disorders | an improved understanding of mental disorder.Adam Frost{"video":"dominance: right;\\nfingerspelled: full (verb);\\nfingerspelled: abbreviated (noun);\\n\ud8c0\udc81\ud8fc\udc61\u00d8\ud8cb\udc61.mov"} yg 33A '!)hfrost2024/04/07 01:33:282026/05/09 00:35:11AS14a50S2fe00S14c59S2fe00S21400S2e736S20500M514x529S14c59486x503S14a50495x491S2e736489x472noun a formal agreement to get married: she'd broken off her engagement to Paul.
        • the duration of an agreement to get married: a good long engagement to give you time to be sure.
        adjective having formally agreed to marry: she was engaged to a lecturer | the newly engaged couple.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c7\udc11\ud8fc\udc61\ud8c7\udcda\ud8fc\udc61\ud8d9\udf81\ud8ed\uded7\ud8d8\udde1.mov"} jj!3h 335QY!3ifrost2024/04/07 01:48:292026/07/28 19:57:49AS1ce50S2fe00S14c59S2fe00S21400S20600M524x526S14c59494x500S1ce50502x474S20600477x495M515x526S14c59485x500S1ce50493x474noun [in isolation] a fiancé.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\nvisible: sign;\\n\ud8d3\udd91\ud8fc\udc61\ud8c7\udcda\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"}[i 33AQ!Kjfrost2024/04/07 01:53:392026/07/28 19:54:51AS1ce50S2fe00S14c59S2fe00S21400S2e736S20500M515x536S14c59485x510S1ce50493x484S2e736490x465M515x526S14c59485x500S1ce50493x474noun a phonological variant (circular movement) of fiancé.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\nvisible: sign;\\n\ud8d3\udd91\ud8fc\udc61\ud8c7\udcda\ud8fc\udc61\ud8d9\udf81\ud8ed\uded7\ud8d8\udde1.mov"} aj 33o [!kfrost2024/04/07 03:11:102026/05/09 00:36:30AS15a11S30007S15a3aS2fe00S20500S22a03S15a32S38622S20500S1dc40S2fe00S15a18S2fe00S21406S20500S22a04S20500M533x606S2ff00482x483S15a11510x488S37806477x544S15a3a502x539S15a32474x527S22a03508x516S15a18485x577S1dc40498x561S22a04513x588S20500500x595noun the husband of one's child.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c8\uddd2\ud8f0\udc08\ud8c8\uddfb\ud8fc\udc61\ud8d8\udde1\ud8db\udfc4\ud8c8\uddf3\ud8fc\ude63\ud8d8\udde1\ud8d4\udec1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8db\udfc5\ud8d8\udde1.mov"} Vk 33) a!Alfrost2024/04/07 15:13:102026/08/07 18:01:07AS14710S33200S10006S20500S26500M529x523S33100482x483S14710498x501S26500515x507adjective
        1. extending or moving uniformly in one direction only; without a curve or bend: a long, straight road.
          • (of hair) not curly or wavy.
          • (of an aim, blow, or course) going direct to the intended target: a straight punch to the face.
          • Geometry (of a line) lying on the shortest path between any two of its points.
        2. properly positioned so as to be level, upright, or symmetrical: he made sure his tie was straight.
        3. not evasive; honest: a straight answer | thank you for being straight with me.
        4. [attributive] in continuous succession: he scored his fourth straight win.
        5. (of a person) sexually or romantically attracted to people of the other sex: I was confused, I didn't know if I was gay or straight | straigasking questions | [no object] : the old man asked about her job | [with clause] : he asked if she wanted coffee | he asked whether his electric wheelchair would fit through their doors.
        6. to request (someone) to do or give something: Mary asked her father for money | [with object and infinitive] : I asked him to call the manager | [no object] : don't be afraid to ask for advice.
          • [with clause] to request permission to do something: she asked if she could move in | [with infinitive] : he asked to see the officer involved.
          • to expect or demand (something) of someone: it's asking a lot, but could you look through Billy's things?.

        INFLECTED FORMS
        ask [frequentative]
        ask [durative]Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8e1\udde1\ud8c0\ude61.mov"} `l 33 w!emfrost2024/04/07 15:18:482026/08/06 22:04:09AS11920S2fe00S10006S14720M511x526S11920490x474S14720497x504adjective denoting, having, or relating to a gender identity identity that is not exclusively male or female: the novelist identifies as nonbinary | nonbinary people are vastly under-represented in the media.
        noun a person who has a nonbinary gender identity: some enbies identify as neither male nor female, while others identify as both.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c2\udd81\ud8fc\udc61\u00d8\ud8c6\udec1.mov"} ))Sm 33O !Ynfrost2024/04/07 15:23:332026/08/06 22:03:43AS14c10S38510S10006S2df02S18531S20500M520x532S14c10497x468S2df02481x489S18531492x503S20500500x521adjective denoting or relating to a person whose gender identity does not correspond with the sex assigned at birth: Perry, who is trans, fought against her high school for her right to use the girls' locker room | trans rights and societal attitudes have changed.
        noun a person who has a gender identity that does not correspond with the sex assigned at birth: the film plays into negative stereotypes about trans people.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc91\ud8fc\uddf1\u00d8\ud8ec\udfa3\ud8cc\ude12\ud8d8\udde1.mov"} EAo 33) !epfrost2024/04/07 16:07:042026/04/23 23:49:05AS10e20S30004S10006S20500S2c601M537x543S10e20499x513S2ff00482x483S2c601518x512combined form a construction of the noun age (sense 1a) and the number two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c1\udd61\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42.mov"}7n 33) !eofrost2024/04/07 16:05:162026/04/23 23:48:57AS10020S30004S10006S20500S2c601M537x543S2ff00482x483S10020499x513S2c601518x512combined form a construction of the noun age (sense 1a) and one.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42.mov"} C8q 33) !erfrost2024/04/07 16:36:242026/04/23 23:49:22AS14420S30004S10006S20500S2c601M537x542S2ff00482x483S14420497x511S2c601518x512combined form a construction of the noun age (sense 1a) and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42.mov"}9p 33) !eqfrost2024/04/07 16:09:422026/04/23 23:49:13AS11e20S30004S10006S20500S2c601M537x543S2ff00482x483S11e20491x513S2c601518x512combined form a construction of the noun age (sense 1a) and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf61\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42.mov"} ~D~Bs 33) !etfrost2024/04/07 16:42:542026/04/23 23:49:38AS18720S30004S10006S20500S2c601M537x538S2ff00482x483S18720498x508S2c601518x512combined form a construction of the noun age (sense 1a) and the number six.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udec1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42.mov"}8r 33) !esfrost2024/04/07 16:37:522026/04/23 23:49:30AS14c20S30004S10006S20500S2c601M537x541S2ff00482x483S14c20495x510S2c601518x512combined form a construction of the noun age (sense 1a) and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42.mov"} C9u 33) !evfrost2024/04/07 17:06:342026/04/23 23:49:55AS1bb20S30004S10006S20500S2c601M537x541S2ff00482x483S1bb20498x513S2c601518x512combined form a construction of the noun age (sense 1a) and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d1\ude41\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42.mov"}9t 33) !eufrost2024/04/07 16:44:272026/04/23 23:49:46AS1a520S30004S10006S20500S2c601M537x540S2ff00482x483S1a520498x512S2c601518x512combined form a construction of the noun age (sense 1a) and seven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude01\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42.mov"} _9_Vw 33O !}xfrost2024/04/07 17:14:052026/04/23 23:50:13AS10010S30004S10006S20500S2c601S1f540M537x543S2ff00482x483S10010487x513S2c601513x512S1f540522x484combined form a construction of the noun age (sense 1a) and ten.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc11\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8d7\udc21.mov"}Cv 33) !ewfrost2024/04/07 17:09:322026/04/23 23:50:03AS1ce20S30004S10006S20500S2c601M531x543S2ff00482x483S1ce20492x513S2c601512x512combined form a construction of the noun age (sense 1a) and the number nine.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d3\udd61\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42.mov"} //ey 33i !}zfrost2024/04/07 17:32:302026/04/23 23:50:30AS10e00S30004S10006S20500S2c601S21d00M539x543S2ff00482x483S10e00487x513S2c601513x512S10e00522x478S21d00521x467combined form a construction of the noun age (sense 1a) and twelve.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c1\udd41\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8da\udee1.mov"}dx 33i !}yfrost2024/04/07 17:29:522026/04/23 23:50:21AS10000S30004S10006S20500S2c601S21d00M545x543S2ff00482x483S10000487x513S2c601513x512S10000522x478S21d00527x467combined form a construction of the noun age (sense 1a) and eleven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc01\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8da\udee1.mov"} **g{ 33i !}|frost2024/04/07 17:50:252026/04/23 23:50:49AS14700S30004S10006S20500S2c601S22114M541x538S2ff00482x483S14700493x512S2c601513x512S14700521x486S22114515x478combined form a construction of the noun age (sense 1a) and fourteen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udea1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8db\udc75.mov"}gz 33i !}{frost2024/04/07 17:43:122026/04/23 23:50:42AS12d00S30004S10006S20500S2c601S22114M545x541S2ff00482x483S12d00522x478S2c601513x512S12d00487x511S22114519x469combined form a construction of the noun age (sense 1a) and thirteen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c4\udce1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8db\udc75.mov"} y} 33u !~frost2024/04/07 18:12:402026/04/23 23:51:05AS18700S30004S10006S20500S2c601S18710S2e008M563x538S2ff00482x483S18700485x508S2c601512x512S18710521x480S2e008542x479combined form a construction of the noun age (sense 1a) and sixteen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udea1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8cc\udeb1\ud8ed\udc09.mov"}g| 33i !}}frost2024/04/07 17:53:122026/04/23 23:50:57AS15a00S30004S10006S20500S2c601S22114M541x538S2ff00482x483S15a00494x511S2c601513x512S15a00522x482S22114515x475combined form a construction of the noun age (sense 1a) and fifteen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c8\uddc1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8db\udc75.mov"} y~ 33u !frost2024/04/07 18:13:502026/04/23 23:51:13AS10000S30004S10006S20500S2c601S1f540S18720M559x543S2ff00482x483S10000487x513S2c601513x512S1f540522x484S18720541x479combined form a construction of the noun age (sense 1a) and sixteen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc01\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8d7\udc21\ud8cc\udec1.mov"} { 33u !frost2024/04/07 18:15:292026/04/23 23:51:20AS1a500S30004S10006S20500S2c601S1a510S2e008M563x541S2ff00482x483S1a500481x513S2c601512x512S1a510519x480S2e008542x479combined form a construction of the noun age (sense 1a) and seventeen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\udde1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8cf\uddf1\ud8ed\udc09.mov"} { 33u !frost2024/04/07 18:16:512026/04/23 23:51:28AS10000S30004S10006S20500S2c601S1f540S1a520M563x543S2ff00482x483S10000487x513S2c601513x512S1f540522x484S1a520542x480combined form a construction of the noun age (sense 1a) and seventeen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc01\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8d7\udc21\ud8cf\ude01.mov"} z 33u !frost2024/04/07 18:19:142026/04/23 23:51:36AS1bb00S30004S10006S20500S2c601S1bb10S2e008M563x541S2ff00482x483S1bb00481x513S2c601512x512S1bb10519x480S2e008542x479combined form a construction of the noun age (sense 1a) and eighteen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d1\ude21\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8d1\ude31\ud8ed\udc09.mov"} z 33u !frost2024/04/07 18:20:352026/04/23 23:51:44AS10000S30004S10006S20500S2c601S1f540S1bb20M563x543S2ff00482x483S10000487x513S2c601513x512S1f540522x484S1bb20542x480combined form a construction of the noun age (sense 1a) and eighteen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc01\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8d7\udc21\ud8d1\ude41.mov"} z 33u !frost2024/04/07 18:24:142026/04/23 23:51:51AS1ce00S30004S10006S20500S2c601S1ce10S2e008M565x543S2ff00482x483S1ce00486x513S2c601512x512S1ce10520x478S2e008544x479combined form a construction of the noun age (sense 1a) and nineteen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d3\udd41\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8d3\udd51\ud8ed\udc09.mov"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxbacbdcedfegfhgihjikjlkmlnmonpoqprqsrtsutvuwvxwyxzy{z|{}|~}~ k 33i !}frost2024/04/07 18:28:592026/04/23 23:52:06AS12420S30004S10006S20500S2c601S22114M557x543S2ff00482x483S12420492x513S2c601520x512S12420520x479S22114531x477combined form a construction of the noun age (sense 1a) and twenty-three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c3\udda1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8db\udc75.mov"}z 33u !frost2024/04/07 18:25:322026/04/23 23:51:59AS10000S30004S10006S20500S2c601S1f540S1ce20M564x543S2ff00482x483S10000487x513S2c601513x512S1f540522x484S1ce20542x478combined form a construction of the noun age (sense 1a) and nineteen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc01\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8d7\udc21\ud8d3\udd61.mov"}  33 !frost2024/04/07 18:56:362026/04/23 23:52:13AS18720S30004S10006S20500S2c601S20e00S22814M559x538S2ff00482x483S18720498x508S2c601518x512S18720521x481S20e00542x494S22814538x508combined form a construction of the noun age (sense 1a) and sixteen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udec1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8d9\udd41\ud8db\udf15.mov"}  33 !frost2024/04/07 18:57:592026/04/23 23:52:21AS1a520S30004S10006S20500S2c601S20e00S22814M559x541S2ff00482x483S1a520498x513S2c601518x512S1a520520x482S20e00542x494S22814538x508combined form a construction of the noun age (sense 1a) and seventeen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude01\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8d9\udd41\ud8db\udf15.mov"}  33 !frost2024/04/07 19:00:042026/04/23 23:52:29AS1bb20S30004S10006S20500S2c601S20e00S22814M559x541S2ff00482x483S1bb20498x513S2c601518x512S1bb20520x482S20e00542x494S22814538x508combined form a construction of the noun age (sense 1a) and eighteen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d1\ude41\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8d9\udd41\ud8db\udf15.mov"}  33 !frost2024/04/07 19:01:492026/04/23 23:52:38AS1ce20S30004S10006S20500S2c601S20e00S22814M559x543S2ff00482x483S1ce20491x513S2c601516x512S1ce20520x480S20e00542x494S22814538x508combined form a construction of the noun age (sense 1a) and nineteen.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d3\udd61\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8d9\udd41\ud8db\udf15.mov"} j 33i !}frost2024/04/07 19:11:582026/04/23 23:52:53AS1dc20S30004S10006S20500S2c601S21802M552x543S2ff00482x483S1dc20491x513S2c601520x512S1dc20528x479S21802519x493combined form a construction of the noun age (sense 1a) and twenty-one.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d4\udea1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8da\udd03.mov"}x 33u !frost2024/04/07 19:05:262026/04/23 23:52:45AS1dc20S30004S10006S20500S2c601S1f420S22114M548x543S2ff00482x483S1dc20491x513S2c601520x512S1f420519x492S22114515x482combined form a construction of the noun age (sense 1a) and twenty.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d4\udea1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8d6\udfa1\ud8db\udc75.mov"}  33 !-frost2024/04/07 19:23:072026/04/23 23:53:01AS10e20S30004S10006S20500S2c601S10e50S26606S22f04M571x543S2ff00482x483S10e20500x513S2c601520x512S10e50544x478S26606541x505S22f04538x516combined form a construction of the noun age (sense 1a) and twenty-two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c1\udd61\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8c1\udd91\ud8e1\ude47\ud8dc\udda5.mov"} ;;^ 33O !}frost2024/04/07 20:04:082026/04/23 23:53:18AS1dc20S30004S10006S20500S2c601S14420M545x543S2ff00482x483S1dc20491x513S2c601520x512S14420523x478combined form a construction of the noun age (sense 1a) and twenty-four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d4\udea1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8c6\udda1.mov"}_ 33O !}frost2024/04/07 20:00:182026/04/23 23:53:10AS1dc20S30004S10006S20500S2c601S11e20M542x543S2ff00482x483S1dc20491x513S2c601520x512S11e20519x479combined form a construction of the noun age (sense 1a) and twenty-three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d4\udea1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8c2\udf61.mov"} //^ 33O !}frost2024/04/07 20:18:092026/04/23 23:53:35AS1dc20S30004S10006S20500S2c601S14c20M544x543S2ff00482x483S1dc20491x513S2c601520x512S14c20521x477combined form a construction of the noun age (sense 1a) and twenty-five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d4\udea1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8c7\udca1.mov"}k 33i !}frost2024/04/07 20:15:122026/04/23 23:53:26AS1c520S30004S10006S20500S2c601S22114M555x542S2ff00482x483S1c520479x514S2c601520x512S1c520525x484S22114513x482combined form a construction of the noun age (sense 1a) and twenty-five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d2\ude01\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8db\udc75.mov"} 44^ 33[ _!!frost2024/04/07 20:29:532026/04/23 23:54:12AS11e02S2fe00S10028S2fe00S21414S20e00S22a04M521x529S10028479x478S11e02491x472S20e00503x498S22a04502x514combined form a construction of month and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf43\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8db\udfc5.mov"}f 33[ o!!frost2024/04/07 20:21:222026/04/23 23:54:05AS10e02S2fe00S10028S2fe00S21414S20e00S22a04M521x526S10028479x475S10e02491x477S20e00503x495S22a04502x511combined form a construction of month and the number two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c1\udd43\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8db\udfc5.mov"} >>] 33[ ]!!frost2024/04/07 20:37:492026/04/23 23:54:27AS14c02S2fe00S10028S2fe00S21414S20e00S22a04M522x528S10028479x480S14c02491x472S20e00503x497S22a04502x513combined form a construction of month and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udc83\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8db\udfc5.mov"}] 33[ ]!!frost2024/04/07 20:31:562026/04/23 23:54:19AS14402S2fe00S10028S2fe00S21414S20e00S22a04M522x528S10028479x477S14402491x472S20e00503x497S22a04502x513combined form a construction of month and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udd83\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8db\udfc5.mov"} 33^ 33[ _!!frost2024/04/07 20:43:012026/04/23 23:54:43AS1a502S2fe00S10028S2fe00S21414S20e00S22a04M520x528S10028480x473S1a502492x475S20e00504x497S22a04503x513combined form a construction of month and seven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\udde3\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8db\udfc5.mov"}g 33[ q!!frost2024/04/07 20:40:042026/04/23 23:54:35AS18702S2fe00S10028S2fe00S21414S20e00S22a04M521x525S10028480x481S18702492x475S20e00505x495S22a04504x510combined form a construction of month and the number six.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udea3\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8db\udfc5.mov"} 22h 33[ s!!frost2024/04/07 20:45:062026/04/23 23:54:59AS1ce02S2fe00S10028S2fe00S21414S20e00S22a04M521x528S10028479x479S1ce02491x473S20e00503x498S22a04502x513combined form a construction of month and the number nine.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d3\udd43\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8db\udfc5.mov"}^ 33[ _!!frost2024/04/07 20:43:582026/04/23 23:54:51AS1bb02S2fe00S10028S2fe00S21414S20e00S22a04M520x528S10028480x473S1bb02492x474S20e00504x497S22a04503x513combined form a construction of month and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d1\ude23\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8db\udfc5.mov"} ##Y33[e!}frost2024/04/09 16:57:202026/08/16 20:44:11AS15a50S2fe00S2035aS2fe00S21400S20e00S22114M524x518S2035a476x482S15a50483x491S20e00505x491S22114498x506M510x536S2035a490x464S15a50497x473S26504496x503S1f720490x521 M516x533S14051485x467S14a20498x495S1fb20498x514verb [frequentative] to summon/stroke.
        • to treat with special attention or indulgence: the grandparents spoiled the children whenever they visited.
        noun, adjective pet.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8db\udc75.mov"}   33) I!Afrost2024/04/09 17:06:322025/03/04 18:24:47AS11020S30004S10006S20500S2dd06M539x540S2ff00482x483S11020504x513S2dd06523x482noun a long limbless reptile which has no eyelids, a short tail, and jaws that are capable of considerable extension. Some snakes have a venomous bite.Adam Frost{"video":"dominance: right;\\n\ud8c1\ude21\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ec\udee7.mov"}] 33) o!Afrost2024/04/09 17:04:302025/03/04 16:45:29AS10e12S38404S10006S20500S21d02M518x534S2ff00482x483S10e12480x519S21d02468x516noun a tailless amphibian with a short squat body, moist smooth skin, and very long hind legs for leaping.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd53\ud8fc\udd85\u00d8\ud8d8\udde1\ud8da\udee3.mov"} OOJ 335 i!frost2024/04/09 17:20:042025/03/04 16:52:14AS14e01S38511S14e09S38517S20e00S20e00S21800S21800M549x528S37600489x505S14e01466x483S14e09507x483S20e00452x486S20e00537x486S21800517x473S21800466x473noun a large, heavy mammal that walks on the soles of its feet, having thick fur and a very short tail.Adam Frost{"video":"dominance: right;\\n\ud8c7\udd42\ud8fc\uddf2\ud8c7\udd4a\ud8fc\uddf8\ud8d9\udd41\ud8d9\udd41\ud8da\udd01\ud8da\udd01.mov"}_ 33i !efrost2024/04/09 17:10:002025/03/04 16:51:16AS10601S38511S10609S38517S20600S20600M536x529S37600488x506S10601471x484S10609506x484S20600464x472S20600514x472noun a mainly nocturnal mammal capable of sustained flight, with membranous wings that extend between the fingers and connecting the forelimbs to the body and the hind limbs to the tail.Adam Frost{"video":"dominance: right;\\n\ud8c0\ude42\ud8fc\uddf2\ud8c0\ude4a\ud8fc\uddf8\ud8d8\ude41\ud8d8\ude41.mov"} Hy 33) '!Afrost2024/04/09 17:38:122025/03/04 16:54:56AS15a20S33200S10006S20500S2c101M533x533S33100482x483S15a20494x506S2c101510x502noun a heavy plant-eating mammal with a prehensile trunk, long curved ivory tusks, and large ears, native to Africa and southern Asia.Adam Frost{"video":"dominance: right;\\n\ud8c8\udde1\ud8f4\udec1\u00d8\ud8d8\udde1\ud8ea\udc62.mov"}4 33u !}frost2024/04/09 17:26:522026/05/03 22:06:53AS14e03S38537S14e0bS38531S20e00S22f00S22f10M540x523S14e03511x495S14e0b463x495S20e00495x506S22f00515x477S22f10461x478noun a small to medium-sized primate that typically has a long tail, most kinds of which live in trees in tropical countries.Adam Frost{"video":"dominance: equal;\\n\ud8c7\udd44\ud8fc\ude18\ud8c7\udd4c\ud8fc\ude12\ud8d9\udd41\ud8dc\udda1\ud8dc\uddb1.mov"} xNxR! 33 -!frost2024/04/09 17:41:262026/05/03 22:07:11AS14e02S30006S14e0aS30002S20e00S20e00S21800S21800M541x524S2ff00482x483S14e02510x489S14e0a459x489S21800511x516S21800471x516noun a very large solitary cat with a yellow-brown coat striped with black, native to the forests of Asia but becoming increasingly rare.Adam Frost{"video":"dominance: equal;\\n\ud8c7\udd43\ud8f0\udc07\ud8c7\udd4b\ud8f0\udc03\ud8d9\udd41\ud8d9\udd41\ud8da\udd01\ud8da\udd01.mov"}. 33 5!)frost2024/04/09 17:39:272025/03/04 16:59:25AS14e04S38400S10006S2b705M529x518S2ff00482x483S14e04486x451S2b705515x454noun a large tawny-colored cat that lives in prides, found in Africa and northwestern India. The male has a flowing shaggy mane and takes little part in hunting, which is done cooperatively by the females.Adam Frost{"video":"dominance: right;\\n\ud8c7\udd45\ud8fc\udd81\u00d8\ud8e9\udca6.mov"} tA#33C#!Afrost2024/04/10 14:50:342026/09/19 21:24:10AS14c00S33200S10006S26500S18501M548x532S3310" 33 i!)frost2024/04/09 17:49:032025/03/04 17:09:06AS16d0eS36a00S10006S22a00M526x542S36a00482x477S16d0e489x525S22a00513x508noun a large African mammal with a very long neck and forelegs, having a coat patterned with brown patches separated by lighter lines. It is the tallest living animal.Adam Frost{"video":"dominance: right;\\n\ud8ca\udcef\ud8f9\udfc1\u00d8\ud8db\udfc1.mov"} for lunch?.
      2. to continue in a specified state or position: her ability to stay calm | tactics used to stay in power | I managed to stay out of trouble.
        • to persist in a state or position without yielding to change: even after hours of discussion, they wouldn’t budge.
      3. (of a person) to live somewhere temporarily as a visitor or guest: the girls had gone to stay with friends | Minton invited him to stay the night.
      noun a period of living somewhere temporarily as a visitor or guest: an overnight stay at a luxury hotel.

      PHONOLOGICAL VARIANTS
      stay with right hand movement

      INFLECTED FORMS
      stay [at center locus]Adam Frost{"video":"dominance: equal;\\n\ud8ce\ude11\ud8fc\udc61\ud8ce\ude19\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"} G$ 33 s!-frost2024/04/10 14:56:452026/08/03 17:51:36AS14e51S2fe00S14e59S2fe00S21400S20500S22511S22517S26520M536x522S14e59497x493S14e51476x493S22511465x484S22517518x484S26520493x478noun an eight-legged predatory arachnid with an unsegmented body consisting of a fused head and thorax and a rounded abdomen. Adam Frost{"video":"dominance: right;\\n\ud8c7\udd92\ud8fc\udc61\ud8c7\udd9a\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8db\uddf2\ud8db\uddf8\ud8e1\ude01.mov"} $$uj& 33 -!)frost2024/04/10 15:30:382026/08/03 19:35:20AS19a12S38621S10006S2990aM537x517S37605464x485S19a12482x483S2990a505x489noun a very large marine mammal with a streamlined hairless body, a horizontal tail fin, and a blowhole on top of the head for breathing.Adam Frost{"video":"dominance: right;\\n\ud8ce\uddd3\ud8fc\ude62\u00d8\ud8e6\udd6b.mov"}j% 33) !Afrost2024/04/10 15:01:172026/08/03 18:02:10AS18211S38404S10006S20500S22125M518x535S2ff00482x483S18211485x518S22125475x516noun
      1. an omnivorous domesticated hoofed mammal with sparse bristly hair and a flat snout for rooting in the soil, kept for its meat.
        • the flesh of a pig as food; pork.
      2. informal a greedy, dirty, or unpleasant person: you're such a pig when it comes to sleep.
      Adam Frost{"video":"dominance: right;\\n\ud8cc\udcd2\ud8fc\udd85\u00d8\ud8d8\udde1\ud8db\udc86.mov"} H' 33 i!)frost2024/04/10 15:33:392026/08/03 19:36:22AS13302S38631S10006S2990eM542x516S37605459x484S13302512x486S2990e477x491noun a small gregarious toothed whale that typically has a beaklike snout and a curved fin on the back.Adam Frost{"video":"dominance: right;\\n\ud8c4\udf23\ud8fc\ude72\u00d8\ud8e6\udd6f.mov"} DD8(33gq-!frost2024/04/10 16:12:542026/08/03 19:49:47AS15a40S2fe00S15a48S2fe00S21406S26b02S26b16S20600M534x514S15a40501x487S15a48487x487S26b02516x487S26b16467x487S38b00470x493 M534x526S15a40487x474S15a48501x474S26b06467x474S26b12516x474S3780a489x493S37802494x494 S38b04470x493noun a fish-eating aquatic mammal with a streamlined body and feet developed as flippers, that returns to land to breed or rest.

      PHONOLOGICAL VARIANTS
      seal crossed at wristsAdam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8e2\udc23\ud8e2\udc37\ud8d8\ude41.mov"} )33!7frost2024/04/10 16:13:522026/08/03 19:48:54AS15a40S2fe00S15a48S2fe00S21402S26b06S26b12S20600M534x526S15a40487x474S15a48501x474S26b06467x474S26b12516x474S3780a489x493S37802494x494M534x514S15a40501x487S15a48487x487S26b02516x487S26b16467x487noun a phonological variant (crossed at wrists) of seal.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf83\ud8e2\udc27\ud8e2\udc33\ud8d8\ude41.mov"} Q* 33[k !}frost2024/04/10 16:28:422026/08/07 18:36:27AS14710S2fe00S14c58S2fe00S21410S20700S26520M517x534S14710484x488S14c58488x503S20700499x485S26520493x467M533x518S2ff00482x483S14710493x469S20600511x473noun a shark.
      verb [center to front loci] (of a shark) to move or swim, especially with the dorsal fin visible above the surface: a shark moved toward the surfers.Adam Frost{"video":"dominance: right;\\n\ud8c6\udeb1\ud8fc\udc61\ud8c7\udcd9\ud8fc\udc61\ud8d9\udf91\ud8d8\udea1\ud8e1\ude01.mov"} -%+33)!)frost2024/04/10 16:33:042026/08/07 18:36:00AS14710S30000S10006S20600M533x518S2ff00482x483S14710493x469S20600511x473M517x534S14710484x488S14c58488x503S20700499x485S26520493x467noun a large, long-bodied marine fish with a cartilaginous skeleton, a prominent dorsal fin, and toothlike scales.

      SIGN VARIATIONS
      shark (noun) with B-hand between fingersAdam Frost{"video":"dominance: right;\\n\ud8c6\udeb1\ud8f0\udc01\u00d8\ud8d8\ude41.mov"} 33I, 33 !frost2024/04/10 16:44:292026/08/03 19:59:28AS15a01S2fe00S15a09S2fe00S21414S20800S22115S22113M533x518S15a09497x495S15a01481x495S20800496x491S22115468x482S22113514x482noun a nectar-feeding insect with two pairs of large, typically brightly colored wings that are covered with microscopic scales.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc2\ud8fc\udc61\ud8c8\uddca\ud8fc\udc61\ud8d9\udf95\ud8d8\udf01\ud8db\udc76\ud8db\udc74.mov"} TL- 33) M!Afrost2024/04/10 16:47:372026/08/07 19:23:35AS18520S33d00S10006S20500S22114M518x528S33b00482x483S18520479x513S22114455x507noun a waterbird with a broad blunt bill, short legs, webbed feet, and a waddling gait.
      proper noun (the Ducks) an informal group of Gallaudet University alumni who became influential behind the scenes in the movement that led to the historic 1988 Deaf President Now (DPN) protest. Adam Frost{"video":"dominance: right;\\n\ud8cc\ude01\ud8f5\udee1\u00d8\ud8d8\udde1\ud8db\udc75.mov"} d/ 33 !!)frost2024/04/10 16:52:032026/08/03 20:00:53AS10620S33200S10006S20600M518x531S33100482x483S10620495x505S20600476x519noun a large bird of prey with a massive hooked bill and long broad wings, renowned for its keen sight and powerful soaring flight.Adam Frost{"video":"dominance: right;\\n\ud8c0\ude61\ud8f4\udec1\u00d8\ud8d8\ude41.mov"}w. 33) #!Afrost2024/04/10 16:49:452025/02/20 19:12:28AS1f011S30004S10006S20500S2c500M554x537S2ff00482x483S1f011480x512S2c500514x513noun a large mainly domesticated game bird native to North America, having a bald head and (in the male) red wattles. It is prized as food, especially on festive occasions such as Thanksgiving and Christmas. Adam Frost{"video":"dominance: right;\\n\ud8d6\ude12\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\udde1.mov"} ,, 1 33) u!Afrost2024/04/10 16:57:002026/08/03 20:13:49AS19a20S30007S10006S20500S2c400M548x518S2ff00482x483S19a20515x482S2c400508x456noun
      1. a fully grown female animal of a domesticated breed of ox, kept to produce milk or beef: a dairy cow.
        • (loosely) a domestic bovine animal, regardless of sex or age.
        • large ruminant animals with horns and cloven hoofs, domesticated for meat or milk, or as beasts of burden.
      2. derogatory an unpleasant or disliked woman: what does he see in that cow?.
      Adam Frost{"video":"dominance: right;\\n\ud8ce\udde1\ud8f0\udc08\u00d8\ud8d8\udde1\ud8ea\udd81.mov"},0 33 1!)frost2024/04/10 16:54:062026/08/03 20:06:54AS19a20S30000S10006S20600M535x518S2ff00482x483S19a20486x470S20600513x477noun an uncastrated male bovine animal: [as modifier] : bull calves.Adam Frost{"video":"dominance: right;\\n\ud8ce\udde1\ud8f0\udc01\u00d8\ud8d8\ude41.mov"} CCZ3 33[ }!}frost2024/04/10 17:05:142026/08/08 18:16:38AS18520S2fe00S18528S2fe00S38006S22114S22114M533x513S18520508x498S18528468x498S22114507x488S22114468x488noun a crustacean with broad, clamp-like pincers.Adam Frost{"video":"dominance: equal;\\n\ud8cc\ude01\ud8fc\udc61\ud8cc\ude09\ud8fc\udc61\ud8fc\udc07\ud8db\udc75\ud8db\udc75.mov"}[2 33[ !}frost2024/04/10 17:02:502026/08/08 18:20:50AS10e50S2fe00S10e58S2fe00S38006S22716S22712M533x515S10e50518x485S10e58468x485S22716505x485S22712486x485noun a crustacean with long, scissor-like pincers.Adam Frost{"video":"dominance: equal;\\n\ud8c1\udd91\ud8fc\udc61\ud8c1\udd99\ud8fc\udc61\ud8fc\udc07\ud8db\udeb7\ud8db\udeb3.mov"} GGV5 33i !efrost2024/04/10 18:46:122026/08/08 16:59:08AS14c20S30007S14c28S30001S20600S20600M541x518S2ff00482x483S14c20515x472S14c28462x472S20600519x505S20600459x505noun a hoofed mammal, especially one with antlers.Adam Frost{"video":"dominance: equal;\\n\ud8c7\udca1\ud8f0\udc08\ud8c7\udca9\ud8f0\udc02\ud8d8\ude41\ud8d8\ude41.mov"}[4 335 ;!efrost2024/04/10 17:10:182026/08/08 16:30:56AS14e50S2fe00S14e38S2fe00S21400S20600M520x525S14e38480x494S14e50494x488S20600492x475noun a large semiaquatic reptile with a long body, powerful tail, and long jaws.Adam Frost{"video":"dominance: right;\\n\ud8c7\udd91\ud8fc\udc61\ud8c7\udd79\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} ))7 33O }!Yfrost2024/04/12 19:18:442026/08/08 18:43:24AS10010S2fe00S10006S21800S26502S10610M526x518S10010511x488S26502492x504S10610474x492S21800476x482noun a small free-swimming crustacean with an elongated body, typically marine and frequently harvested for food.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc11\ud8fc\udc61\u00d8\ud8da\udd01\ud8e1\udde3\ud8c0\ude51.mov"}L6 335 !efrost2024/04/10 18:49:472026/08/09 17:07:32AS11010S2fe00S11018S2fe00S21406S20600M516x520S11010501x493S11018485x493S20600489x480noun a gnawing rodent, especially one with prominent front teeth.Adam Frost{"video":"dominance: equal;\\n\ud8c1\ude11\ud8fc\udc61\ud8c1\ude19\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"} nd833);!ofrost2024/04/12 19:21:062026/08/09 18:21:22AS14720S2fe00S10006S14a20S14a20M508x530S14720494x470S14a20493x496S14a20493x515M542x538S2ff00482x471S2ff10482x500S1ce10516x474S15a20515x511S26500528x518noun
      1. a bee.
      2. [with modifier] a meeting for communal work or amusement: a quilting bee.
        • a competition centered on a particular activity: a spelling bee.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udec1\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8c6\udfe1.mov"} j9 33uk/!qfrost2024/04/12 19:23:012026/08/16 21:35:47AS1ce10S30005S10006S20500S15a20S20e00S26500M542x538S2ff00482x471S2ff10482x500S1ce10516x474S15a20515x511S26500528x518M508x530S14720494x470S14a20493x496S14a20493x515noun
      1. a stinging winged insect that collects nectar and pollen, produces wax and honey, and lives in large communities; honeybee.
      2. an insect of a large group to which the honeybee belongs, including many solitary as well as social kinds.

      SIGN VARIATIONS
      bee (sense 1) fingerspelledAdam Frost{"video":"dominance: right;\\n\ud8d3\udd51\ud8f0\udc06\u00d8\ud8d8\udde1\ud8c8\udde1\ud8d9\udd41\ud8e1\udde1.mov"} /: 33 7!)frost2024/04/12 19:25:432026/05/26 02:55:24AS14017S38506S10006S27106M565x520S36d00479x504S14017524x485S27106550x480pronoun [at center and right loci] used to refer to the signer and one other person or thing: the two of us will take care of you.
      determiner [at center and right loci] used to indicate that something is associated with the signer and one other person or thing: this is our mistake, not yours.Adam Frost{"video":"dominance: right;\\n\ud8c6\udc18\ud8fc\udde7\u00d8\ud8e2\ude67.mov"} O; 33 !)frost2024/04/12 19:28:092026/05/26 03:40:15AS14001S2fe00S10006S27100M520x522S14001486x498S27100480x479pronoun [at center and front loci] used to refer to the signer and one other person or thing: you and I are working on the project.
      determiner [at center and front loci] used to indicate that something belongs to or is associated with the signer and one other person or thing: this is our plan, so don't worry about what anyone else says.Adam Frost{"video":"dominance: right;\\n\ud8c6\udc02\ud8fc\udc61\u00d8\ud8e2\ude61.mov"} FA= 33 u!)frost2024/04/12 19:45:432026/05/26 03:40:58AS11e31S2fe00S10006S2ea32M516x525S11e31491x495S2ea32484x475pronoun [at front locus] used to refer to three people or things: you three need to sit down.
      determiner [at front locus] used to indicate three people or things: I talked to these three students.Adam Frost{"video":"dominance: right;\\n\ud8c2\udf72\ud8fc\udc61\u00d8\ud8ed\udff3.mov"}6< 33 _!)frost2024/04/12 19:39:122026/05/26 03:40:36AS14047S2fe00S10006S27106M522x520S14047479x485S27106507x480pronoun [at front locus] used to refer to two people or things: you two need to pay attention.
      determiner [at front locus] used to indicate two people or things: I like those two books.Adam Frost{"video":"dominance: right;\\n\ud8c6\udc48\ud8fc\udc61\u00d8\ud8e2\ude67.mov"} .> 33 5!)frost2024/04/12 19:56:062026/05/26 03:41:12AS11e31S38510S10006S2ea32M521x529S36d00479x471S11e31488x499S2ea32481x479pronoun [at center and front loci] used to refer to the signer and two other people or things: the three of us need to talk.
      determiner [at center and front loci] used to indicate that something belongs to or is associated with the signer and two other people or things: this is our decision.Adam Frost{"video":"dominance: right;\\n\ud8c2\udf72\ud8fc\uddf1\u00d8\ud8ed\udff3.mov"} E? 33 c!)frost2024/04/12 20:06:222026/05/26 02:55:50AS11e31S38506S10006S2ea32M552x525S36d00479x505S11e31527x495S2ea32520x476pronoun [at center and right loci] used to refer to the signer and two other people or things: the three of us can handle your dog.
      determiner [at center and right loci] used to indicate that something belongs to or is associated with the signer and two other people or things: that's our responsibility, not yours.Adam Frost{"video":"dominance: right;\\n\ud8c2\udf72\ud8fc\udde7\u00d8\ud8ed\udff3.mov"} BB:@ 33 g!)frost2024/04/12 20:07:512026/05/26 03:41:34AS14431S2fe00S10006S2ea32M516x524S14431488x495S2ea32484x477pronoun [at front locus] used to refer to four people or things: you four need to wait.
      determiner [at front locus] used to indicate four people or things: those four students need to wait.Adam Frost{"video":"dominance: right;\\n\ud8c6\uddb2\ud8fc\udc61\u00d8\ud8ed\udff3.mov"} QA 33 {!)frost2024/04/12 20:10:262026/05/26 03:42:04AS14431S38510S10006S2ea32M521x528S36d00479x473S14431485x499S2ea32482x480pronoun [at center and front loci] used to refer to the signer and three other people or things: the four of us need to make a decision before the next meeting.
      determiner [at center and front loci] used to indicate that something belongs to or is associated with the signer and three other people or things: that was our idea.Adam Frost{"video":"dominance: right;\\n\ud8c6\uddb2\ud8fc\uddf1\u00d8\ud8ed\udff3.mov"} LB 33 q!)frost2024/04/12 20:11:402026/05/26 02:56:06AS14431S38506S10006S2ea32M554x524S36d00479x497S14431526x495S2ea32523x476pronoun [at center and right loci] used to refer to the signer and three other people or things: the four of us will take care of your paperwork.
      determiner [at center and right loci] used to indicate that something belongs to or is associated with the signer and three other people or things: this is our team, not yours.Adam Frost{"video":"dominance: right;\\n\ud8c6\uddb2\ud8fc\udde7\u00d8\ud8ed\udff3.mov"} >>>C 33 o!)frost2024/04/12 20:52:152026/05/26 03:42:23AS14c31S2fe00S10006S2ea32M514x523S14c31488x496S2ea32486x477pronoun [at front locus] used to refer to five people or things: you five are on the team.
      determiner [at front locus] used to refer to five people or things: those five movies are my favorite.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcb2\ud8fc\udc61\u00d8\ud8ed\udff3.mov"} 4D 33 A!)frost2024/04/12 20:54:412026/05/26 03:42:37AS14c31S38510S10006S2ea32M521x527S36d00479x473S14c31484x500S2ea32481x481pronoun [at center and front loci] used to refer to the signer and four other people or things: the five of us need to stay.
      determiner [at center and front loci] used to indicate that something belongs to or is associated with the signer and four other people or things: our proposal was accepted.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcb2\ud8fc\uddf1\u00d8\ud8ed\udff3.mov"} CE 33 _!)frost2024/04/12 20:55:352026/05/26 02:56:28AS14c31S38506S10006S2ea32M552x523S36d00479x497S14c31526x496S2ea32523x477pronoun [at center and right loci] used to refer to the signer and four other people or things: the five of us will wait for you.
      determiner [at center and right loci] used to indicate that something belongs to or is associated with the signer and four other people or things: here is our section for your report.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcb2\ud8fc\udde7\u00d8\ud8ed\udff3.mov"} @@4G 33[ /!}frost2024/04/13 01:01:382026/08/03 20:35:09AS14e30S2fe00S14e38S2fe00S38006S2a204S2a21cM535x532S14e30509x469S14e38465x469S2a204510x504S2a21c466x504combining form not want.Adam Frost{"video":"dominance: equal;\\n\ud8c7\udd71\ud8fc\udc61\ud8c7\udd79\ud8fc\udc61\ud8fc\udc07\ud8e7\udcc5\ud8e7\udcdd.mov"}F 33[ M!}frost2024/04/13 00:59:542026/08/10 00:11:57AS15a30S2fe00S15a38S2fe00S38006S23600S23614M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507adverb used to indicate that something is uncertain or not definite: maybe I won't go back.
      modal verb used to indicate that something is uncertain or not definite: he said he might be late.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddf1\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8fc\udc07\ud8dd\udc41\ud8dd\udc55.mov"} GG:I 33g g!Efrost2024/04/13 01:08:132025/03/05 17:13:13AS14c02S38510S14c0aS38530S20500S20500S26500S26510S1bb02S1bb0aM530x547S14c02499x496S14c0a471x516S20500517x516S20500475x536S26500513x478S26510474x498S1bb02502x454S1bb0a471x474adjective arousing curiosity or interest; holding or catching the attention: an interesting debate | it will be very interesting to see what they come up with.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc83\ud8fc\uddf1\ud8c7\udc8b\ud8fc\ude11\ud8d8\udde1\ud8d8\udde1\ud8e1\udde1\ud8e1\uddf1\ud8d1\ude23\ud8d1\ude2b.mov"}wH 33 I!Afrost2024/04/13 01:04:382025/03/13 01:46:03AS15a04S2fe01S10006S26b04M514x525S15a04495x476S26b04487x507adverb indicates that something has not happened up to the present time but is expected or possible in the future: the bus hasn’t arrived yet.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc5\ud8fc\udc61\ud8fc\udd25\u00d8\ud8e2\udc25.mov"} $$XJ 33u E!frost2024/04/13 01:35:442026/04/23 23:55:20AS1dc20S30004S10006S20500S2c601S1f420S22104M548x543S2ff00482x483S1dc20491x513S2c601520x512S1f420519x492S22104520x482combined form a construction of the noun age (sense 1a) and twenty.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d4\udea1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ea\ude42\ud8d6\udfa1\ud8db\udc65.mov"} ``K 33O /!Yfrost2024/04/13 02:34:202026/08/03 20:27:28AS10043S38517S10006S20500S2d600S20500M532x518S10043502x482S20500494x506S2d600470x492S20500469x507pronoun used by a speaker to refer to himself or herself and one or more other people considered together: shall we have a drink?. Adam Frost{"video":"dominance: right;\\n\ud8c0\udc44\ud8fc\uddf8\u00d8\ud8d8\udde1\ud8ec\udc41\ud8d8\udde1.mov"} HH4L 33u !!qfrost2024/04/13 02:38:002026/08/03 20:33:03AS10043S38517S10006S20500S2880eS1004dS20500M532x530S10043502x480S20500494x504S2880e476x518S20500469x505S1004d476x471pronoun used by a speaker to refer to himself or herself and one or more other people considered together, especially those who are physically present: shall we have a drink?. Adam Frost{"video":"dominance: right;\\n\ud8c0\udc44\ud8fc\uddf8\u00d8\ud8d8\udde1\ud8e4\udf0f\ud8c0\udc4e\ud8d8\udde1.mov"}8or produce (something) for inspection: every salesperson should show an ID card | he wants to show you all his woodwork stuff.
    2. to put on display in an exhibition or competition: he ceased early in his career to show his work | showing a large dog is not always easy | [no object] : other artists who showed there included Robert Motherwell.
    3. to present (a movie or television program) on a screen for public viewing: ITV showed The Enforcer on Saturday night.
    4. (of a movie) to be presented on a screen for public viewing: a movie showing at the Venice Film Festival.
    5. to indicate (a particular time, measurement, etc.): a travel clock showing the time in different cities.
    6. to represent or depict in art: a postcard showing the Wicklow Mountains.
    7. to display or allow to be perceived (a quality, emotion, or characteristic): it was Frank's turn to show his frustration | her students had shown great courage | the whole uuM33)Ks!Afrost2024/04/17 19:13:062026/06/05 17:28:38AS10020S2fe00S10006S26500S10620M511x538S10020496x508S26500497x492S10620490x463M514x538S10020493x508S26a00487x491S10620487x462 M529x515S10020514x485S2ea00496x488S10620472x489verb [center to front loci]
      1. to say something in order to obtain an answer or some information: [with object] : people are always  ]]N 33C Y!Afrost2024/04/17 19:17:422026/05/19 06:11:05AS14c01S2ff00S10006S2e300S18500M536x547S2ff00482x483S14c01491x493S2e300489x520S18500512x522adjective pleasing the senses or mind aesthetically: beautiful poetry | a beautiful young woman | the mountains were calm and beautiful.
        • of a very high standard; excellent: she spoke in beautiful English | the house had been left in beautiful order.
        adverb [as submodifier] informal to a moderately high degree; fairly: he looked pretty fit for his age.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc82\ud8ef\udfa1\u00d8\ud8ed\udd21\ud8cc\udde1.mov"} O 33G!Gfrost2024/04/17 19:20:292026/05/03 23:55:44AS10053S2ff00S10006S2e300M531x523S2ff00482x483S10053510x465S2e300495x496M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M519x544S2ff00482x483S10001498x492S2ed00494x521 S38800464x496You might be looking for face/look.Adam Frost{"video":"dominance: right;"} JP 33Y !Qfrost2024/04/17 19:24:252025/07/19 17:42:41AS10001S2ff00S10006S2ed00S19a50S2fe00S19a58S2fe00S38006S22a04S22a14M535x581S2ff00482x483S10001498x492S2ed00494x521S19a50507x543S19a58465x543S22a04515x566S22a14472x566verb to have the same appearance as before; to not have changed in how one looks: even after all these years, she looks the same | the house looks the same as when I was a kid.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc02\ud8ef\udfa1\u00d8\ud8ee\udce1\ud8ce\ude11\ud8fc\udc61\ud8ce\ude19\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"}nation is waiting for him to show leadership.
        • to accord or treat someone with (a specified quality): he urged his soldiers to fight them and show no mercy | [with two objects] : he has learned to show women some respect.
        • [no object] (of an emotion) to be noticeable: he tried not to let his relief show.
        • [no object] informal (of a woman) to be visibly pregnant: Shirley was four months pregnant and just starting to show.
      2. [with object] to demonstrate or prove: experts say this shows the benefit of regular inspections | [with clause] : the figures show that the underlying rate of inflation continues to fall.
        • to cause to understand or be capable of doing something by explanation or demonstration: he showed the boy how to operate the machine.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\ude01.mov"} EEtR33a!)frost2024/04/17 20:57:062026/08/10 19:46:55AS19a50S2fe00S10006S22a04M514x519S19a50486x481S22a04494x504M535x519S19a50507x481S19a58465x481S22a04515x504S22a14472x504verb, noun [at center locus] stay.Adam Frost{"video":"dominance: right;\\n\ud8ce\ude11\ud8fc\udc61\u00d8\ud8db\udfc5.mov"}7Q33[;!}frost2024/04/17 20:52:142026/08/15 19:30:07AS19a50S2fe00S19a58S2fe00S38006S22a04S22a14M535x519S19a50507x481S19a58465x481S22a04515x504S22a14472x504M514x519S19a50486x481S22a04494x504 S38a00464x490 S38b00470x493 M529x519S19a50501x481S19a58472x481S22a04509x504 S38b04470x493verb
      1. to continue to be in the same place: you stay here and I'll be back soon | Jenny decided to stay at home with their young child | he stayed with the firm as a consultant.
        • (stay for) delay leaving so as to join in (an activity): why not stay eS33A!frost2024/04/17 21:18:092026/08/10 19:47:18AS19a50S2fe00S19a58S2fe00S21406S20500S22a04M529x519S19a50501x481S19a58472x481S22a04509x504M535x519S19a50507x481S19a58465x481S22a04515x504S22a14472x504verb, noun a phonological variant (right hand movement) of stay.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8ce\ude11\ud8fc\udc61\ud8ce\ude19\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8db\udfc5.mov"}p`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|`2    !#$&'()*+,-/135 7!8"9#:$;%=&>'?(@)A*B+C,D-E.G/I0J1K2L4M5N6O7P9R:Snoun
          1. a sleeveless, close-fitting waist-length garment worn over a shirt, typically having no collar and buttoning down the front: businessmen wear three-piece pin-striped suits with vests and neckties.
          2. a garment worn on the upper part of the body for a particular purpose or activity: a running vest | a bulletproof vest.
          Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c1\udd61\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8d8\udd41\ud8d7\ude41.mov"}>a mechanical process involving the transfer of text, images, or designs to paper: a thousand copies of the book were printed.
          • to produce (text or a picture) by printing: the words had been printed in blue type.
          • to prepare and issue (a book, journal, piece of music, etc.) for public sale, distribution, or readership: we publish practical reference books.
          • to print (something) in a book or journal so as to make it generally known: we pay $30 for every letter we publish.
          • (of a newspaper or magazine) to publish (a piece of writing) within its pages: the article was printed in the first edition.
          • to prepare and issue the work of (a particular writer): she is frequently published in literary journals and anthologies.
          • (of a publisher or printer) to arrange for (a book, manuscript, etc.) to be reproduced in large quantities: Harper printed her memoirs in 1930.
          • to make (content) available online: a few hours after publishing the post I received a response from the founder of the company | the photo has not been published on her Instagram account.
          • to produce a paper copy of (information stored on a computer): the results of a search can be printed out.
          • to send (a computer file) to a printer or to another, temporary file.
          • to produce (a photographic print) from a negative: any make of film can be developed and printed.
        • to mark (a surface, typically a textile or a garment) with a colored design or pattern: a delicate fabric printed with roses.
          • to transfer (a colored design or pattern) to a surface: patterns of birds, flowers, and trees were printed on the cotton.

      DERIVATIVES
      printer nounAdam Frost{"video":"dominance: right;\\n\ud8d6\udfa1\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8db\udc65.mov"} cv9V 33Aku!}frost2024/04/17 21:25:312026/08/12 19:47:24AS1f420S2fe00S15a39S2fe00S21400S20500S22104M519x516S15a39481x485S1f420490x501S22104506x492M526x516S15a39475x485S1f420484x501S22114500x492verb [with object]
      1. to produce (books, newspapers, magazines, etc.), especially in large quantities, by = U 33A {!}frost2024/04/17 21:21:532026/05/26 03:43:20AS10012S2fe00S15a18S2fe00S21406S20500S26520M521x526S15a18480x494S10012491x511S26520490x475verb [center to front loci]
        1. to allow or cause (something) to be visible: a white blouse will show the blood.
          • to be or become visible: wrinkles were starting to show on his face.
          • to offer, exhibit, 3er work for public sale: the publication of her first novel | a legal prohibition prevented their publication.
            • the action of making content available online.
            • the action of making something generally known: the publication of April trade figures.
          • a book or journal issued for public sale: he is the author of numerous publications | scientific publications.
          • a printed publication (usually issued daily or weekly) consisting of folded unstapled sheets and containing news, feature articles, advertisements, and correspondence: all the newspapers carried the story | [as modifier] : a newspaper article | [mass noun] : she left her muddy boots on a piece of newspaper.
            • the organization responsible for producing a particular newspaper: Ms Henry joined the newspaper 10 months ago.
        Adam Frost{"video":"dominance: right;\\n\ud8d6\udfa1\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8db\udc75.mov"}mall, shaped metal implement for operating a switch in the form of a lock, especially one operating the ignition of a motor vehicle: Nat turned the key in the ignition.
      2. short for key card.
      3. an instrument for grasping and turning a screw, peg, or nut, especially one for winding a clock or turning a valve.
      4. a pin, bolt, or wedge inserted between other pieces, or fitting into a hole or space designed for it, so as to lock parts together.
      5. a thing that provides a means of gaining access to or understanding something: the key to Jack's behavior may lie submerged in his unhappy past.
      adjective of paramount or crucial importance: she became a key figure in the suffragette movement.

      INFLECTED FORMS
      key [at front locus]Adam Frost{"video":"dominance: right;\\n\ud8c0\ude53\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d9\ude61\ud8ea\udde1.mov"} people, especially Quakers, for worship.
    8. a formal meeting for discussion: he gathered all the men around the table for a conference.
      • a formal meeting that typically takes place over a number of days and involves people with a shared interest, especially one held regularly by an association or organization: an international conference on the environment | the third annual National Wilderness Conference.
    9. a large meeting or conference, especially of members of a political party or a particular profession: a convention of retail merchants.
    10. a meeting of a deliberative or judicial body to conduct its business: the governor called this week's special session to reconsider the decision.
    11. a period devoted to a particular activity: gym is followed by a training session.
      12. Adam Frost{"video":"dominance: equal;\\n\ud8cc\uddf8\ud8fc\udc61\ud8cc\ude00\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8db\udc74\ud8db\udc76.mov"} p>pJX 33 !frost2024/04/18 00:33:052026/08/13 05:28:14AS14450S2fe00S1445cS2fe00S21406S20e00S26a00S26a14M532x535S14450503x484S1445c486x504S20e00493x472S26a00505x465S26a14469x479[to front and back loci] a freeway, especially with right-hand traffic.Adam Frost{"video":"dominance: right;\\n\ud8c6\uddd1\ud8fc\udc61\ud8c6\udddd\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8e1\udfc1\ud8e1\udfd5.mov"}6W 33Ako!}frost2024/04/17 21:30:042026/08/12 19:46:40AS1f420S2fe00S15a39S2fe00S21400S20500S22114M526x516S15a39475x485S1f420484x501S22114500x492M519x516S15a39481x485S1f420490x501S22104506x492noun
      1. a machine for printing text or pictures onto paper, especially one linked to a computer.
      2. the preparation and issuing of a book, journal, piece of music, or oth@ hhiZ 33kg!)frost2024/04/18 00:36:472026/08/12 04:13:16AS1ea40S2fe00S10006S2a408M515x531S1ea40486x469S2a408490x495M527x521S15a48473x491S10612486x506S2c500487x480noun, adjective [at front locus] key.Adam Frost{"video":"dominance: right;\\n\ud8d6\udc01\ud8fc\udc61\u00d8\ud8e7\udd89.mov"}$Y 33 ;!)frost2024/04/18 00:35:122026/05/19 16:16:27AS18537S2fe00S10006S2b700M510x526S18537491x499S2b700490x475verb [center to front, with two objects] to freely transfer the possession of (something) to (someone); to hand over to: the check given to the jeweler proved worthless | [with object] : he gave the papers back | they gave her water to drink.
        • to administer (medicine): she was given antibiotics.
        Adam Frost{"video":"dominance: right;\\n\ud8cc\ude18\ud8fc\udc61\u00d8\ud8e9\udca1.mov"}18201508x501S18209467x501S20e00494x503S22a00511x483S22a10476x483noun
        1. the period between childhood and adult age: he had been a keen sportsman in his youth.
          • the state or quality of being young, especially as associated with vigor, freshness, or immaturity: she imagined her youth and beauty fading.
          • an early stage in the development of something: this publishing sector is no longer in its youth.
        2. young people considered as a group: middle-class youth have romanticized poverty | [as modifier] : youth culture.
        3. a person aged between 13 and 19 years: as a teenager she discovered she had a talent for dance | they have produced a dictionary of slang words popular with teenagers.
        adjective [in isolation] young.Adam Frost{"video":"dominance: equal;\\n\ud8cc\udcc2\ud8fc\uddf8\ud8cc\udcca\ud8fc\uddf2\ud8d9\udd41\ud8dc\udda1\ud8dc\uddb1.mov"} QMQ x\ 33C !Afrost2024/04/18 00:42:262026/05/09 17:37:11AS15410S30006S10006S26500S20310M539x518S2ff00482x483S15410524x488S26500524x468S20310523x448Adam Frost{"video":"dominance: right;\\n\ud8c7\udf91\ud8f0\udc07\u00d8\ud8e1\udde1\ud8d8\udd31.mov"}'[ 33AQk!}frost2024/04/18 00:40:242026/08/12 04:11:27AS10612S2fe00S15a48S2fe00S21406S21100S2c500M527x521S15a48473x491S10612486x506S2c500487x480M515x531S1ea40486x469S2a408490x495noun
        1. a small piece of shaped metal with incisions cut to fit the wards of a particular lock, which is inserted into a lock and turned to open or close it: there were two keys to the cupboard | a room key.
          • a sAM1S15a0a487x469S14c50487x500S22510488x484S38b00470x493 M515x529S15a0a488x471S14c50487x481S26a00486x515 S38b04470x493 S38a00464x490 M514x540S15a0a487x460S14c50487x491S22510488x475S26a00486x526 M514x545S15a0a487x455S14c50487x486S22510488x470S2ea20493x520verb
            1. to devote time and attention to acquiring knowledge on (an academic subject), especially by means of books: she studied biology and botany.
              • to investigate and analyze (a subject or situation) in detail: he has been studying mink for many years.
              • [no object] to apply oneself to study: he spent his time listening to the radio rather than studying.
              • (study at) to acquire academic knowledge at an educational establishment: he studied at the Kensington School of Art.
            2. to look at closely in order to observe or read: she bent her head to study the plans.
            noun
            1. the devotion of time and attention to acquiring knowledge on an academic sub v^ 33O W!efrost2024/04/18 00:48:202026/08/03 20:37:54AS10e1cS2fe00S15a1aS38617S20500S21d00M516x537S37800512x465S15a1a485x463S10e1c500x497S21d00498x529noun twelve o'clock at night: I left at midnight | [as modifier] : a midnight deadline.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd5d\ud8fc\udc61\ud8c8\udddb\ud8fc\ude58\ud8d8\udde1\ud8da\udee1.mov"}W] 33g Q!frost2024/04/18 00:44:562026/05/03 22:07:52AS18517S2fe00S1851fS2fe00S21406S20500S22113S22115M527x518S18517500x491S1851f481x491S22113508x483S22115473x483noun a gathering or assembly of people for a specific intent
              • an assembly of people, especially the members of a society or committee, for discussion or entertainment: the early-dismissal policy will be discussed at our next meeting.
                • Christian church a gathering ofB Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx           88D_ 33 !frost2024/04/18 01:11:082026/08/13 21:02:56AS14c10S2fe00S14c18S2fe00S21406S20e00S27100S27114M544x531S14c10498x489S14c18480x500S20e00493x477S27100504x469S27114456x483noun
                  1. the movement of pedestrians or forms of transportation: managing the air traffic was a mammoth task.
                    • the transportation of goods or passengers: the increased use of railroads for goods traffic.
                  2. the messages or signals transmitted through a communications system: data traffic between remote workstations.
                  Adam Frost{"video":"dominance: right;\\n\ud8c7\udc91\ud8fc\udc61\ud8c7\udc99\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8e2\ude61\ud8e2\ude75.mov"} ??Ia 33g;U!Gfrost2024/04/18 01:15:572026/05/03 23:56:02AS10004S2fe00S10008S2fe00S37f00S2db00S2db10S2fd02M534x528S10004519x473S10008513x498S2db00474x480S2db10467x508M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M528x528S10004513x473S10008507x498S2ea06482x481S2ea42476x506S26522472x493 S38800464x496You might be looking for tour/travel/trip.Adam Frost{"video":"dominance: right;"}p` 33A A!}frost2024/04/18 01:13:232026/08/13 20:50:10AS14c50S2fe00S14c58S2fe00S21414S20500S26504M517x540S14c58483x461S14c50493x491S26504499x525noun vehicles moving on a road or public highway: a stream of heavy traffic.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd1\ud8fc\udc61\ud8c7\udcd9\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1\ud8e1\udde5.mov"} e%e4d33u!}frost2024/04/18 01:38:572026/07/30 22:34:21AS18201S38517S18209S38511S20e00S22f00S22f10M533x518S18201508x501S18209467x501S20e00494x503S22f00505x483S22f10470x483M533x518SE1c 33Ok{!Yfrost2024/04/18 01:30:352026/05/23 18:47:32AS15a11S30007S10006S20e00S22a05S19a10M574x542S2ff00482x483S15a11510x487S22a05531x506S19a10546x522M546x518S2ff00482x483S1c517521x488S22124511x476interrogative adverb, relative adverb, conjunction why.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8f0\udc08\u00d8\ud8d9\udd41\ud8db\udfc6\ud8ce\uddd1.mov"}"b 33[ !}frost2024/04/18 01:28:152026/05/09 17:38:26AS15a31S2fe00S15a59S2fe00S21404S20e00S26507M525x523S15a31489x500S15a59475x488S20e00501x491S26507512x478Adam Frost{"video":"dominance: right;\\n\ud8c8\uddf2\ud8fc\udc61\ud8c8\ude1a\ud8fc\udc61\ud8d9\udf85\ud8d9\udd41\ud8e1\udde8.mov"}ject, especially by means of books: an application to continue full-time study.
                  • (studies) used in the title of an academic subject: a major in East Asian studies.
                • a detailed investigation and analysis of a subject or situation: a study of a sample of 5,000 children | the study of global problems.
                • a room used or designed for reading, writing, or academic work: the third bedroom was used as a study.

            PHONOLOGICAL VARIANTS
            study with repeated contact

            INFLECTED FORMS
            study [frequentative]
            study [durative]Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd1\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8fc\udc05\ud8db\uddf1.mov"}involves a lot of travel.
            • (travels) a period of time spent traveling from place to place, typically over long distances: perhaps you'll write a book about your travels.
            • a journey for pleasure in which several different places are visited: three couples from Kansas on an airline tour of Alaska.
            • a short trip to or through a place in order to view or inspect something: a tour of the White House.
            • a journey made by performers or an athletic team, in which they perform or play in several different places: she joined the Royal Shakespeare Company on tour.
            • (the tour) (in golf, tennis, and other sports) the annual round of events in which top professionals compete.

            PHONOLOGICAL VARIANTS
            tour with 1-handsAdam Frost{"video":"dominance: right;\\n\ud8d2\ude32\ud8fc\udc61\ud8d2\ude20\ud8fc\udc61\ud8fb\udfa1\ud8ed\udfc7\ud8ee\udc03\ud8e1\ude03.mov"}533x518S18201508x501S18209467x501S20e00494x503S22a00511x483S22a10476x483M533x518S18201508x501S18209467x501S20e00494x503S22f00505x483S22f10470x483adjective having lived or existed for only a short time: a young girl.
            • not as old as the norm or as would be expected: more people were dying young.
            • [attributive] relating to, characteristic of, or consisting of young people: young love | a young authors' association.
            • immature or inexperienced: she's very young for her age.
            • having the qualities popularly associated with young people, such as enthusiasm and optimism: all those who are young at heart.

            INFLECTED FORMS
            young [in isolation]Adam Frost{"video":"dominance: equal;\\n\ud8cc\udcc2\ud8fc\uddf8\ud8cc\udcca\ud8fc\uddf2\ud8d9\udd41\ud8db\udfc1\ud8db\udfd1.mov"} Uf 33Ak !frost2024/04/18 02:23:472026/05/29 21:43:23AS14c50S2fe00S15a0aS2fe00S21404S26a00S20600M515x529S15a0a488x471S14c50487x481S26a00486x515M514x531S15a0a487x469S14c50487x500S22510488x484verb, noun a phonological variant (repeated contact) of study.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udcd1\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf85\ud8e1\udfc1\ud8d8\ude41.mov"}e3353 !efrost2024/04/18 02:20:452026/06/05 17:28:56AS14c50S2fe00S15a0aS2fe00S38004S22510M514x53G g33y!7frost2024/04/18 15:57:542026/08/14 17:38:53AS10004S2fe00S10008S2fe00S37f00S2ea06S2ea42S26522M528x528S10004513x473S10008507x498S2ea06482x481S2ea42476x506S26522472x493M539x526S1c551514x481S1c53f486x501S2ea06480x475S2ea42462x504S26522473x488verb, noun a phonological variante (1-hands) of tour.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc05\ud8fc\udc61\ud8c0\udc09\ud8fc\udc61\ud8fb\udfa1\ud8ed\udfc7\ud8ee\udc03\ud8e1\ude03.mov"}  h 33 !)frost2024/04/18 16:15:312026/05/19 16:24:10AS10001S2ff00S10006S2ed00M519x544S2ff00482x483S10001498x492S2ed00494x521verb to have the appearance or give the impression of being: her father looked unhappy | the home looked like a prison.
            • to show a likelihood of: it doesn't look like you'll be moving to Brooklyn.
            • to appear one's normal, healthy self: he just didn't look himself at all.
            noun the front part of a person's head from the forehead to the chin, or the corresponding part in an animal.
            • the face as expressing emotion; an expression shown on the face: the happy faces of these children.
            Adam Frost{"video":"dominance: right;\\n\ud8c0\udc02\ud8ef\udfa1\u00d8\ud8ee\udce1.mov"} Ii 33g;U!Gfrost2024/04/18 17:05:152026/05/03 23:56:22AS1c551S2fe00S1c53fS2fe00S37f00S2db00S2db10S2fd02M548x523S1c551523x478S1c53f495x498S2db00478x482S2db10452x500M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M539x526S1c551514x481S1c53f486x501S2ea06480x475S2ea42462x504S26522473x488 S38800464x496You might be looking for tour/travel/trip.Adam Frost{"video":"dominance: right;"}S14049497x500S14040482x476S20600472x505verb
            1. [often in imperative] be cautious; keep oneself safe: take care if you're planning to go out tonight.
              • said to someone on leaving them: take care, see you soon.
            2. keep (someone or something) safe and provided for: I can take care of myself.
              • look after a child or children while the parents are out: I babysit for my neighbor sometimes | [with object] : she was babysitting Sophie.
            3. deal with (something): he has the tools to take care of the electrical problem.
            adjective making sure of avoiding potential danger, mishap, or harm; cautious: I begged him to be more careful | be careful not to lose her address | [as exclamation] : Careful! That stuff's worth a fortune!.Adam Frost{"video":"dominance: right;\\n\ud8c6\udc41\ud8fc\udc61\ud8c6\udc4a\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} VVj33Wy!frost2024/04/18 17:05:552026/08/14 21:30:24AS1c551S2fe00S1c53fS2fe00S37f00S2ea06S2ea42S26522M539x526S1c551514x481S1c53f486x501S2ea06480x475S2ea42462x504S26522473x488S38b00470x493 M528x528S10004513x473S10008507x498S2ea06482x481S2ea42476x506S26522472x493 S38b04470x493verb to move from place to place: the flu has been going around.
            • to travel through or visit several places: they traveled across Europe.
            • to make a tour of (an area): he decided to tour France | [no object] : they had toured in a little minivan.
            • to take (a performer, production, etc.) on tour: this production will be toured to outlying villages.
            • [no object, with adverbial of direction] to go on a short journey: when tripping through the Yukon take some time to explore our museums.
            noun the action of traveling from place to place: my job N ~l33 !wfrost2024/04/18 17:16:032026/05/28 22:11:44AS14710S30004S10006S20600M533x532S2ff00482x483S14710493x510S20600511x516M542x532S2ff00482x483S14710493x510S20e00523x520S22f00517x504noun a phonological variant (tapping movement) of breakfast.
            name sign used for a person whose name starts with B.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\nvisible: sign;\\n\ud8c6\udeb1\ud8f0\udc05\u00d8\ud8d8\ude41.mov"}noun a game in which two or four players strike a ball with rackets over a net stretched across a court.Adam Frost{"video":"dominance: right;\\n\ud8d6\udc01\ud8fc\udc61\u00d8\ud8dc\udf2c.mov"} _sn33uM!}frost2024/04/18 17:18:442026/07/30 22:33:40AS18201S38517S18209S38511S20e00S22a00S22a10MOm33CSa!mfrost2024/04/18 17:16:402026/05/28 22:11:08AS14710S30004S10006S20e00S22f00M542x532S2ff00482x483S14710493x510S20e00523x520S22f00517x504M521x605S33b00482x483S18507502x510S15a38505x546S37800510x573S15a5a490x590 S38a00464x490 S38b00470x493 M533x532S2ff00482x483S14710493x510S20600511x516 S38b04470x493noun a breakfast.

            PHONOLOGICAL VARIANTS
            breakfast (noun) with tapping movementAdam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udeb1\ud8f0\udc05\u00d8\ud8d9\udd41\ud8dc\udda1.mov"}no object] : I'll pay for your ticket.
            • to give (a sum of money) in exchange for goods or work done or in discharge of a debt: he paid $1,000 to have it built in 1977 | you will have paid out more in premiums that you received from claims | [with two objects] : a museum paid him a four-figure sum for it.
            • to hand over or transfer the amount due of (a debt, wages, etc.) to someone: I always prefer to pay all my bills on time | bonuses were paid to savers whose policies completed their full term.
            • (of work, an investment, etc.) to yield or provide someone with (a specified sum of money): jobs that pay $5 or $6 an hour.
            • [no object] (of a business or undertaking, or an attitude) to be profitable or advantageous to someone: crime doesn't pay | [with infinitive] : it pays to choose varieties carefully.
            Adam Frost{"video":"dominance: right;\\n\ud8c0\udc05\ud8fc\udc61\ud8c8\uddf8\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udf61.mov"} McMp 33 !)frost2024/04/18 17:26:082025/03/11 17:01:12AS1f71cS2fe00S10006S27100M520x518S1f71c492x503S27100480x483noun an electrical apparatus that by means of suction collects dust and small particles from floors and other surfaces.
            verb to clean with an electrical apparatus that collects dust and small particles from floors and other surfaces, especially by holding its handle: the room needs to be vacuumed.Adam Frost{"video":"dominance: right;\\n\ud8d7\udcbd\ud8fc\udc61\u00d8\ud8e2\ude61.mov"}o 33u _!}frost2024/04/18 17:22:382026/04/23 22:03:38AS16d51S2fe00S16d39S2fe00S20800S28806S2881eM528x520S16d39492x480S16d51483x483S20800495x503S28806506x508S2881e472x508verb to separate a marriage; to divorce.Adam Frost{"video":"dominance: right;\\n\ud8ca\udd32\ud8fc\udc61\ud8ca\udd1a\ud8fc\udc61\ud8d8\udf01\ud8e4\udf07\ud8e4\udf1f.mov"} CFCr 335 !efrost2024/04/18 17:36:302025/03/11 17:08:52AS20340S2fe00S20348S2fe00S37f04S2a32cM521x521S20340506x501S20348506x479S2a32c479x481verb to clean (an area) by brushing away dirt or litter, especially by holding the handle of a broom: I've swept the floor.
            noun a long-handled brush of bristles or twigs, used for sweeping, especially by holding its handle.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8fb\udfa5\ud8e7\udd4d.mov"}6q 335 q!efrost2024/04/18 17:34:352025/03/11 16:56:24AS15712S2fe00S15a39S2fe00S37f00S27107M525x530S15a39483x507S15712476x492S27107498x471verb to clean with an electrical apparatus that by means of suction collects dust and small particles from floors and other surfaces: the room needs to be vacuumed.Adam Frost{"video":"dominance: right;\\n\ud8c8\udcb3\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8fb\udfa1\ud8e2\ude68.mov"} 0t 335 e!efrost2024/04/18 17:48:232026/05/23 16:18:10AS14040S2fe00S14049S2fe00S21400S20600M528x524Tns 33 e!frost2024/04/18 17:43:192025/03/11 17:10:18AS15a41S2fe00S15a36S2fe00S21400S20e00S2880eS2880eM522x530S15a41499x502S15a36483x518S20e00484x501S2880e479x486S2880e479x471noun a long-handled brush of bristles or twigs, used for sweeping.
            verb to clean (an area) by brushing away dirt or litter: I've swept the floor.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude02\ud8fc\udc61\ud8c8\uddf7\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e4\udf0f\ud8e4\udf0f.mov"}82x465M527x536S16d48474x496S1853e489x511S21000504x509S22f00502x492S14c30481x465verb [no object] (of a plant) to germinate and develop: seaweed grows in the ocean.
            • [with object] to produce by cultivation: more and more land was needed to grow crops for export.
            • [with object] to allow or cause (a part of the body) to grow or develop: [with object and complement] : she grew her hair long.
            • (of a living thing) to undergo natural development by increasing in size and changing physically; progress to maturity: he would watch Nick grow to manhood.

            INFLECTED FORMS
            growing [frequentative]

            DERIVATIVES
            plant nounAdam Frost{"video":"dominance: right;\\n\ud8cc\ude1f\ud8fc\udc61\ud8ca\udd29\ud8fc\udc61\ud8d9\udf87\ud8d9\ude01\ud8db\udfc1\ud8c7\udcb1.mov"} `4v 33[ /!}frost2024/04/18 18:03:212026/02/25 21:35:05AS16d40S2fe00S16d48S2fe00S38006S28809S28819M529x522S16d40504x502S16d48471x502S28809509x478S28819476x478verb to remove the contents of a container, typically by dumping or pouring them out to the right: you need to empty out the trash.Adam Frost{"video":"dominance: right;\\n\ud8ca\udd21\ud8fc\udc61\ud8ca\udd29\ud8fc\udc61\ud8fc\udc07\ud8e4\udf0a\ud8e4\udf1a.mov"}u 33A !}frost2024/04/18 17:56:502026/02/25 19:49:44AS1f751S2fe00S15a39S2fe00S21400S21100S2ea32M520x517S15a39480x484S1f751491x496S21100507x486verb to clean (a horizontal surface) with water and, typically, soap or detergent: it's Jimmy's turn to wash the dishes.Adam Frost{"video":"dominance: right;\\n\ud8d7\udcf2\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8ed\udff3.mov"} <xfx 33[ !}frost2024/04/18 18:08:352026/05/19 17:14:56AS10004S2fe00S15a37S2fe00S21400S20e00S26900M520x525S15a37489x502S10004505x479S20e00483x496S26900481x475verb [with object] to give (someone) money that is due for work done, goods received, or a debt incurred: [with object and infinitive] : he paid the locals to pick his coffee beans | [X@w 33u -!}frost2024/04/18 18:06:122025/03/11 18:48:23AS18537S33d00S1853fS2fe00S20500S26a00S26a10M544x555S33b00482x483S18537502x510S1853f474x528S26a00517x508S26a10464x514verb to give food to: the raiders fed the guard dog to keep it quiet | [with two objects] : he fed her brownies he had just baked.Adam Frost{"video":"dominance: right;\\n\ud8cc\ude18\ud8f5\udee1\ud8cc\ude20\ud8fc\udc61\ud8d8\udde1\ud8e1\udfc1\ud8e1\udfd1.mov"}a525x523S15a39475x482S10050486x493S20e00496x492S26a07504x477M524x525S15a39476x481S11a50481x495S20e00496x492S26a07503x476
            verb
            1. to carry out a systematic or formal inquiry to discover and examine the facts of (an incident, allegation, etc.) so as to establish the truth: police are investigating the alleged beating.
              • to carry out research or study into (a subject, typically one in a scientific or academic field) so as to discover facts or information: [with clause] : future studies will investigate whether long-term use of the drugs could prevent cancer.
              • to make inquiries as to the character, activities, or background of (someone): everyone with a possible interest in your brother's death must be thoroughly investigated.
              • [no object] to make a check to find out something: when you didn't turn up I thought I'd better come back to investigate.
            2. to look at (someone or something) closely, typ +z33K!frost2024/04/18 18:12:142026/08/15 18:29:16AS1853eS2fe00S16d48S2fe00S21406S21000S22a00S14c30M525x536S16d48475x496S1853e490x511S21000505x509S22a00509x492S14c304\xy 33u }!frost2024/04/18 18:09:272026/08/08 23:44:33AS14720S2fe00S10006S19220S1dc20S1dc20S20320M515x566S14720495x434S19220494x460S1dc20485x483S1dc20485x517S20320494x551noun more than one bill.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udec1\ud8fc\udc61\u00d8\ud8cd\udee1\ud8d4\udea1\ud8d4\udea1\ud8d8\udd41.mov"}ically to assess their condition or to discover any shortcomings: they were inspecting my outside paintwork for cracks and flaws.
              • to examine (someone or something) to ensure that they reach an official standard: customs officers came aboard to inspect our documents.
            3. to research (verb).
            noun
            1. the action of investigating something or someone; formal or systematic examination or research: he is under investigation for receiving illicit funds.
              • a formal inquiry or systematic study: an investigation has been launched into the potential impact of the oil spill.
            2. a research (noun).
            Adam Frost{"video":"dominance: right;\\n\ud8c0\udc51\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc8.mov"} y| 33 e!)frost2024/04/18 18:19:002026/05/19 17:15:44AS16d27S2fe00S10006S28802M520x514S16d27500x494S28802481x487verb [with object and adverbial of direction] to cause (a liquid) to flow from a container in a steady stream: she poured a little whisky into a glass.Adam Frost{"video":"dominance: right;\\n\ud8ca\udd08\ud8fc\udc61\u00d8\ud8e4\udf03.mov"}y{33[y!)frost2024/04/18 18:17:152026/08/15 19:39:15AS14020S2fe00S16d48S2fe00S21406S21300S2b700M527x522S16d48473x502S14020474x478S21300506x506S2b700502x481M527x536S16d48474x496S1853e489x511S21000504x509S22f00502x492S14c30481x465noun [declining in use] a plant (noun sense 1).Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc21\ud8fc\udc61\ud8ca\udd29\ud8fc\udc61\ud8d9\udf87\ud8d9\udf21\ud8e9\udca1.mov"} OO-} 33g }!frost2024/04/19 15:47:462025/03/11 23:26:50AS20302S2fe00S2030aS2fe00S21400S21100S26900S26910M531x518S20302497x486S2030a488x503S26900515x483S26910469x500verb form (something) by putting parts together or combining substances: my grandmother made a dress for me | the body is made from four pieces of maple | baseball bats are made of ash.
            • to prepare (a dish, drink, or meal) for consumption: she was making lunch for Lucy and Francis | [with two objects] : I'll make us both a cup of tea.
            Adam Frost{"video":"dominance: right;\\n\ud8d8\udd23\ud8fc\udc61\ud8d8\udd2b\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e1\udf61\ud8e1\udf71.mov"} og~ 33g q!frost2024/04/19 15:56:062026/03/13 18:15:42AS15a51S2fe00S15a39S2fe00S21400S20500S2a228S20500M527x523S15a39474x491S15a51485x500S20600482x477S2a228504x486verb
            1. to bend (something) over on itself in successive sections so that one part of it covers another: he folded the towel neatly.
            2. to pat and flip (something) over, then pat again with the hands to make flat: she flattened the tortilla evenly on both sides.
            Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e7\udce9\ud8d8\udde1.mov"}  33M 1!Efrost2024/04/19 16:08:162025/03/11 23:32:08AS20320S2fe00S20328S2fe00S38006S26500S26510S14c20S14c28S2fd04M533x540S20320514x514S20328472x525S26500514x495S26510473x507S14c20510x460S14c28468x473S2fd04491x533verb to store various or multiple things in an appropriate or usual place: the decorations were boxed up and put away for next year.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd41\ud8fc\udc61\ud8d8\udd49\ud8fc\udc61\ud8fc\udc07\ud8e1\udde1\ud8e1\uddf1\ud8c7\udca1\ud8c7\udca9\ud8ef\udee5.mov"} ExO33[k!}frost2024/04/19 16:54:152026/09/04 20:19:12AS10050S2fe00S15a39S2fe00S21400S20e00S26a07M_7 33M M!sfrost2024/04/19 16:13:452026/05/05 17:30:43AS1ce10S2fe00S1ce18S2fe00S38006S19210S19218S10640S10648S2fd04M531x547S1ce10509x454S19210504x487S10640510x511S1ce18470x464S19218476x497S10648476x521S2fd04495x541verb to mend or repair multiple objects or the same object repeatedly: he spent the afternoon fixing things around the house.
            • (fix something up) to do the necessary work to improve or adapt something: we want to fix up the house before we sell it.
            Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d3\udd51\ud8fc\udc61\ud8d3\udd59\ud8fc\udc61\ud8fc\udc07\ud8cd\uded1\ud8cd\uded9\ud8c0\ude81\ud8c0\ude89\ud8ef\udee5.mov"} keep your receipt to check with your statement.
          • to inspect or examine thoroughly: I checked my notes.
          • informal to look at; to take notice of: check the remix.
        2. (of a passenger) to consign (baggage) to the care of the transport provider with whom they are traveling: I checked my bag and got my boarding pass.
          • to deposit (a coat, bag, or other item) for temporary safekeeping in the cloakroom of a restaurant, theater, etc.: the drinks weren't expensive and there's no cover charge but you do have to check your coat for $3.00.
        noun
        1. an examination to test or ascertain accuracy, quality, or satisfactory condition: a campaign calling for regular checks on gas appliances | a health check.
        2. the bill in a restaurant: let's get the check.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc51\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8dd\udfaa.mov"}ne from a sense of moral obligation rather than for pleasure: a fifteen-minute duty visit.
      3. (often duties) a task or action that someone is required to perform: the queen's official duties | your duties will include sweeping the switchboard | Juliet reported for duty.
        • [with modifier] a person's responsibility for a specified task, usually one involving supervising someone or supplying something: when he's on baby duty he usually lets his wife sleep in | we've got a small gathering coming up and I'm on beer duty.
        • military service: combat duty in the army.
        • [as modifier] (of a person) engaged in their regular work: a duty nurse.
        • (also duties) performance of prescribed church services by a priest or minister: he was willing to take Sunday duties.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c0\udcb1\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} alone.
    12. to provide (someone) with positive emotional engagement or satisfaction: a tremendous game that thoroughly entertained the crowd.
    13. to recognize the full worth of: she feels that he does not appreciate her.
    noun
    1. a feeling of positive emotional engagement or satisfaction: she had not traveled for pleasure for a long time.
    2. the act of providing or experiencing positive emotional engagement or satisfaction: everyone just sits in front of the TV for entertainment.
      • an event, performance, or activity designed to provide positive emotional engagement or satisfaction to others: a theatrical entertainment.

    PHONOLOGICAL VARIANTS
    enjoy (verb, noun) right-handedAdam Frost{"video":"dominance: right;\\n\ud8c8\uddc2\ud8fc\uddf1\ud8c8\uddc7\ud8fc\ude11\ud8d9\ude61\ud8d9\ude61\ud8ed\udde1\ud8ed\uddf9.mov"} ,,H 33[ W!}frost2024/04/19 17:17:162026/08/14 00:17:29AS10050S2fe00S15a0aS2fe00S21414S20e00S23f09M527x519S15a0a473x481S10050481x486S20e00504x481S23f09506x496verb [with object]
    1. to examine (something) in order to determine its accuracy, quality, or condition, or to detect the presence of something: customs officers have the right to check all luggage | [no object] : a simple blood test to check for anemia.
      2.
    2. expressing a firm, unyielding stance; unwilling to reconsider, negotiat # 335Y!frost2024/04/19 17:19:142026/08/15 19:33:24AS10150S2fe00S2035aS2fe00S21400S20600M521x523S10150480x477S2035a490x508S20600499x493M543x522S36d00479x499S18211518x479S18209488x505S20600494x486S20600512x507noun
      1. a moral or legal obligation; a responsibility: it's my duty to uphold the law | she was determined to do her duty as a citizen | a strong sense of duty.
        • [as modifier] (of a visit or other undertaking) dohe, or continue engaging on a topic; typically signed with greater tension in movement.
        • (of information, writing, etc.) dealing primarily with facts and presented in a dull, uninteresting way: he not only avoids dry accounts of regimes and rulers, but enables the reader to feel how the substance of daily life has changed | the commentary is very dry, with little of interest to even the most avid fan.
          • unemotional, undemonstrative, or impassive: it transformed him from a dry administrator into the people's hero | Ralph gave me a dry, silent wave.
        • (of a joke or sense of humor) subtle, expressed in a matter-of-fact way, and having the appearance of being unconscious or unintentional: he delighted his friends with a dry, covert sense of humor.
      2. prohibiting the sale or consumption of alcoholic drink: Indiana stayed dry after the end of prohibition.
        • (of a person) no longer addicted to or drinking alcohol: I heard much 733g S!frost2024/04/19 17:25:502026/06/21 16:31:42AS15a01S38510S15a06S38530S21100S21100S2e500S2e518M514x532S15a01491x468S15a06486x504S21100486x483S21100492x518S38b00470x493 M514x515S15a01491x486S21100486x501 S38b04470x493verb
          1. to experience positive emotional engagement or satisfaction in (an activity or occasion): Joe enjoys reading Icelandic family sagas.
            • (enjoy oneself) to have a satisfying and emotionally positive experience: I could never enjoy myself, knowing you were in your roomi xx_W 33C I!Afrost2024/04/21 17:27:582025/03/12 20:25:46AS10e10S30007S10006S22712S26504M550x529S2ff00482x483S10e10521x481S22712540x481S26504522x514verb to cut a person's hair: I need to cut my hair before the wedding next week.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd51\ud8f0\udc08\u00d8\ud8db\udeb3\ud8e1\udde5.mov"}) 33 !efrost2024/04/19 17:27:212026/05/15 21:54:32AS14051S2fe00S10006S17620M516x522S14051485x478S17620498x506noun the public department or corporation responsible for mail services and (in some countries) telecommunications.
              • a building where postal business is transacted.
              adjective [attributive] relating to the post office or the mail: postal services | increased postal rates.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c6\udc52\ud8fc\udc61\u00d8\ud8cb\udc61.mov"} PE 33A k!}frost2024/04/21 17:31:202025/03/12 19:29:13AS1c550S2fe00S15a39S2fe00S21400S20500S2c503M534x522S15a39466x497S1c550481x494S2c503502x479noun
              1. the science or practice of the diagnosis, treatment, and prevention of disease (in technical use often taken to exclude surgery): he made distinguished contributions to pathology and medicine | the remarkable achievements of modern medicine.
              2. a compound or preparation used for the treatment or prevention of disease: give her some medicine | your doctor will be able to prescribe medicines.
                • healing substances or drugs collectively: an aid convoy loaded with food and medicine.
              Adam Frost{"video":"dominance: right;\\n\ud8d2\ude31\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8ea\udde4.mov"} 44H 33[ +!) frost2024/04/21 17:35:022026/05/09 00:36:51AS11a02S2fe00S10028S2fe00S21414S20e00S22f04M521x523S10028479x480S11a02485x478S20e00502x495S22f04496x509noun a tenant's regular payment to a landlord for the use of property or land.
              • a sum paid for the hire of equipment.
              Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\uddc3\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8dc\udda5.mov"} vj 33O ! frost2024/04/21 17:36:312026/05/19 17:27:18AS11a20S2fe00S10006S14a20S11920S1fb20M511x551S11a20496x449S14a20496x483S11920490x502S1fb20496x532noun a tenant's regular payment to a landlord for the use of property or land.
              • a sum paid for the hire of equipment.
              verb to pay someone for the use of (something, typically property, land, or a car): they rented a house together in Spain.
              • (of an owner) to let someone use (something) in return for payment: he purchased a large tract of land and rented out most of it to local farmers.
              • [no object] to be let or hired out at a specified rate: skis or snowboards rent for $60–80 for six days.
              Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c2\udde1\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8c2\udd81\ud8d7\ude41.mov"} competition involving sides made up of two players: the semifinals of the doubles.
          pronoun a number or amount which is twice as large as a contrasting or usual number or amount: he paid double and had a room all to himself.
          verb [no object] to become twice as much or as many: profits doubled in one year.
          • [with object] to make twice as much or as many of (something): Clare doubled her income overnight.
          • [no object] Baseball (of a batter) to get a two-base hit: Strawberry doubled with two outs.
          • [no object] Bridge to make a call increasing the value of the penalty points to be scored on an opponent's bid if it wins the auction and is not fulfilled: it may be right for East to double | [with object] : West's failure to double 4♥.
          Adam Frost{"video":"dominance: right;\\n\ud8c1\udd42\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8e4\udf0a.mov"}hat affect the teeth and gums, especially the repair and extraction of teeth and the insertion of artificial ones: his mouth is still sore from his visit to the dentist's | a leather dentist's chair.
        • singular form of teeth.
        • a hard, brittle substance, typically transparent or translucent, made by fusing sand with soda, lime, and sometimes other ingredients and cooling rapidly. It is used to make windows, drinking containers, and other articles: [as modifier] : a glass door | a piece of glass.
          • a substance similar to glass which has solidified from a molten state without crystallizing: the black volcanic glass makes the beaches sparkle.
        • [typically before a descriptive affix] a lens, or an optical instrument containing a lens or lenses, in particular a monocle or a magnifying lens.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\ude41\ud8f9\udc61\u00d8\ud8d8\ude41.mov"}thing: fill in your full name below | full details on request.
      • (often used for emphasis) reaching the utmost limit; maximum: he reached for the engine control and turned it up to full power | John made full use of all the tuition provided.
      • having all the privileges and status attached to a particular position: the country applied for full membership in the European Community.
      • (of a report or account) containing as much detail or information as possible: a full report of the conference | fuller descriptions of these varieties are available elsewhere.
      • used to emphasize an amount or quantity: he kept his fast pace going for the full 14-mile distance.
    adverb to the greatest possible degree or extent; with nothing partial or lacking: I fully understand the fears of the workers.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd2\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde4.mov"} wn 33 5!) frost2024/04/21 17:41:342026/02/28 19:44:00AS10600S36110S10006S27102M536x546S36100482x483S10600503x512S27102521x506noun a set of hard, bony enamel-coated structures in the jaws of most vertebrates, used for biting and chewing: he clenched his teeth.Adam Frost{"video":"dominance: right;\\n\ud8c0\ude41\ud8f9\udc61\u00d8\ud8e2\ude63.mov"}u 33i G!Y frost2024/04/21 17:39:312026/05/19 17:30:53AS10012S30004S10006S20e00S26506S10612M592x527S2ff00482x483S10012499x512S20e00532x513S26506547x512S10612566x512adjective
    1. free from moisture or liquid; not wet or moist: the jacket kept me warm and dry | he wiped it dry with his shirt.
      • having lost all wetness or moisture over a period of timk22x534S1ce40500x504S1ce48482x466S2c600479x504S2b715505x476verb [at center locus] to cause one thing to take the place of another: the company replaced the old computer system with a new one.
        noun the act or process of causing one thing to take the place of another: the company announce a replacement for the old policy.
        • a person or thing that serves in place of another: please stay until we find a replacement for you | [as modifier] : a substitute teacher | a foster parent.
        adverb as an alternative or substitute: do not use lotions, but put on a clean dressing instead.
        • (instead of) as a substitute or alternative to; in place of: walk to work instead of going by car.
            • Adam Frost{"video":"dominance: right;\\n\ud8d3\udd81\ud8fc\udc61\ud8d3\udd89\ud8fc\udc61\ud8fc\udc05\ud8ea\ude41\ud8e9\udcb6.mov"} V(VN 33) #!ofrost2024/04/21 17:50:162026/05/04 03:57:46AS1f000S2fe00S10006S1f720S20320M515x527S1f000486x474S1f720495x493S20320500x512noun refined petroleum used as fuel for internal combustion engines: we stopped for gas.
            • the accelerator of an automobile: I ordered my friend to step on the gas.
            Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d6\ude01\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8d8\udd41.mov"}L 33 q!) frost2024/04/21 17:46:102026/05/19 17:32:35AS10600S36110S10006S20600M538x533S36100482x483S10600496x507S20600516x512noun
            1. a person qualified to treat the diseases and conditions tt  33A !}frost2024/04/21 17:55:122025/03/12 20:19:53AS1f521S2fe00S20348S2fe00S21400S28802S20700M525x523S20348475x508S1f521482x485S28802503x477verb to fill the tank of (a motor vehicle) with gasoline: after gassing up the car, he went into the restaurant.Adam Frost{"video":"dominance: right;\\n\ud8d7\udc02\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8e4\udf03\ud8d8\udea1.mov"}j 335 Y!efrost2024/04/21 17:54:292025/03/12 20:17:57AS1f521S2fe00S20348S2fe00S21400S20710M527x519S20348474x504S1f521481x481S20710493x504noun refined petroleum used as fuel for internal combustion engines: we stopped for gas.Adam Frost{"video":"dominance: right;\\n\ud8d7\udc02\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d8\udeb1.mov"} hh 33A !}frost2024/04/21 17:56:292025/03/12 20:25:06AS1dc03S2fe00S20348S2fe00S21400S28802S20700M529x523S20348472x508S1dc03479x484S28802507x477verb to fill the tank of (a motor vehicle) with gasoline: after gassing up the car, he went into the restaurant.Adam Frost{"video":"dominance: right;\\n\ud8d4\ude84\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8e4\udf03\ud8d8\udea1.mov"}eave | [as modifier] : an application form | [with infinitive] : an application to join the forum.
            verb
            1. to freely offer to do something: he volunteered for the job | [with infinitive] : I rashly volunteered to be a contestant.
              • [with object] to offer (help): he volunteered his services as a driver for the convoy.
              • to work for an organization without being paid.
            2. [no object] to make a formal application or request: you need to apply to the local authorities for a grant | [with infinitive] : a number of people have applied to vote by proxy.
              • put oneself forward formally as a candidate for a job: she had applied for a number of positions.

            PHONOLOGICAL VARIANTS
            volunteer with forward movementAdam Frost{"video":"dominance: right;\\n\ud8d3\udd52\ud8fc\uddf8\u00d8\ud8d8\udf01\ud8dc\udda1.mov"} s 33[ -!}frost2024/04/21 17:58:422026/05/19 17:33:17AS14c51S2fe00S20348S2fe00S21400S20e00S26503M519x525S20348482x493S14c51483x476S20e00507x500S26503493x512adjective
            1. containing or holding as much or as many as possible; having no empty space: trash cans full of trash | she could only nod because her mouth was full.
              • (full of) [predicative] containing or holding much or many; having a large number of: his diary is full of entries about her.
              • involving a lot of activities: he lived a full life.
            2. [attributive] not lacking or omitting anyu <3 33) m!ofrost2024/04/21 18:19:292026/05/19 17:33:41AS17620S2fe00S10006S19220S1dc20M515x537S17620494x464S19220494x484S1dc20485x507noun a viscous liquid derived from petroleum, especially for use as a fuel or lubricant.
              • petroleum: 400 birds were coated with oil which spilled out from an opened valve | [as modifier] : the oil industry.
              • [with modifier] any of various thick, viscous, typically flammable liquids that are insoluble in water but soluble in organic solvents and are obtained from animals or plants: potatoes fried in vegetable oil.
              • a liquid preparation used on the hair or skin as a cosmetic: suntan oil.
              Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cb\udc61\ud8fc\udc61\u00d8\ud8cd\udee1\ud8d4\udea1.mov"} tsv 33[ 3!}frost2024/04/21 18:30:592026/05/26 03:10:39AS1ce40S2fe00S1ce48S2fe00S38004S2c600S2b715M5w 33[ W!}frost2024/04/21 18:24:142026/05/26 03:10:16AS1ea41S2fe00S1ea49S2fe00S38004S2c600S2b715M523x527S1ea41495x501S1ea49478x475S2c600481x501S2b715507x473verb [at center locus] to put one thing in the place of another: he replaced the broken window with a new one.
              noun the action or process of replacing someone or something: a hip replacement.
              • a person or thing that takes the place of another: we've ordered a replacement for the broken TV.
              Adam Frost{"video":"dominance: right;\\n\ud8d6\udc02\ud8fc\udc61\ud8d6\udc0a\ud8fc\udc61\ud8fc\udc05\ud8ea\ude41\ud8e9\udcb6.mov"}489S1f540491x482S20600480x508 M523x541S15a37498x467S1f540491x460S15a40510x496S15a48478x496S22a04510x526S22a14477x526verb to make it easier to do something by offering one's services or resources: their parents helped with school expenses.
              • to improve (a situation or problem); to be of benefit to: upbeat comments about prospects helped confidence | [no object] : legislation to fit all new cars with catalytic converters will help.
              INFLECTED FORMS
              help (verb) [center to front loci]
              help [frequentative]
              noun a help (noun).

              DERIVATIVES
              helper nounAdam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8c8\uddf8\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1.mov"} ==? 33O G!frost2024/04/21 18:32:032026/05/04 03:58:20AS10020S2fe00S10006S2450aS17620S17620M518x537S10020482x467S2450a487x463S17620482x501S17620482x521noun an establishment which maintains a collection of wild animals, typically in a park or gardens, for study, conservation, or display to the public.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8de\uddeb\ud8cb\udc61\ud8cb\udc61.mov"}2462x480adjective [predicative] in a suitable state for an activity, action, or situation; fully prepared: are you ready, Carrie? | I began to get ready for bed | [with verb] : she was about ready to leave.
              • (of a thing) made suitable and available for immediate use: dinner's ready! | could you have the list ready by this afternoon?.
              • (ready with) keen or quick to give: I'm always ready with a wisecrack.
              • (ready for) in need of or having a desire for: I expect you're ready for a drink | she always looks ready for a fight.
              • [with verb] eager, inclined, or willing to do something: she is ready to die for her political convictions.
              • [with verb] in such a condition as to be likely to do something: by the time he arrived he was ready to drop.
              Adam Frost{"video":"dominance: equal;\\nletter: integrated;\\n\ud8c2\udde1\ud8fc\udc61\ud8c2\udde9\ud8fc\udc61\ud8fc\udc07\ud8e4\udf0b\ud8e4\udf13.mov"} M@33y1!efrost2024/04/21 18:43:362026/08/22 18:04:34AS1f540S2fe00S15a37S2fe00S21400S20500M515x515S15a37492x492S1f540485x485M515x521S15a37492x498S1f540485x491S26520495x479 M521x519S15a37498x'33C=7!Afrost2024/04/21 18:37:402026/05/20 20:55:51AS1ce11S38517S10006S20800S22f00M545x526S36d00479x504S1ce11517x491S20800516x516S22f00520x475S38b00470x493 M551x519S36d00479x485S1ce02499x497S20800532x500S26a00524x482 S38b04470x493noun
              1. a person who freely offers to take part in an enterprise or undertake a task.
                • a person who works for an organization without being paid.
                • a person who freely enrolls for military service rather than being conscripted, especially a member of a force formed by voluntary enrollment and distinct from the regular army.
              2. a formal request to an authority for something: an application for l{onclick="entry=1574; Query();">once (sense 1) incorporated with two: the tablets should be taken twice a day | she had been married twice.
              3. at or to twice the amount or extent: I'm twice your age | you have to be careful, and this counts double for older people.
              adjective consisting of two equal, identical, or similar parts or things: the double doors.
              • having twice the usual size, quantity, or strength: she sipped a double brandy.
              • designed to be used by two people: a double bed.
              • having two different roles or interpretations, especially in order to deceive or confuse: the double life of a freelance secret agent.
              • (of a domino) having the same number of dots on each half.
              predeterminer twice as much or as many: the jail now houses almost double the number of prisoners it was designed for | I'll pay double what I paid last t _U 335Qk!efrost2024/04/21 18:44:502026/08/19 17:37:40AS1f540S2fe00S15a37S2fe00S21400S20600M521x519S15a37498x489S1f540491x482S20600480x508M515x515S15a37492x492S1f540485x485noun the support or guidance that makes it easier to do something: I asked for help from my neighbors | thank you for your help.
              • a person or thing that provides useful support: he was a great help.
              • [as modifier] giving guidance to a computer user in the form of displayed instructions: a help menu.
              verb [frequentative] to help.
              exclamation used as an appeal for urgent assistance: Help! He's drowning!.Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8c8\uddf8\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} 7# 33) M!ofrost2024/04/21 18:48:382026/05/04 03:58:47AS10e20S2fe00S10006S14a20S1fb20M508x536S10e20493x464S14a20493x498S1fb20493x517noun
              1. a person qualified to treat diseased or injured animals.
              2. a person who has served in the military: a Vietnam vet.
              Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c1\udd61\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8d7\ude41.mov"}E 33AQ'!}frost2024/04/21 18:45:502026/08/19 17:40:51AS1f540S2fe00S15a37S2fe00S21400S20500S26520M515x521S15a37492x498S1f540485x491S26520495x479M515x515S15a37492x492S1f540485x485verb [center to front loci] to help: I can help you with that.Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8c8\uddf8\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\ude01.mov"} wGwL 33 !)frost2024/04/22 20:29:382026/05/09 17:48:44AS1dc02S38603S10006S20500M529x516S37605472x484S1dc02479x486Adam Frost{"video":"dominance: right;\\n\ud8d4\ude83\ud8fc\ude44\u00d8\ud8d8\udde1.mov"}5 33C Y!mfrost2024/04/28 19:20:232026/08/14 00:20:39AS10102S38517S10006S20e00S22f04M549x520S36d00479x481S10102497x490S20e00530x492S22f04524x506noun a person sent or authorized to represent others, in particular an elected representative sent to a conference: the delegates rejected the proposal.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c0\udc63\ud8fc\uddf8\u00d8\ud8d9\udd41\ud8dc\udda5.mov"} b 33M Q!Efrost2024/04/22 20:32:112025/03/13 01:15:21AS18511S2fe00S18519S2fe00S38006S28802S2881aS28802S2881aS2fd00M551x521S18511504x502S18519469x502S28802529x494S2881a450x494S28802529x480S2881a450x480S2fd00488x486verb fill (a suitcase or bag), especially with clothes and other items needed when away from home: [no object] : she had packed and checked out of the hotel | I packed a bag with a few of my favorite clothes.
              • to have one's belongings gathered and prepared for transport: I packed up my stuff and drove to Detroit.
              Adam Frost{"video":"dominance: right;\\n\ud8cc\uddf2\ud8fc\udc61\ud8cc\uddfa\ud8fc\udc61\ud8fc\udc07\ud8e4\udf03\ud8e4\udf1b\ud8e4\udf03\ud8e4\udf1b\ud8ef\udee1.mov"} / 33' )!-frost2024/04/22 20:40:202026/08/15 20:44:39AS18551S2fe00S18559S2fe00S38006S2d207S2d217S14c57S14c59M554x529S18551484x510S18559446x509S2d207506x497S2d217464x498S14c57528x472S14c59486x475verb to leave one's place of residence or work: they moved out and went north.
              • to go to live in another area: before they moved away, I saw her every Thursday night.
              Adam Frost{"video":"dominance: equal;\\n\ud8cc\ude32\ud8fc\udc61\ud8cc\ude3a\ud8fc\udc61\ud8fc\udc07\ud8eb\udec8\ud8eb\uded8\ud8c7\udcd8\ud8c7\udcda.mov"}  33[ E!)!frost2024/04/22 20:46:462026/06/14 01:29:52AS11a20S2fe00S11a28S2fe00S38006S2880aS28812M538x520S11a20502x490S11a28482x490S2880a516x480S2881?33[K!} frost2024/04/22 20:42:092026/08/15 20:27:20AS18521S2fe00S18529S2fe00S38006S28802S28812M541x514S18521494x495S18529459x495S28802519x487S28812476x487M541x514S18521494x495S18529459x495S2880a519x487S2881a476x487verb [right to center loci] to move.
              • to take possession of a new house or business premises: when I first moved in I painted everything magnolia.
              • to start to share accommodations with someone: a new tenant moved in | Victoria moved in with her new boyfriend.
              noun [right to center loci] a move.Adam Frost{"video":"dominance: equal;\\n\ud8cc\ude02\ud8fc\udc61\ud8cc\ude0a\ud8fc\udc61\ud8fc\udc07\ud8e4\udf03\ud8e4\udf13.mov"}sime.
              noun
              1. a thing which is twice as large as usual or is made up of two standard units or things: join the two sleeping bags together to make a double.
                • a hotel room or bedroom designed to be used by two people.
                • a double measure of liquor: [as modifier] : he ordered a double whiskey.
                • Baseball a hit that allows the batter to reach second base safely: Sabo came home on a double by O'Neill.
                • a type of bet in which two selections are made, with any winnings from the first being transferred to the second.
                • Bridge a call that will increase the points won if the declarer is successful, or increase the penalty points won by the defenders if the declarer fails to make the contract.
                • Darts a hit on the narrow ring enclosed by the two outer circles of a dartboard, scoring double: you must finish the game on a double.
              2. (doubles) (especially in tennis and badminton) a game or 0n0:# 33 M!)$frost2024/04/22 21:12:242026/03/11 18:07:28AS14e01S30005S10006S23603M546x547S2ff00482x483S14e01518x501S23603503x517exclamation used to express awe, shocked, or being overwhelmed: wow, that's great!Adam Frost{"video":"dominance: right;\\n\ud8c7\udd42\ud8f0\udc06\u00d8\ud8dd\udc44.mov"}(" 33 C!)#frost2024/04/22 21:09:032025/03/19 03:32:21AS14c02S2fe00S10006S22f04M516x520S14c02485x480S22f04491x506exclamation used to express amazement or being impressed: whoa, that's huge!.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc83\ud8fc\udc61\u00d8\ud8dc\udda5.mov"}b! 33 !)"frost2024/04/22 21:01:312026/01/11 21:51:44AS1f510S30006S10006S2b704M539x537S2ff00482x483S1f510524x495S2b704522x513verb to indicate or show that one is not willing to do something: he was severely beaten when he refused | I won't answer.Adam Frost{"video":"dominance: right;\\n\ud8d6\udff1\ud8f0\udc07\u00d8\ud8e9\udca5.mov"} [[!$ 33 5!)%frost2024/04/22 21:14:432026/05/26 03:43:59AS1c527S2fe00S10006S2ea08M515x527S1c527490x474S2ea08486x502verb [center to front loci] to feel sorrow for the misfortunes of: Clare didn't know whether to envy or pity them.
                noun [center to front loci] the feeling of sorrow and compassion caused by the suffering and misfortunes of others: her voice was full of pity.
                exclamation [center to front loci] used to express sympathy, pity, or compassion towards someone: oh, that must have been really hard.Adam Frost{"video":"dominance: right;\\n\ud8d2\ude08\ud8fc\udc61\u00d8\ud8ed\udfc9.mov"} ``%33[ !}&frost2024/04/22 21:36:432026/08/11 23:43:49AS10002S2fe00S15a48S2fe00S21406S20e00S28809M522x526S15a48479x495S10002492x511S20e00493x496S28809495x474M519x534S15a48481x497S10e01494x504S20e00495x489S28809497x467 M519x534S15a48481x497S11e01494x504S20e00495x489S28809497x467adverb
                1. on one occasion or for one time only: they deliver once a week.
                2. [usually with negative] at all; on even one occasion (used for emphasis): he never once complained | if she once got an idea in her head you'd never move it.

                DERIVATIVES
                twice numeral incorporation
                thrice numeral incorporationAdam Frost{"video":"dominance: right;\\n\ud8c0\udc03\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8e4\udf0a.mov"}!rect people's behavior or the course of events: the whole operation is under the control of a production manager | the situation was slipping out of her control.
                • control of or dominion over an area or people: the revolution brought an end to British rule.
                • the ability to manage a machine, vehicle, or other moving object: he lost control of his car | improve your ball control.
                • the restriction of an activity, tendency, or phenomenon: pest control.
                • the power to restrain something, especially one's own emotions or actions: give children time to get control of their emotions.
                • (often controls) a means of limiting or regulating something: growing controls on local spending.
                • a switch or other device by which a machine is regulated: the volume control.
                • the place where a particular item is verified: passport control.
                • the base from which a system or activity is directed: comul>
                • having three times the usual size, quality, or strength: a triple dark rum.
                predeterminer three times as much or as many: the copper energy cells had triple the efficiency of silicon cells.
                noun
                1. a thing that is three times as large as usual or is made up of three standard units or items: two whiskies—triples, please.
                2. (triples) a sporting contest in which each side has three players.
                3. Baseball a hit which enables the batter to reach third base.
                verb [no object]
                1. to become three times as much or as many: grain prices were expected to triple.
                  • [with object] to multiply by three: the party more than tripled its share of the vote.
                2. Baseball to hit a triple: he tripled into right field.
                Adam Frost{"video":"dominance: right;\\n\ud8c2\udf42\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8e4\udf0a.mov"}510verb going to see and spending time with (someone) socially: I am visiting my grandmother.
                • staying temporarily with (someone) or at (a place) as a guest or tourist: [no object] : I don't live here—I'm only visiting | we hope you enjoy your stay and visiting with us.
                • going to see (someone or something) for a specific purpose, such as to make an inspection or to receive or give professional advice or help: inspectors are visiting all the hotels.
                • going to (a website or web page): thank you for visiting us at www.flycreekcidermill.com.
                noun the process of going or coming to see a person or place socially, as a tourist, or for some other purpose: visiting the doctor.
                • a period of temporarily staying with a person or at a place: she enjoyed visiting the United States.
                Adam Frost{"video":"dominance: right;\\n\ud8c1\udd41\ud8fc\udc61\ud8c1\udd49\ud8fc\udc61\ud8fc\udc07\ud8ed\udfc1\ud8ee\udc0d.mov"} XXu'33[1 !}(frost2024/04/22 21:44:352026/08/12 01:00:54AS11e01S2fe00S15a48S2fe00S21406S20e00S28809M519x534S15a48481x497S11e01494x504S20e00495x489S28809497x467M522x526S15a48479x495S10002492x511S20e00493x496S28809495x474 M512x515S11e00489x485adverb once (sense 1) incorporated with three: Dean was married three times | a dose of 25 mg three time daily.
                adjective [attributive] consisting of or involving three parts, things, or people: a triple murder | triple somersaults. <&33[1G!}'frost2024/04/22 21:40:252026/08/12 00:48:58AS10e01S2fe00S15a48S2fe00S21406S20e00S28809M519x534S15a48481x497S10e01494x504S20e00495x489S28809497x467M522x526S15a48479x495S10002492x511S20e00493x496S28809495x474 M508x515S10e00493x485adverb
                1. verb [center to front loci] to go see and spending time with (someone) socially: I visit my grandmother | [no object] : he went out to visit with his pals.
                  • to stay temporarily with (someone) or at (a place) as a guest or tourist: [no object] : we hope you enjoy your stay and will visit with us.
                  • to go see (someone or something) for a specific purpose, such as to make an inspection or to receive or give professional advice or help: inspectors visit all the hotels.
                  • to go to (a website or web page): visit us at www.flycreekcidermill.com.
                  noun an act of going or coming to see a person or place socially, as a tourist, or for some other purpose: a visit to the doctor.
                  • a temporary stay with a person or at a place: she went on a visit to the United States.
                  Adam Frost{"video":"dominance: right;\\n\ud8c1\udd41\ud8fc\udc61\ud8c1\udd49\ud8fc\udc61\ud8fc\udc06\ud8e1\udde1\ud8e1\uddf1.mov"} dd( 33[ w!})frost2024/04/22 21:48:292026/06/28 17:20:07AS10630S2fe00S10638S2fe00S38007S26a00S26a10M530x535S10630506x483S10638480x509S26a00503x466S26a10471x492noun the action of traveling over snow on skis, especially as a sport or recreation: winter sports activities such as skiing, snowboarding, and ice skating | he enjoys hiking, skiing, biking, and spending time with his wife | [as modifier] : good skiing conditions.
                  verb to ski as a sport or recreation: she likes to ski during the winter.Adam Frost{"video":"dominance: right;\\n\ud8c0\ude71\ud8fc\udc61\ud8c0\ude79\ud8fc\udc61\ud8fc\udc08\ud8e1\udfc1\ud8e1\udfd1.mov"} **څR) 33[ k!}*frost2024/04/22 21:57:172026/03/18 17:22:24AS10630S2fe00S10638S2fe00S38007S27100S27114M537x536S10630506x484S10638480x510S27100497x465S27114463x492verb to move across ice as a sport or pastime: we ice skated on the neighborhood pond.
                  noun the sport or pastime of moving across ice: ice skating will be featured in the winter | activities include ice skating and sledding.
                  • (ice skate) a boot with a blade attached to the bottom, used for such an activity.
                  Adam Frost{"video":"dominance: right;\\n\ud8c0\ude71\ud8fc\udc61\ud8c0\ude79\ud8fc\udc61\ud8fc\udc08\ud8e2\ude61\ud8e2\ude75.mov"} TT(* 33M ]!E+frost2024/04/23 16:43:082025/03/13 17:43:18AS10e50S2fe00S10e58S2fe00S38006S22a04S22a14S26526S22a04S22a14M544x524S10e50477x476S10e58457x476S22a04531x509S22a14512x509S26526494x509S22a04478x509S22a14458x509noun the activity of visiting places of interest in a particular location: our two-week trip combines spectacular sightseeing and superb hospitality.
                  verb to visit places of interest in a particular location: the players have a day off to sightsee around London.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd91\ud8fc\udc61\ud8c1\udd99\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5\ud8e1\ude07\ud8db\udfc5\ud8db\udfd5.mov"} S- 33[ i!}.frost2024/04/23 16:51:422026/05/26 03:44:24AS10e00S2fe00S10e08S2fe00S38005S26500S26510M521x529S10e00506x499S10e08480x488S26500506x482S, 33[ {!}-frost2024/04/23 16:50:322026/01/09 02:45:02AS10e00S2fe00S10e08S2fe00S38006S2ea00S2ea4cM521x535S10e00505x466S10e08479x475S2ea00506x501S2ea4c480x)+ 33[ !},frost2024/04/23 16:45:362025/03/05 21:15:50AS19a40S2fe00S19a48S2fe00S38006S2a404S2a414M532x531S19a40504x470S19a48468x470S2a404505x495S2a414469x495noun a social gathering of invited guests, typically involving eating, drinking, and entertainment: an engagement party.Adam Frost{"video":"dominance: right;\\n\ud8ce\ude01\ud8fc\udc61\ud8ce\ude09\ud8fc\udc61\ud8fc\udc07\ud8e7\udd85\ud8e7\udd95.mov"}36x524S1ea07515x496S1ea0f464x496S2ea06510x477S2ea12464x477verb
                  1. to acknowledge (a significant or happy day or event) with a social gathering or enjoyable activity: they were celebrating their wedding anniversary at a restaurant | [no object] : she celebrated with a glass of champagne.
                    • to reach (a birthday or anniversary): the program celebrates its 40th birthday this year.
                  2. to perform (a religious ceremony) publicly and duly, in particular officiate at (the Eucharist): he celebrated holy communion.
                  3. to honor or praise publicly: a film celebrating the actor's career.
                  noun
                  1. the action of marking one's pleasure at an important event or occasion by engaging in enjoyable, typically social, activity: the birth of his son was a cause for celebration | a birthday celebration.
                  2. the date on which an event took place in a previous year: the 50th anniversary of the start of World War II | [as modifier] : anniversary celebrations.
                    • the date on which a country or other institution was founded in a previous year: Canada's 125th anniversary.
                    • the date on which a couple was married in a previous year: he even forgot our tenth anniversary!.
                    • informal the date on which a romance began in a previous month or week.
                  3. a day or period of celebration, typically a religious commemoration: a tabulation of saints' days and other festivals | [as modifier] : a festival atmosphere.
                    • an annual celebration or anniversary: highlights of this year's pumpkin festival.
                    • an organized series of concerts, plays, or movies, typically one held annually in the same place: numbers that are still heard at traditional jazz festivals.
                  Adam Frost{"video":"dominance: equal;\\n\ud8d5\udfc8\ud8fc\udc61\ud8d5\udfd0\ud8fc\udc61\ud8fc\udc07\ud8ed\udfc7\ud8ed\udfd3.mov"}   p. 33 9!)/frost2024/04/23 16:56:472025/03/18 17:03:10AS1f527S33d00S10006S20600M527x533S33b00482x483S1f527505x511S20600483x521noun an establishment where alcohol and sometimes other refreshments are served: a small friendly bar open all day.
                  • a room in a restaurant or hotel in which alcohol is served: the oak-paneled bar of the Lion | [as modifier] : bar stools.
                  Adam Frost{"video":"dominance: right;\\n\ud8d7\udc08\ud8f5\udee1\u00d8\ud8d8\ude41.mov"} $/ 335 M!e0frost2024/04/24 22:08:232026/03/18 17:50:13AS20357S2fe00S15a58S2fe00S38006S26a01M530x517S15a58470x487S20357509x496S26a01495x483noun a game played on a table in which balls are struck with a cue stick and pocketed: we played pool after dinner.
                  verb to play pool: they were shooting pool all night.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd78\ud8fc\udc61\ud8c8\ude19\ud8fc\udc61\ud8fc\udc07\ud8e1\udfc2.mov"} 00L033[)!1frost2024/04/24 22:15:452026/06/14 01:59:32AS14c51S2fe00S20359S2fe00S21400S20e00S27101M529x528S20359486x506S14c51502x502S20e00492x492S27101472x473M516x552S14720501x449S14a20500x475S1f720495x494S16d20499x513S11502485x537noun a beach.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udcd2\ud8fc\udc61\ud8d8\udd7a\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e2\ude62.mov"} pp 1339s!2frost2024/04/24 22:23:332026/06/14 02:39:48AS15a20S30005S1822fS2fe00S20500S18227S2fe00S38005S22113S22115S26500S26510M544x565S2ff00482x483S15a20503x508S26500518x515S26510475x550S18227518x488S1822f472x523S22113525x481S22115463x516M527x633S2ff00482x483S18710491x514S14c50503x602S14c58474x580S2c100497x570S2c111481x548noun a phonological variant (flat-hands) of ocean.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c8\udde1\ud8f0\udc06\ud8cc\udcf0\ud8fc\udc61\ud8d8\udde1\ud8cc\udce8\ud8fc\udc61\ud8fc\udc06\ud8db\udc74\ud8db\udc76\ud8e1\udde1\ud8e1\uddf1.mov"} ]233u3!3frost2024/04/24 22:26:312026/06/14 02:38:34AS14720S2fe00S10006S14a20S1f720S16d20S11502M516x552S14720501x449S14a20500x475S1f720495x494S16d20499x513S11502485x537M529x528S20359486x506S14c51502x502S20e00492x492S27101472x473 M527x633S2ff00482x483S18710491x514S14c50503x602S14c58474x580S2c100497x570S2c111481x548noun a strip of land covered with sand, pebbles, or small stones at the edge of a body of water, especially by the ocean between high- and low-water marks: fabulous sandy beaches | walking along the beach at sunset | [as modifier] : a beach bar.

                  SIGN VARIATIONS
                  beach with 5-hand brushing over fist
                  beach (sense 1a) compound of water and wavesAdam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udec1\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8d7\udcc1\ud8ca\udd01\ud8c1\udfe3.mov"}720498x535verb an association or organization dedicated to a particular interest or activity: a photography club | [as modifier] : the club secretary.
                  • the building or facilities used by a club.
                  • an organization or facility offering members social amenities, meals, and temporary residence: we had dinner at his club.
                  • a nightclub, especially one playing fashionable dance music.
                  • an organization constituted to play games in a particular sport: a football club | [as modifier] : the club captain.
                  • a commercial organization offering subscribers special benefits: a shopping club.
                  • [with adjective or noun modifier] a group of people, organizations, or nations having something in common: in cocktail lounges all over town convenes the daily meeting of the ain't-it-awful club.
                  Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8ca\udd01\ud8fc\udc61\u00d8\ud8d4\udea1\ud8c2\udc01\ud8c6\udec1.mov"}g of mild astonishment or shock caused by something unexpected: she couldn’t hide her surprise when they announced her name.
                2. [as modifier] denoting something made, done, or happening unexpectedly: a surprise attack.
          verb (of something unexpected) to cause (someone) to feel mild astonishment or shock: I was surprised at his statement | [with object and clause] : Joe was surprised that he enjoyed the journey | [with infinitive] : she was surprised to learn that he was forty.
          adjective causing surprise or not expected: a surprising sequence of events.
          • [predicate] feeling or showing surprise: she looked surprised.
          adverb in a way that causes surprise or not expected: the finale ends surprisingly | [as submodifier] : the move was surprisingly easy.Adam Frost{"video":"dominance: equal;\\n\ud8d6\udc31\ud8f1\udf91\ud8d6\udc39\ud8f1\udfa1\ud8e1\udde8\ud8e1\uddf2\ud8d4\ude91\ud8d4\ude99.mov"}9502x513S2b700522x458S2b711502x492preposition between (the time mentioned) and a later time, usually the present: she hasn't spoken to him since last year | a lot has changed in the industry since then | the worst property slump since the war.
          conjunction
          1. from a time in the past until a later time, usually the present: I've felt better since I've been here | ever since the film hit cinemas in 1996, fans have been wondering whether a sequel would finally get the go-ahead.
          2. nonstandard for the reason that; because: delegates were delighted, since better protection of rhino reserves will help protect other rare species.
          adverb from a past time until a later time, usually the present: she ran away on Friday and we haven't seen her since | the couple divorced in 2012 and he has since remarried.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc02\ud8fc\udde8\ud8c0\udc0a\ud8fc\udc61\ud8d8\udde1\ud8e9\udca1\ud8e9\udcb2.mov"} ~~23 33[ +!}4frost2024/04/24 22:33:042026/05/03 22:08:41AS1ea07S2fe00S1ea0fS2fe00S38006S2ea06S2ea12M5 4 33O c!5frost2024/04/24 22:34:112026/05/19 20:29:20AS16d20S2fe00S10006S1dc20S11520S14720M513x557S16d20496x443S1dc20488x467S11520497x501S14j5 33[ !}6frost2024/04/24 22:41:062025/03/13 17:40:04AS11020S2fe00S11028S2fe00S38006S2ea00S2ea4cM527x535S11020506x466S11028474x478S2ea00512x498S2ea4c476x510noun
          1. an amusement-park or fairground ride consisting of a giant vertical revolving wheel with passenger cars suspended on its outer edge.
          2. a public event or venue featuring entertainment, rides, games, food, and attractions, often designed for recreation, celebration, or community gathering.
          Adam Frost{"video":"dominance: right;\\n\ud8c1\ude21\ud8fc\udc61\ud8c1\ude29\ud8fc\udc61\ud8fc\udc07\ud8ed\udfc1\ud8ee\udc0d.mov"} pp 6 33 }!-7frost2024/04/24 23:08:472026/03/18 18:54:26AS11501S33200S11559S2fe00S20500S22a04S11551S21400S20500M526x569S33100482x483S11501499x500S22a04508x530S11559477x544S11551499x543noun enjoyment, amusement, or lighthearted pleasure: the children were having fun in the play area | anyone who turns up can join in the fun.
          • a source of fun: people watching is great fun.
          adjective amusing, entertaining, or enjoyable: it was a fun evening.Adam Frost{"video":"dominance: right;\\n\ud8c1\udfe2\ud8f4\udec1\ud8c2\udc3a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc5\ud8c2\udc32\ud8d9\udf81\ud8d8\udde1.mov"} bL8 335 m!9frost2024/04/24 23:44:542026/05/19 20:30:47AS1eb10S31410S1eb18S31420S26507S26511S1dc10S1dc18M577x518S2ff00482x483S1eb10513x490S1eb18463x490S26507539x479S26511448x479S1dc10553x447S1dc18423x447noun an unexpected or astonishing event, fact, or thing: the announcement was a complete surprise.
          • a feelin 733)3!o8frost2024/04/24 23:10:402026/08/09 18:25:26AS1ce20S2fe00S10006S11520S11920M514x547S1ce20492x453S11520493x487S11920487x521M526x569S33100482x483S11501499x500S22a04508x530S11559477x544S11551499x543exclamation used to express that something is fun or enjoyable: "What did you think of the ride?" "Fun!".
            noun, adjective fun.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d3\udd61\ud8fc\udc61\u00d8\ud8c2\udc01\ud8c2\udd81.mov"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx ! "!#"$#%$&%'&(')(*)+*,+-,.-/.0/102132435465768798:9;:<;=<>=?>@?A@BACBDCEDFEGFHGIHJIKJLKMLNMONPOQPRQSRTSUTVUWVXWYXZY[Z\[]\^]_^`_a`bacbdcedfegfhgihjikjlkmlnmde, or sacrifice for a purpose: [no object] : committee members who give so generously of their time and effort.
          noun
          1. a thing given willingly to someone without payment; a present: a Christmas gift.
            • something that is given to a charity, especially a sum of money: a tax-deductible donation of $200 | charitable contributions.
            • an article or other piece of writing submitted for publication in a collection: local historians are requesting contributions for a forthcoming book on the history of the community.
          2. a part played in helping to bring about a result or advance something: he made a lasting contribution by designing the modern radio telescope.

          PHONOLOGICAL VARIANTS
          gift with right handAdam Frost{"video":"dominance: right;\\n\ud8c0\ude51\ud8fc\udc61\ud8c0\ude59\ud8fc\udc61\ud8fc\udc08\ud8e9\udca1\ud8e9\udcb2.mov"}  ,"; 33[ !}the group has claimed responsibility for a string of murders.
        • the opportunity or ability to act independently and make decisions without authorization: we would expect individuals lower down the organization to take on more responsibility.
        • (often responsibilities) a thing that one is required to do as part of a job, role, or legal obligation: he will take over the responsibilities of overseas director.
        • a routine task, especially a household one: the early risers were up and about, doing their chores.
        • (responsibility to/toward) [in singular] a moral obligation to behave correctly toward or in respect of: individuals have a responsibility to control personal behavior.

        SIGN VARIATIONS
        duty with D-handAdam Frost{"video":"dominance: right;\\n\ud8cc\udcd2\ud8fc\udde8\ud8cc\udcca\ud8fc\uddf8\ud8d8\ude41\ud8d8\ude41.mov"} _< 33O 5!Y=frost2024/04/25 00:19:042025/03/19 16:50:14AS1c507S30004S10006S20500S22a04S20500M524x573S2ff00482x483S1c507499x517S22a04496x544S20500498x562noun the anniversary of the day on which a person was born, typically treated as an occasion for celebration and the giving of gifts: [as modifier] : a birthday cake | I'm getting a dollhouse for my birthday | the birthday boy.
        • the day of a person's birth: she shares a birthday with Paul McCartney.
        Adam Frost{"video":"dominance: right;\\n\ud8d2\udde8\ud8f0\udc05\u00d8\ud8d8\udde1\ud8db\udfc5\ud8d8\udde1.mov"}38a00464x490 S38b00470x493 M521x531S36d00479x469S10002487x478S1000a456x478S21100480x482S28c3b487x496S22a33495x513S22a03488x517S28c33462x496S22a35467x512S22a15472x517 S38b04470x493noun
        1. a heart.
        2. (Valentine's Day) February 14, a day when it is traditional to send a card, often anonymously, to a person one is romantically involved with or attracted to: for Valentine's Day, your beloved has planned a romantic date | [as modifier] : she exchanged Valentine's Day cards with her boyfriend.
        3. a card sent, often anonymously, on Valentine's Day to a person one loves or is attracted to.
          • a person to whom one sends a card on Valentine's Day.

        PHONOLOGICAL VARIANTS
        heart with 1-handsAdam Frost{"video":"dominance: right;\\n\ud8d2\udde2\ud8fc\uddf2\ud8d2\uddea\ud8fc\uddf2\ud8d9\ude61\ud8e5\udc8c\ud8e5\udc94.mov"} rS=33[ o!}>frost2024/04/25 00:22:562026/08/21 21:39:18AS10610S2fe00S10618S2fe00S38007S2b700S2b711M522x538S10610507x490S10618479x512S2b700501x463S2b711481x485S38b00470x493 M511x527S10610496x501S2b700490x474 S38b04470x493verb [to front locus] to intentionally give (something) to another as a favor or benefit: the teacher gave him two extra points to help him out.
        • to give (something) as a gift: the director gifted her with a heart-shaped brooch.
        • to give (money or goods) for a good cause, for example to a charity: a portion of the proceeds will be donated to charity.
        • to allow the removal of (blood or an organ) from one's body for transplantation, transfusion, or other use: (donated as adjective) : all donated blood is tested for antibodies.
        • to freely devote, set asi vxv~? 33O E!@frost2024/04/25 00:32:252026/08/21 17:51:33AS1f000S2fe00S10006S19220S1ce20S1fb20M518x548S1f000483x453S19220497x472S1ce20496x495S1fb20497x529noun
          1. a thing given willingly to someone without payment; a present: a Christmas gift | [as modifier] : a gift shop.
          2. a natural ability or talent: he has a gift for comedy.
          Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d6\ude01\ud8fc\udc61\u00d8\ud8cd\udee1\ud8d3\udd61\ud8d7\ude41.mov"}>33!)?frost2024/04/25 00:24:282026/08/21 21:38:31AS10610S2fe00S10006S2b700M511x527S10610496x501S2b700490x474M522x538S10610507x490S10618479x512S2b700501x463S2b711481x485verb, noun a phonological variant (right-handed) of gift.Adam Frost{"video":"dominance: right;\\n\ud8c0\ude51\ud8fc\udc61\u00d8\ud8e9\udca1.mov"}houghts and emotions, especially love, compassion, or loyalty: hardening his heart, he ignored her entreaties | he poured out his heart to me | she had already given her heart to another | he has no heart.
        • one's mood or feeling: they had a change of heart.
      • the central or innermost part of something: right in the heart of the city.
        • the vital part or essence: the heart of the matter.
      • a conventional representation of a heart with two equal curves meeting at a point at the bottom and a cusp at the top: she decorated the Valentine's card with hearts.
        • (hearts) one of the four suits in a conventional deck of playing cards, denoted by a red heart.
        • a playing card of the suit of hearts.

    SIGN VARIATIONS
    heart two-handedAdam Frost{"video":"dominance: right;\\n\ud8d2\udde2\ud8fc\uddf2\u00d8\ud8d8\ude41.mov"} n@ 33ikO!eAfrost2024/04/25 00:37:322026/08/21 01:37:17AS18211S38507S18209S38517S20600S20600M543x522S36d00479x499S18211518x479S18209488x505S20600494x486S20600512x507M521x523S10150480x477S2035a490x508S20600499x493adjective [predicative] being required to do, manage, or care for something as part of one's job or role: the department responsible for education.
    • being the primary cause of something and so able to be blamed or credited for it: the gene was responsible for a rare type of eye cancer.
    • capable of being trusted: she's very responsible; you can trust her.
    noun the state or fact of being required to deal with something or of having control over someone: a true leader takes responsibility for their team and helps them achieve goals.
    adverb
    1. in a very enthusiastic and eager manner: he talked excitedly about his future marriage plans | they excitedly waved and blew kisses.
    2. in a way that causes great enthusiasm and eagerness: [as submodifier] : their music remains excitingly vibrant | [sentence adverb] : excitingly, the drug should also protect against other viruses.
    noun
    1. a feeling of great enthusiasm and eagerness: her cheeks were flushed with excitement | the excitement of seeing a live leopard.
      • something that arouses enthusiasm and eagerness; an exciting incident: the excitements of the previous night.
      • sexual arousal.
    Adam Frost{"video":"dominance: right;\\n\ud8d2\udde2\ud8fc\uddf8\ud8d2\uddea\ud8fc\uddf2\ud8d9\udd41\ud8ed\udfc1\ud8ee\udc0d.mov"} jv 33) !Awfrost2024/04/29 19:33:342026/08/23 20:12:19AS16d02S38510S10006S21100S22a04M510x526S16d02490x474S211 RR*w 33 G!)xfrost2024/04/29 19:40:152026/09/03 18:04:29AS10e00S36a00S10006S20500M518x547S36a00482x477S10e00491x517
    adjective
    1. fixed in a particular position or unable to move or get free: Sara tried to open the window but it was stuck | the cat's stuck up a tree | twenty workers were trapped because of the flames.
      • unable to progress with a task or find the answer or solution to something: I'm doing the crossword and I'm stuck.
      • remaining in a static condition; failing to progress: he lost a lot of weight but was stuck at 210 pounds.
      • unable to leave or get free from a specified place or situation, especially one perceived as tedious or unpleasant: I don't want to be stuck in an office all my life.
    Adam Frost{"video":"dominance: right;\\n\ud8c1\udd41\ud8f9\udfc1\u00d8\ud8d8\udde1.mov"} }}x 33A _!}yfrost2024/04/30 16:04:092026/05/03 22:11:24AS15a30S2fe00S15a38S2fe00S21406S20500S26a20M514x522S15a30501x495S15a38488x495S26a20487x478noun a small vessel propelled on water by oars, sails, or an engine: a fishing boat | [as modifier] : a boat trip. verb to travel or go in a boat, especially for pleasure: they boated through fjords | she likes to go boating.Adam Frost{"video":"dominance: equal;\\n\ud8c8\uddf1\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\udfe1.mov"} wsz 33A a!}{frost2024/04/30 16:11:092026/09/04 18:16:43AS15a41S2fe00S15a49S2fe00S21406S20500S26520M5Ӆy 33A k!}zfrost2024/04/30 16:05:122026/05/03 22:11:50AS15a30S2fe00S15a38S2fe00S21406S20500S26520M513x523S15a30501x496S15a38488x496S26520494x478verb to travel or go in a boat, especially for pleasure: they boated through fjords | she likes to go boating.
    noun a small vessel propelled on water by oars, sails, or an engine: a fishing boat | [as modifier] : a boat trip. Adam Frost{"video":"dominance: equal;\\n\ud8c8\uddf1\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\ude01.mov"}S15a0a480x503S15a02494x507S2b700497x481
    adjective
    1. (of a time or season) coming immediately after the time of writing or speaking: we'll go next month.
      • (of a day of the week) nearest (or the nearest but one) after the present: not this Wednesday, next Wednesday.
      • (of an event or occasion) occurring directly in time after the present or most recent one, without anything of the same kind intervening: the next election | next time I'll bring a hat.
    2. coming immediately after the present one in order: the next chapter.
    adverb
    1. on the first or soonest occasion after the present; immediately afterwards: he wondered what would happen next.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8fc\udc05\ud8e9\udca1.mov"} "| 33[ !}}frost2024/04/30 16:17:532026/05/09 18:49:55AS11050S2fe00S16d48S2fe00S21400S20800S2880aM531x520S16d48470x480S11050480x493S20800498x489S2880a509x481Adam Frost{"video":"dominance: right;\\n\ud8c1\ude51\ud8fc\udc61\ud8ca\udd29\ud8fc\udc61\ud8d9\udf81\ud8d8\udf01\ud8e4\udf0b.mov"}"{ 33[ !}|frost2024/04/30 16:12:332026/05/09 18:49:39AS11050S2fe00S16d48S2fe00S21400S28802S20800M532x520S16d48469x480S11050479x493S20800497x489S28802510x480Adam Frost{"video":"dominance: right;\\n\ud8c1\ude51\ud8fc\udc61\ud8ca\udd29\ud8fc\udc61\ud8d9\udf81\ud8e4\udf03\ud8d8\udf01.mov"} TG} 33A o!}~frost2024/04/30 16:26:482026/09/06 17:39:32AS15a31S2fe00S15a39S2fe00S21400S2b700S20500M524x518S15a39476x483S15a31486x495S2b700505x490
    verb [no object]
    1. [to front locus] to reach a place at the end of a journey or a stage in a journey: we arrived at his house and knocked at the door | the team arrived in New Delhi on July 30 | they had recently arrived from Turkey.
      • [to front locus] (of a thing) to be brought or delivered: the invitation arrived a few days later.
      • (arrive at) to reach (a conclusion or decision): they arrived at the same conclusion.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\uddf2\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8e9\udca1\ud8d8\udde1.mov"}rTHflrx~ &,28D>`JPV\bhntz Z"(4.T:@FLRX^djpv|7/یp=?@ABCDEFGHIJKMNOQRTVŒXÌZČ[Ō]ƌ_Ɍ`ʌbˌčd͌eΌgЌhՌj֌lٌmڌo،nތrߌuvwxz|}   "#$& ) * +.-04659:;=>@!C"D#E$F%G&H(I)J,K-L.M/O1P2R3T5W6Z7]8_:a noun
    1. the organ of hearing in humans and other animals.
    verb
    1. [with object] to perceive with the ear the sound made by (someone or something): behind her she could hear men's voices | [no object] : he did not hear very well.
      • to listen or pay attention to: [with clause] : she just doesn't hear what I'm telling her.
    2. to be told or informed of: have you heard the news? | [with clause] : they heard that I had moved | [no object] : no doubt you heard about the raid.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f4\ude11\u00d8\ud8d8\udde1.mov"} D#DS 33u S!}frost2024/04/30 17:00:582026/09/06 01:35:27AS1c501S38517S1c509S38511S20e00S2ea00S2ea4cM530x533S1c501505x468S1c509470x482S20e00496x509S2ea00511x494S2ea4c479x508
    adjective
    1. very enthusiastic and eager: they were excited about the prospect | the excited children.
      • sexually aroused.
    2. causing great enthusiasm and eagerness: an exciting breakthrough.
    verb [with object]
    1. to cause strong feelings of enthusiasm and eagerness in (someone): that new idea excites me | Gould was excited by these discoveries.
      • to arouse (someone) sexually: Y 33 !)frost2024/04/30 16:56:592026/05/09 22:05:23AS14c10S38507S10006S2bd05M539x531S36d00479x501S14c10516x469S2bd05524x503Adam Frost{"video":"dominance: right;\\n\ud8c7\udc91\ud8fc\udde8\u00d8\ud8e9\udee6.mov"}nitive] : Ben stood on the street corner waiting to cross | [with object] : I had to wait my turn to play.
        • (wait for) to stay where one is or delay action until (someone) arrives or is ready: he sits on the corner waiting for Mary.
        • to be left until a later time before being dealt with: we shall need a statement later, but that will have to wait.
        • to remain in readiness for some purpose: he found the train waiting at the platform.
      • (cannot wait) used to indicate that one is eagerly impatient to do something or for something to happen: I can't wait for tomorrow | [with infinitive] : I can't wait to get started again.
    noun
    1. [in singular] a period of waiting: we had a long wait.
    Adam Frost{"video":"dominance: right;\\n\ud8c7\udc81\ud8fc\udc61\ud8c7\udc89\ud8fc\udc61\ud8fc\udc06\ud8db\uddf1\ud8db\uddf1.mov"}482x483S1a010478x502S20e00524x500S22f00518x484
    adjective
    1. staying aloof from others because one thinks one is superior: she liked to prove she wasn't stuck-up.
    noun
    1. a person who stays aloof from others because they think they are superior: there were several snobs at the party.
      • a person with an exaggerated respect for high social position or wealth who seeks to associate with social superiors and dislikes people or activities regarded as lower-class: her mother was a snob and wanted a lawyer as a son-in-law.
      • [with adjective or noun modifier] a person who believes that their tastes in a particular area are superior to those of other people: a musical snob.
    Adam Frost{"video":"dominance: right;\\n\ud8cf\udc11\ud8f4\udec1\u00d8\ud8d9\udd41\ud8dc\udda1.mov"} g 33C i!Afrost2024/04/30 17:14:452026/09/05 19:41:49AS1dc01S30005S10006S20e00S26a06M548x537S2ff00482x483S1dc01508x507S20e00520x498S26a06534x491
    verb [no object]
    1. to make spontaneous movements and facial expressions associated with lively amusement, sometimes accompanied by sound: she couldn't help laughing at his jokes | he laughed out loud.
    noun
    1. the action or sound of laughing: I heard laughter in the other room.
      • an act of laughing: the baby has a cute laugh.
    Adam Frost{"video":"dominance: right;\\n\ud8d4\ude82\ud8f0\udc06\u00d8\ud8d9\udd41\ud8e1\udfc7.mov"}& 335 Q!efrost2024/04/30 17:02:022026/09/04 22:23:06AS15a02S2fe00S15a0aS2fe00S38004S2b700M521x519 55G 33g 1!frost2024/04/30 17:19:042026/08/25 17:22:39AS15412S2fe00S15a39S2fe00S21400S20500S2df08S20500M524x526S15a39500x500S15412488x498S20600476x515S2df08503x475
    noun
    1. a small sweet cake, typically round and flat and having a crisp or chewy texture: freshly baked cookies.
    2. Computing a packet of data sent by a web server to a browser, which is returned by the browser each time it subsequently accesses the same server, used to identify the user or track their access to the server.
    Adam Frost{"video":"dominance: right;\\n\ud8c7\udf93\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8ec\udfa9\ud8d8\udde1.mov"} 6\6" 33[ !}frost2024/04/30 17:35:432026/05/09 22:21:34AS1bb31S2fe00S15a0aS2fe00S21414S21000S22f04M525x523S1bb31476x478S15a0a495x478S21000502x492S22f04500x509Adam Frost{"video":"dominance: right;\\n\ud8d1\ude52\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf95\ud8d9\ude01\ud8dc\udda5.mov"}  33 ;! frost2024/04/30 17:29:552025/02/27 19:50:11AS1bb07S33d00S10006S20500S26500S1bb00S20e00S22804M550x520S33b00482x483S1bb07506x496S26500521x484S1bb00515x453S20e00538x468S22804539x482adjective highly pleasant to the taste: delicious home-baked brown bread.Adam Frost{"video":"dominance: right;\\n\ud8d1\ude28\ud8f5\udee1\u00d8\ud8d8\udde1\ud8e1\udde1\ud8d1\ude21\ud8d9\udd41\ud8db\udf05.mov"} | [with clause] : everybody agrees that jobs will go.
    • (agree with) to approve of (something) with regard to its moral correctness: do you agree with capital punishment?.
  • (agree to or to do something) to consent to do something that has been suggested by another person: she had agreed to go and see a movie with him.
    • [with object] to reach agreement about (something), typically after a period of negotiation: the government has agreed a plan on the country's territorial waters | [no object] : the commission agreed on a proposal to limit imports.
  • (agree with) to be consistent with: your body language does not agree with what you are saying.
    • Grammar to have the same number, gender, case, or person as: the writer made the verb agree with the subject.
  • (agree with) [usually with negative] (of food, conditions, etc.) to be healthy or appropr Y 33 !)frost2024/04/30 17:43:222026/05/09 22:21:52AS15a01S33200S10006S2ea00M537x526S33100482x483S15a01505x503S2ea00522x486Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc2\ud8f4\udec1\u00d8\ud8ed\udfc1.mov"}z 33[ ;!}frost2024/04/30 17:41:172026/08/25 17:29:40AS14c00S2fe00S14c08S2fe00S38005S22510S22510M528x530S14c00505x499S14c08473x485S22510506x484S22510473x470
    verb [no object]
    1. to stay where one is or delay action until a particular time or until something else happens: I rang the bell and waited | he did not wait for a reply | we're waiting for Allan to get back | I was told to wait outside until the office was open | [with infi " 33[ !}frost2024/04/30 17:50:112026/05/09 22:22:09AS10002S2fe00S1000aS2fe00S38006S26a02S26a16M553x514S10002506x493S1000a465x493S26a02539x487S26a16448x487Adam Frost{"video":"dominance: right;\\n\ud8c0\udc03\ud8fc\udc61\ud8c0\udc0b\ud8fc\udc61\ud8fc\udc07\ud8e1\udfc3\ud8e1\udfd7.mov"}" 33[ !}frost2024/04/30 17:49:252026/05/09 22:22:01AS10012S2fe00S1001aS2fe00S38006S2843eS2841aM571x510S10012505x493S1001a464x493S2843e538x490S2841a429x490Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8fc\udc61\ud8c0\udc1b\ud8fc\udc61\ud8fc\udc07\ud8e4\uddbf\ud8e4\udd9b.mov"} ,<_,/ 33u !}frost2024/04/30 18:19:142026/05/09 22:24:58AS14e02S38517S14e0aS38511S20e00S28809S28811M534x523S14e02503x498S14e0a466x498S20e00494x486S28809514x478S28811466x478Adam Frost{"video":"dominance: equal;\\n\ud8c7\udd43\ud8fc\uddf8\ud8c7\udd4b\ud8fc\uddf2\ud8d9\udd41\ud8e4\udf0a\ud8e4\udf12.mov"}Y 33 !)frost2024/04/30 18:11:292026/05/09 22:24:25AS15400S33d00S10006S21800M538x533S33b00482x483S15400509x508S21800520x500Adam Frost{"video":"dominance: right;\\n\ud8c7\udf81\ud8f5\udee1\u00d8\ud8da\udd01.mov"}@ 33 Y!)frost2024/04/30 18:01:082025/03/26 16:48:22AS15400S33d00S10006S26500M525x552S33b00482x483S15400509x508S26500511x537adjective feeling or showing strong annoyance, displeasure, or hostility: a mad customer | he looked angry and confused | why are you angry with me? | Christine had made him angry | I'm angry that she didn't call me.Adam Frost{"video":"dominance: right;\\n\ud8c7\udf81\ud8f5\udee1\u00d8\ud8e1\udde1.mov"} XX~ 33? !Qfrost2024/04/30 18:46:542026/05/09 22:26:18AS10011S30007S10006S20500S15451S2fe00S1543fS2fe00S37f00S2ea06S2ea42M539x573S2ff00482x483S10011516x491S15451486x527S1543f482x549S2ea06514x532S2ea42510x551Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f0\udc08\u00d8\ud8d8\udde1\ud8c7\udfd2\ud8fc\udc61\ud8c7\udfc0\ud8fc\udc61\ud8fb\udfa1\ud8ed\udfc7\ud8ee\udc03.mov"}" 33[ !}frost2024/04/30 18:28:452026/05/09 22:26:07AS15451S2fe00S1543fS2fe00S37f00S2ea06S2ea42M529x523S15451476x477S1543f472x499S2ea06504x482S2ea42500x501Adam Frost{"video":"dominance: right;\\n\ud8c7\udfd2\ud8fc\udc61\ud8c7\udfc0\ud8fc\udc61\ud8fb\udfa1\ud8ed\udfc7\ud8ee\udc03.mov"} 88D 335 ]!frost2024/04/30 18:55:412026/09/04 21:11:12AS14c01S30005S14c09S30003S22511S22517S22a07S22a11M560x544S2ff00482x483S14c01526x517S14c09448x517S22511515x506S22517467x506S22a07547x508S22a11440x508
      adjective
      1. kind and pleasant: they were friendly to me | she gave me a friendly smile.
      2. [in combination] denoting something that is adapted for or is not harmful to a specified thing: an environment-friendly agronomic practice | child-friendly policies.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udc82\ud8f0\udc06\ud8c7\udc8a\ud8f0\udc04\ud8db\uddf2\ud8db\uddf8\ud8db\udfc8\ud8db\udfd2.mov"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxpoqprqsrtsutvuwvxwyxzy{z|{}|~}~ ^E< 33[ ?!}frost2024/05/01 19:47:582026/08/25 17:19:55AS1c550S2fe00S15a39S2fe00S21400S20e00S26507M533x525S15a39467x502S1c550483x494S20e00508x487S26507520x475
      adjective
      1. offensively impolite or ill-mannered: she had been rude to her boss | he is a rude and arrogant bully | [with infinitive] : it's rude to talk about people right in front of them.
      Adam Frost{"video":"dominance: right;\\n\ud8d2\ude31\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde8.mov"} 33s !]frost2024/05/01 19:42:492026/05/09 22:26:36AS14e10S33200S14e48S2fe00S20500S22a04S21600S1f740S21406S20e00S22a04M524x600S33100482x483S14e10499x502S14e48478x549S22a04505x536S21600488x539S1f740504x554S20e00506x571S22a04505x585Adam Frost{"video":"dominance: right;\\n\ud8c7\udd51\ud8f4\udec1\ud8c7\udd89\ud8fc\udc61\ud8d8\udde1\ud8db\udfc5\ud8da\udc41\ud8d7\udce1\ud8d9\udf87\ud8d9\udd41\ud8db\udfc5.mov"} ;2 33A !-frost2024/05/01 20:26:082026/09/18 04:35:26AS1543eS38517S15436S38511S21100S22f04S22f14S20332S2033aM533x525S1543e508x475S15436468x475S21100494x483S22f04508x493S22f14468x493S20332513x510S2033a473x510
      adjective
      1. suppressing feelings, opinions, or wants rather than expressing them: the women were portrayed as passive victims.
      Adam Frost{"video":"dominance: equal;\\n\ud8c7\udfbf\ud8fc\uddf8\ud8c7\udfb7\ud8fc\uddf2\ud8d9\ude61\ud8dc\udda5\ud8dc\uddb5\ud8d8\udd53\ud8d8\udd5b.mov"}" 33[ !}frost2024/05/01 19:52:162026/05/09 22:26:59AS11541S2fe00S15a38S2fe00S21400S21100S26500M515x529S15a38485x486S11541491x502S21100501x489S26500500x472Adam Frost{"video":"dominance: right;\\n\ud8c2\udc22\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e1\udde1.mov"} L 33 !)frost2024/05/03 17:15:082026/05/09 22:29:03AS17610S30000S10006S20500M518x518S2ff00482x483S17610492x476Adam Frost{"video":"dominance: right;\\n\ud8cb\udc51\ud8f0\udc01\u00d8\ud8d8\udde1.mov"} 33C U!Afrost2024/05/03 17:11:202026/09/18 05:26:11AS1a010S33200S10006S20e00S22f00M543x531S33100 33 !frost2024/05/03 17:07:242026/09/18 00:58:57AS1f710S38517S1f718S38511S20500S20500S26500S26510M529x524S1f710509x495S1f718472x495S20500512x513S20500479x513S26500510x477S26510477x477
      adjective
      1. having or showing a confident and forceful personality: patients should be more assertive with their doctors.
      Adam Frost{"video":"dominance: equal;\\n\ud8d7\udcb1\ud8fc\uddf8\ud8d7\udcb9\ud8fc\uddf2\ud8d8\udde1\ud8d8\udde1\ud8e1\udde1\ud8e1\uddf1.mov"}iate for (someone): she's eaten something that didn't agree with her | in Australia the climate did not agree with me.
    noun
    1. harmony or accordance in opinion or feeling; a position or result of agreeing: the governments failed to reach agreement | the two officers nodded in agreement | there is wide agreement that investment is necessary.
      • a negotiated and typically legally binding arrangement between parties as to a course of action: a trade agreement | a verbal agreement to sell.
      • the absence of incompatibility between two things; consistency: agreement between experimental observations and theory.
      • Grammar the condition of having the same number, gender, case, or person.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f0\udc08\u00d8\ud8d8\udde1\ud8c0\udc51\ud8fc\udc61\ud8c0\udc59\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1.mov"}ering appliances: the electricity was back on.
  • energy that is produced by mechanical, electrical, or other means and used to operate a device: generating power from waste | [as modifier] : power cables.
    • electrical energy supplied to an area, building, etc.: the power went off.
    • [as modifier] driven by electrical energy: a power drill.
    • a container consisting of one or more cells, in which chemical energy is converted into electricity and used as a source of power: [as modifier] : battery power.
    • a device for charging a battery or battery-powered equipment.
    adjective of, worked by, charged with, or producing electricity: an electric stove | an electric current.
    • (of a musical instrument) amplified through a loudspeaker: electric bass guitar.
    Adam Frost{"video":"dominance: equal;\\n\ud8c0\ude43\ud8fc\udc61\ud8c0\ude4b\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"}section id=modalverb1705> modal verb
    1. to be able to: they can run fast | I could hear footsteps.
      • to be able to through acquired knowledge or skill: I can speak Italian.
      • to have the opportunity or possibility to: there are many ways vacationers can take money abroad.
      • to express in question doubt about what is possible: where could she have gone?.
      • to indicate that something is typically the case: antique clocks can seem out of place in modern homes | he could be very moody.
    2. to be permitted to: you can use the phone if you want to | may I ask a few questions?.
    3. to ask someone to do something: can you open the window?.
      • to make a suggestion or offer: we can have another drink if you like.
    Adam Frost{"video":"dominance: equal;\\n\ud8d8\udd71\ud8fc\udc61\ud8d8\udd79\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"} XVX/r 33e 5!ifrost2024/05/03 17:25:052026/08/25 17:55:34AS10011S30007S10006S20500S10002S2fe00S1000aS2fe00S21406S20500S26506S26512M550x549S2ff00482x483S10011516x491S22a03509x516S10002501x534S1000a469x534S26506535x534S26512450x534
    verb [no object]
    1. to have or express a different opinion: no one was willing to disagree with him | historians often disagree.
      • (disagree with) to disapprove of: she disagreed with the system of aparthei 33 !9frost2024/05/03 17:20:452026/08/25 17:49:26AS10011S30007S10006S20500S10050S2fe00S10058S2fe00S21406S20500M537x561S2ff00482x483S10011516x491S22a03508x517S10050501x531S10058484x531
        verb [no object]
        1. to have the same opinion about something: I completely agree with your recent editorial | we both agreed on issues such as tougher penalties for criminalsi>what were you thinking?.
        2. (I think) used in speech to reduce the force of a statement or opinion, or to politely suggest or refuse something: I thought we could go out for a meal.
    2. [no object] to direct one's mind toward someone or something; to use one's mind actively to form connected ideas: he was thinking about Colin | Jack thought for a moment.
      • to have a particular mental attitude or approach: he thought like a general | [with complement] : one should always think positive.
      • (think to do something) to have sufficient foresight or awareness to do something: I hadn't thought to warn Rachel about him.
      • to imagine (an actual or possible situation): think of being paid a salary to hunt big game! | [with clause] : I never thought we'd raise so much money.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f0\udc08\u00d8\ud8d8\udde1.mov"} / 33u !}frost2024/05/03 17:33:172026/05/09 22:30:06AS1c501S38517S1c509S38511S20e00S28809S28811M532x525S1c501507x500S1c509468x500S20e00494x497S28809512x476S28811468x476Adam Frost{"video":"dominance: equal;\\n\ud8d2\udde2\ud8fc\uddf8\ud8d2\uddea\ud8fc\uddf2\ud8d9\udd41\ud8e4\udf0a\ud8e4\udf12.mov"} //M 33 s!)frost2024/05/03 17:42:102025/07/12 17:51:40AS10000S30004S10006S20b00M519x541S2ff00482x483S10000487x511S20b00506x518adjective
    1. (of a person) sad or displeased because someone or something has failed to fulfill one's hopes or expectations: I'm disappointed in you, Mary | thousands of disappointed customers were kept waiting.
    2. having a sharp or unpleasant taste; not sweet: the raw berries have a bitter flavor.
    verb notice the loss or absence of: he's rich—he won't miss the money | she slipped away when she thought she wouldn't be missed.
    • feel regret or sadness at no longer being able to enjoy the presence of: she misses all her old friends.
    • feel regret or sadness at no longer being able to go to, do, or have: I still miss France and I wish I could go back.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8f0\udc05\u00d8\ud8d9\udc21.mov"} 44H 33 !frost2024/05/03 17:44:252025/03/20 02:13:08AS15a12S38510S15a1aS38530S21100S21100S22a04S22a14M528x528S15a12485x474S15a1a487x497S21100515x473S21100472x496S22a04515x490S22a14472x513noun a feeling of reassurance and relaxation following release from anxiety or distress: much to her relief, she saw the door open.
    • a cause of or occasion for relief: it was a relief to find somewhere to stay.
    adjective no longer feeling distressed or anxious; reassured: relieved parents who had waited anxiously for news.
    verb to make or become less tense or anxious: [no object] : he relaxed and smiled confidently.
    • to cause (someone) to stop feeling distressed or anxious about something: he was relieved by her change of tone.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd3\ud8fc\uddf1\ud8c8\udddb\ud8fc\ude11\ud8d9\ude61\ud8d9\ude61\ud8db\udfc5\ud8db\udfd5.mov"} rr 33i !Yfrost2024/05/03 18:23:032026/05/09 22:30:35AS14c52S38404S10006S20e00S26506S20310M552x536S2ff00482x483S14c52471x512S20e00504x518S26506519x517S20310537x517Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd3\ud8fc\udd85\u00d8\ud8d9\udd41\ud8e1\udde7\ud8d8\udd31.mov"}[ 335 !frost2024/05/03 18:10:392026/05/09 22:30:26AS15a10S30006S15a18S30002S26501S26517S15a41S15a49M535x518S2ff00482x483S15a10523x485S15a18465x485S26501516x469S26517471x469S15a41502x443S15a49474x443Adam Frost{"video":"dominance: equal;\\n\ud8c8\uddd1\ud8f0\udc07\ud8c8\uddd9\ud8f0\udc03\ud8e1\udde2\ud8e1\uddf8\ud8c8\ude02\ud8c8\ude0a.mov"} 33O !efrost2024/05/03 17:47:592026/05/09 22:30:13AS15a12S38510S15a1aS38530S20500S20500M525x518S15a12486x483S15a1a488x506S20500515x483S20500476x506Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd3\ud8fc\uddf1\ud8c8\udddb\ud8fc\ude11\ud8d8\udde1\ud8d8\udde1.mov"} 5#5j" 33) !Afrost2024/05/03 18:31:222026/09/30 00:57:56AS14c10S38510S10006S20500S22510M518x524S14c10483x493S20500508x506S22510484x477
    adjective
    1. informal fashionably attractive or impressive: he made no concessions to fashion, yet somehow he was hip and cool | I always wore sunglasses to look cool.
      • excellent: [as exclamation] : our office was a sunny room with a computer you didn't even have to plug in. Cool!.
      • used to express acceptance or agreement: if people want to freak out at our clubs, that's cool.
    Adam Frost{"video":"dominance: right;\\n\ud8c7\udc91\ud8fc\uddf1\u00d8\ud8d8\udde1\ud8db\uddf1.mov"}Y! 33 !)frost2024/05/03 18:25:542026/05/09 22:30:45AS1c501S38511S10006S20500M521x522S36d00479x478S1c501476x485S20500469x511Adam Frost{"video":"dominance: right;\\n\ud8d2\udde2\ud8fc\uddf2\u00d8\ud8d8\udde1.mov"} ii# 33) [!Afrost2024/05/03 18:36:012026/09/30 00:59:15AS1eb10S30005S10006S21100S2c300M547x527S2ff00482x483S1eb10512x508S2c300521x485
    adjective
    1. informal very good or pleasant; excellent: it was really neat seeing the city.
    Adam Frost{"video":"dominance: right;\\n\ud8d6\udc31\ud8f0\udc06\u00d8\ud8d9\ude61\ud8ea\udd21.mov"} w$ 33 !efrost2024/05/03 18:37:562026/06/05 17:29:17AS18510S2fe00S18518S2fe00S21406S20500M526x508S18510501x493S18518474x493determiner a greater or additional amount or degree of: she poured herself more coffee | I feel better in myself and I have more energy.
    pronoun a greater or additional amount of something: tell me more | products of superior quality usually cost more | you guys will probably know more than me about this | they were more of a hindrance than a help.

    INFLECTED FORMS
    more [in isolation]Adam Frost{"video":"dominance: equal;\\n\ud8cc\uddf1\ud8fc\udc61\ud8cc\uddf9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1.mov"} t& 33A I!}frost2024/05/03 18:46:262026/06/03 18:25:23AS10002S2fe00S18548S2fe00S21400S2e700S20500M534x513S10002486x493S18548467x496S2e700519x488preposition on the subject of; concerning: I was thinking about you | it's all about having fun | an article about yellow fever.
    • so as to affect: there's nothing we can do about it.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc03\ud8fc\udc61\ud8cc\ude29\ud8fc\udc61\ud8d9\udf81\ud8ed\udea1\ud8d8\udde1.mov"}% 335 !efrost2024/05/03 18:39:162026/05/09 22:32:00AS15a51S2fe00S15a39S2fe00S37f00S22a04M518x531S15a39482x508S15a51495x487S22a04496x469Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8fb\udfa1\ud8db\udfc5.mov"} S:") 33[ !}frost2024/05/03 18:57:432026/05/09 22:32:45AS20350S2fe00S20358S2fe00S38006S22f04S22f14M529x516S20350509x484S20358476x484S22f04504x502S22f14471x502Adam Frost{"video":"dominance: equal;\\n\ud8d8\udd71\ud8fc\udc61\ud8d8\udd79\ud8fc\udc61\ud8fc\udc07\ud8dc\udda5\ud8dc\uddb5.mov"}( 33[ !}frost2024/05/03 18:54:232026/08/28 18:24:11AS20350S2fe00S20358S2fe00S38006S22a04S22a14M524x517S20350509x484S20358476x484S22a04510x502S22a14477x502<)' 33 E!)frost2024/05/03 18:50:402026/06/28 21:26:10AS10020S2fe00S10006S29f0cM519x524S10020482x476S29f0c500x491noun
    1. a sentence worded or expressed so as to elicit information: we hope this leaflet has been helpful in answering your questions.
    2. a punctuation mark (?) indicating a question.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8e6\udfad.mov"}0482x483S15a00494x510S20e00513x517S22f04507x532M521x547S2ff00482x483S15a00494x510S20e00508x517S22a04508x532noun
    1. a sweet crystalline substance obtained from various plants, especially sugar cane and sugar beet, consisting essentially of sucrose, and used as a sweetener in food and drink: a spoonful of sugar | [as modifier] : a sugar bowl.
    2. a disease in which the body’s ability to produce or respond to the hormone insulin is impaired, resulting in abnormal metabolism of carbohydrates and elevated levels of glucose in the blood and urine.
    adjective
    1. [in isolation] sweet.
    2. (of a person) having diabetes.
      • relating to or designed to relieve diabetes: a diabetic clinic | a diabetic diet.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc1\ud8f0\udc05\u00d8\ud8d9\udd41\ud8dc\udda5.mov"}0482x483S15a00494x510S20e00508x517S22a04508x532M532x546S2ff00482x483S15a00494x510S20e00513x517S22f04507x532adjective
    1. having the pleasant taste characteristic of sugar or honey; not salty, sour, or bitter: a cup of hot sweet tea | a sweet taste of success · figurative.
      • (of air, water, or food) fresh, pure, and untainted: lungfuls of the clean, sweet air.
    2. pleasing in general; delightful: it was the sweet life he had always craved.
    3. (of a person or action) pleasant and kind or thoughtful: a very sweet nurse came along.
      • (especially of a person or animal) charming and endearing: a sweet little cat.

    INFLECTED FORMS
    sweet [in isolation]Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc1\ud8f0\udc05\u00d8\ud8d9\udd41\ud8db\udfc5.mov"} n* 33 O!)frost2024/05/03 18:58:412026/08/28 18:50:21AS10011S30007S10006S20500M537x521S2ff00482x483S10011516x491
    verb
    1. [with clause] to have a particular opinion, belief, or idea about someone or something: she thought that nothing would be the same again.
      • used in questions to express anger or surprise: < SS)+ 33) !Afrost2024/05/03 23:34:222025/03/20 01:44:10AS10011S33200S10006S21100S2c300M548x534S33100482x483S10011503x504S2c300522x498adjective
        1. not interesting; tedious: I've got a boring job in an office.
        2. feeling weary because one is unoccupied or lacks interest in one's current activity: she got bored with staring out of the window | they would hang around all day bored.
        noun a person whose talk or behavior is dull and uninteresting: a crashing bore who tells the same old jokes over and over.
        • a tedious situation or thing: it's such a bore cooking when one's alone.
        verb to make (someone) feel weary and uninterested by tedious talk or dullness: rather than bore you with all the details, I'll hit some of the bright spots.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f4\udec1\u00d8\ud8d9\ude61\ud8ea\udd21.mov"} k, 33) !Afrost2024/05/04 00:00:142026/05/09 22:33:02AS10011S33200S10006S20500S28107M543x534S33100482x483S10011503x504S28107520x492Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f4\udec1\u00d8\ud8d8\udde1\ud8e4\udc68.mov"}5- 33 !Ufrost2024/05/04 00:04:012026/06/03 16:18:35AS1dc01S38511S10006S20600M521x521S36d00479x479S1dc01471x479S20600471x510adjective unwilling to work or use energy: he was too lazy to cook | I'm very lazy by nature.
        • characterized by lack of effort or activity: lazy summer days.
        • showing a lack of effort or care: lazy writing.
        • (of a river) slow-moving: a lazy lowland river.
        Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d4\ude82\ud8fc\uddf2\u00d8\ud8d8\ude41.mov"} O. 33 w!)frost2024/05/04 00:06:482026/10/03 21:15:23AS10012S33010S10006S2ea00M567x518S33010479x483S10012519x489S2ea00552x485
        adjective
        1. very foolish, senseless, or strange: it was crazy to hope that good might come out of this mess | I'm always full of crazy ideas | the whole thing is crazy but I don't regret it.
        2. (of a person) wildly irrational or incoherent: Stella went crazy and assaulted a visitor | a crazy grin.
          • sometimes offensive having a mental illness.
        3. (crazy about) extremely excited or enthusiastic: I'm crazy about Cindy.
        4. extremely angry: that noise makes me crazy.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8f4\ude11\u00d8\ud8ed\udfc1.mov"} ]/ 33C U!Afrost2024/05/04 00:11:432026/08/09 18:21:43AS12d00S33200S10006S20e00S22114M540x533S33100482x483S12d00488x503S20e00521x502S22114514x516adjective
        1. causing laughter or amusement; humorous: a funny story | the play is hilariously funny.
          • [predicative, with negative] informal used to emphasize that something is serious or should be taken seriously: stealing other people's work isn't funny.
        2. difficult to explain or understand; strange or odd: I had a funny feeling you'd be around | the funny thing is I can't remember much about it.
          • unusual, especially in such a way as to arouse suspicion: there was something funny going on.
          • informal slightly but undefinably unwell: suddenly my stomach felt funny | Are you okay? You look a bit funny.
        Adam Frost{"video":"dominance: right;\\n\ud8c4\udce1\ud8f4\udec1\u00d8\ud8d9\udd41\ud8db\udc75.mov"} 0"0 33i !!Yfrost2024/05/04 00:17:492026/08/28 19:09:51AS10012S33200S10006S20e00S26506S10612M590x523S33100482x483S10012497x508S20e00530x509S26506545x508S10612564x508
        adjective
        1. unpleasant or repulsive, especially in appearance: people in school always told me I was ugly.
        2. involving or likely to involve violence or other unpleasantness: the mood in the room turned ugly.
          • unpleasantly suggestive; causing disquiet: ugly rumors persisted that there had been a cover-up.
          • morally repugnant: racism and its most ugly manifestations, racial attacks and harassment.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8f4\udec1\u00d8\ud8d9\udd41\ud8e1\udde7\ud8c0\ude53.mov"} D"D433CM!Afrost2024/05/04 00:43:192026/06/05 17:29:37AS15a00S30004S10006S20e00S22a04M521x547S2ff0 %333Ck!Afrost2024/05/04 00:41:242026/10/03 19:03:06AS15a00S30004S10006S20e00S22f04M532x546S2ff0 k2 33) !Afrost2024/05/04 00:30:542026/05/09 22:35:03AS1c510S30007S10006S20500S28108M546x518S2ff00482x483S1c510516x478S28108516x451Adam Frost{"video":"dominance: right;\\n\ud8d2\uddf1\ud8f0\udc08\u00d8\ud8d8\udde1\ud8e4\udc69.mov"}k1 33) !Afrost2024/05/04 00:27:552026/05/09 22:34:54AS10011S30007S10006S20500S2c300M544x521S2ff00482x483S10011516x491S2c300518x474Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f0\udc08\u00d8\ud8d8\udde1\ud8ea\udd21.mov"}83S10e22494x475S20b00483x469M518x518S2ff00482x483S1f700492x478S20b00493x463 S38a00464x490 M537x556S2ff00482x483S10011516x491S22a03513x521S10e51491x531S10e59472x527 M537x521S2ff00482x483S10011516x491
        adjective
        1. having or showing a lack of intelligence or common sense; dumb: that is such a stupid question | faking the documents was a stupid thing to do | how could you be so stupid?.
          • informal used to express exasperation or boredom: she told him to stop messing with his stupid painting.
        SIGN VARIATIONS
        stupid beginning with think
        Adam Frost{"video":"dominance: right;\\n\ud8c1\udd63\ud8f0\udc01\u00d8\ud8d9\udc21.mov"} ~5 33C !Afrost2024/05/04 00:45:552026/08/28 19:35:59AS18211S30005S10006S21100S2c300M538x518S2ff00482x483S18211511x501S21100520x485S2c300512x460
        adjective
        1. being reserved or having or showing nervousness or lack of confidence in the company of other people: I was pretty shy at school | a shy smile.
          • (shy about) [predicative] slow or reluctant to do (something): she has never been shy about discussing her efforts to raise aesthetic standards.
          • [in combination] having a dislike of or aversion to a specified thing: camera-shy.
        Adam Frost{"video":"dominance: right;\\n\ud8cc\udcd2\ud8f0\udc06\u00d8\ud8d9\ude61\ud8ea\udd21.mov"} 6 33C %!Afrost2024/05/04 00:49:092026/08/28 20:10:21AS19a10S33200S10006S20e00S2e00cM518x549S33100482x483S19a10469x498S20e00494x520S2e00c471x521
        adjective
        1. having or showing a lack of common sense or judgment; absurd: another of his silly jokes | she said, "Don't be silly!".
        noun
        1. informal a foolish person (often used as a form of address): come on, silly.
          • ridiculously trivial or frivolous: he would brood about silly things.
        Adam Frost{"video":"dominance: right;\\n\ud8ce\uddd1\ud8f4\udec1\u00d8\ud8d9\udd41\ud8ed\udc0d.mov"} ]733a=!)frost2024/05/05 16:14:032026/09/16 01:56:30AS1f700S30000S10006S20b00M518x518S2ff00482x483S1f700492x478S20b00493x463M524x518S2ff00482x483S10e22494x475S20b00483x469 S38a00464x490 M537x549S2ff00482x483S10011516x491S22a03513x521S1f730495x534S1f758487x523 M537x521S2ff00482x483S10011516x491
        adjective
        1. lacking intelligence or common sense; stupid: a dumb question | people are dumb enough to believe it.
          • informal used to express exasperation or boredom: she told him to stop messing with his dumb painting.
        SIGN VARIATIONS
        dumb beginning with think
        Adam Frost{"video":"dominance: right;\\n\ud8d7\udca1\ud8f0\udc01\u00d8\ud8d9\udc21.mov"}15a11S2fe00S15a19S2fe00S21414S20500M526x535S1f70a474x485S1f702511x485S21100493x477S22a00510x466S22a10475x466S15a19488x512S15a11489x512M526x533S1f70a474x486S1f702511x486S21100493x478S22a00510x467S22a10475x467S20319495x512S20311485x512 S38a00464x490 M527x534S1f70a474x486S1f702511x486S21100493x478S22a00510x467S22a10475x467S1f018498x513S1f010473x519
        noun
        1. an expert swimmer employed to rescue people who get into difficulty in a swimming pool or at the beach; a lifeguard (with fist hands).
        SIGN VARIATIONS
        lifeguard with G-hands
        Adam Frost{"video":"dominance: right;\\n\ud8d7\udca3\ud8fc\uddf8\ud8d7\udcab\ud8fc\uddf2\ud8d9\ude61\ud8db\udfc1\ud8db\udfd1\ud8c8\uddd2\ud8fc\udc61\ud8c8\uddda\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1.mov"}20311S2fe00S20319S2fe00S21414S20500M526x533S1f70a474x486S1f702511x486S21100493x478S22a00510x467S22a10475x467S20319495x512S20311485x512M526x535S1f70a474x485S1f702511x485S21100493x477S22a00510x466S22a10475x466S15a19488x512S15a11489x512 M527x534S1f70a474x486S1f702511x486S21100493x478S22a00510x467S22a10475x467S1f018498x513S1f010473x519
        noun
        1. an expert swimmer employed to rescue people who get into difficulty in a swimming pool or at the beach; a lifeguard (with flat hands).
        SIGN VARIATIONS
        lifeguard with G-hands
        Adam Frost{"video":"dominance: right;\\n\ud8d7\udca3\ud8fc\uddf8\ud8d7\udcab\ud8fc\uddf2\ud8d9\ude61\ud8db\udfc1\ud8db\udfd1\ud8d8\udd32\ud8fc\udc61\ud8d8\udd3a\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1.mov"} ^^0833ac!)frost2024/05/05 16:18:042026/09/16 01:55:58AS10e22S30000S10006S20b00M524x518S2ff00482x4*9 33k!![frost2024/05/05 16:23:182026/09/02 20:08:17AS10011S30007S10006S20500S1f730S2fe00S1f758S2fe00S21404S20500M537x549S2ff00482x483S10011516x491S22a03513x521S1f730495x534S1f758487x523M518x518S2ff00482x483S1f700492x478S20b00493x463
        adjective
        1. dumb.
        Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc12\ud8f0\udc08\u00d8\ud8d8\udde1\ud8d7\udcd1\ud8fc\udc61\ud8d7\udcf9\ud8fc\udc61\ud8d9\udf85\ud8d8\udde1.mov"} 5,: 33k%![frost2024/05/05 16:28:092026/09/02 20:08:28AS10011S30007S10006S20500S10e51S2fe00S10e59S2fe00S21404S20500M537x556S2ff00482x483S10011516x491S22a03513x521S10e51491x531S10e59472x527M524x518S2ff00482x483S10e22494x475S20b00483x469
        adjective
        1. stupid.
        Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc12\ud8f0\udc08\u00d8\ud8d8\udde1\ud8c1\udd92\ud8fc\udc61\ud8c1\udd9a\ud8fc\udc61\ud8d9\udf85\ud8d8\udde1.mov"} ;335#w!efrost2024/05/05 16:29:432026/06/02 21:33:11AS1ce12S2fe00S15a1aS2fe00S38000S22a04M525x519S1ce12476x481S15a1a482x505S22a04512x504S38b00470x493 M521x518S16d10483x482S15a1a479x504S22a04508x503 S38b04470x493noun the time in the evening when the sun disappears or daylight fades: sunset was still a couple of hours away.
        • the colors and light visible in the sky on an occasion of the sun's disappearance in the evening, considered as a view or spectacle: a blue and gold sunset.

        PHONOLOGICAL VARIANTS
        sunset with C-handAdam Frost{"video":"dominance: right;\\n\ud8d3\udd53\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8fc\udc01\ud8db\udfc5.mov"} Hm= 33A !-frost2024/05/05 16:41:072026/05/09 22:38:16AS1c501S38517S1c509S38511S20e00S28809S28811S28809S28811M543x525S1c501507x500S1c509468x500S20e00494x497S28809502x476S28811478x476S28809523x476S28811457x476Adam Frost{"video":"dominance: equal;\\n\ud8d2\udde2\ud8fc\uddf8\ud8d2\uddea\ud8fc\uddf2\ud8d9\udd41\ud8e4\udf0a\ud8e4\udf12\ud8e4\udf0a\ud8e4\udf12.mov"}4< 335km!frost2024/05/05 16:39:132026/06/02 21:32:17AS16d10S2fe00S15a1aS2fe00S38000S22a04M521x518S16d10483x482S15a1a479x504S22a04508x503M525x519S1ce12476x481S15a1a482x505S22a04512x504noun a phonological variant (C-hand) of sunset.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8ca\udcf1\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8fc\udc01\ud8db\udfc5.mov"} BB:> 33A U!}frost2024/05/05 16:58:212026/06/02 21:15:32AS20302S2fe00S2030aS2fe00S21400S20500S22f00M513x524S20302493x493S2030a488x509S22f00488x476noun a device consisting of a circular canopy of cloth on a folding metal frame supported by a central rod, used as protection against rain or sometimes sun.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd23\ud8fc\udc61\ud8d8\udd2b\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8dc\udda1.mov"} eew'@33q7C! frost2024/05/05 17:19:492026/09/16 01:57:21AS1f702S38517S1f70aS38511S21100S22a00S22a10S(? 33A 1!}frost2024/05/05 17:14:182026/06/02 21:20:41AS11504S2fe00S15a59S2fe00S21400S20500S26a20M514x531S15a59488x508S11504493x487S26a20487x470verb [no object] stand or lie on a surfboard and ride on a wave towards the shore: he's learning to surf.
        • [with object] to ride (a wave) towards the shore on a surfboard: he has built a career out of surfing big waves.
        noun
        1. the sport or pastime of riding a wave towards the shore while standing or lying on a surfboard.
        2. a person who rides a wave toward the shore while standing or lying on a surfboard: a beach popular with surfers.
        Adam Frost{"video":"dominance: right;\\n\ud8c1\udfe5\ud8fc\udc61\ud8c8\ude1a\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udfe1.mov"}roup of countries: the English-speaking world.
        • a particular period of history: the ancient world.
        • a group of living things: the animal world.
        • the people, places, and activities to do with a particular thing: they were a legend in the world of British theater.
        • (one's world) a person's life and activities: he felt his whole world had collapsed.
      • human and social interaction: he has almost completely withdrawn from the world | how inexperienced she is in the ways of the world.
        • secular interests and affairs: parents are not viewed as the primary educators of their own children, either in the world or in the Church.
        • [in singular] a stage of human life, either mortal or after death: in this world and the next.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cc\udee2\ud8fc\udc61\ud8cc\udeab\ud8fc\udc61\ud8d9\udf81\ud8ed\uded5\ud8d8\udde1.mov"}'technique     | [in singular] : an established athlete with a very good technique.
  • a skillful or efficient way of doing or achieving something: tape recording is a good technique for evaluating our own communications.
    • adjective
    1. relating to or using technology: the quickening pace of technological change.
    2. relating to a particular subject, art, or craft, or its techniques: technical terms | a test of an artist's technical skill.
      • requiring specialized knowledge to be understood: a technical report | at first sight this might all look very technical.
    3. of, involving, or concerned with applied and industrial sciences: an important technical achievement | a technical college.
      • (of clothing or fabric) designed for use in conditions where function and performance are important, such as adverse weather: make sure yo |x|xC 33C !Afrost2024/05/05 17:38:552026/05/09 22:39:28AS10e00S33200S10006S22a00S11500M531x534S33100482x483S10e00507x504S22a00518x485S11500507x453Adam Frost{"video":"dominance: right;\\n\ud8c1\udd41\ud8f4\udec1\u00d8\ud8db\udfc1\ud8c1\udfe1.mov"}B 33A !}frost2024/05/05 17:36:212026/05/09 22:39:14AS1f540S2fe00S14c5aS2fe00S21414S20700S22a04M516x529S14c5a484x472S1f540501x487S22a04502x514Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8c7\udcdb\ud8fc\udc61\ud8d9\udf95\ud8d8\udea1\ud8db\udfc5.mov"}A33qC! frost2024/05/05 17:26:452026/09/16 01:58:50AS1f702S38517S1f70aS38511S21100S22a00S22a10S __D 33' !-frost2024/05/05 17:41:512026/05/03 22:12:26AS18537S2fe00S1853fS2fe00S38006S21100S21100S22946S22942M543x523S18537507x495S1853f474x496S21100517x487S21100471x487S22946533x478S22942458x477noun
        1. the matter from which a thing is or can be made: goats can eat more or less any plant material | highly flammable materials | materials such as brass.
        2. cloth or fabric, especially pre-made and/or pre-cut: a piece of dark material | dress materials.
          • material produced by weaving or knitting fibers: heavy silk fabric | waterproof fabrics.
          • woven or felted material made from wool, cotton, or a similar fiber: [as modifier] : a cloth bag | shelves covered with bright red cloth.
        Adam Frost{"video":"dominance: equal;\\n\ud8cc\ude18\ud8fc\udc61\ud8cc\ude20\ud8fc\udc61\ud8fc\udc07\ud8d9\ude61\ud8d9\ude61\ud8db\udfa7\ud8db\udfa3.mov"} DD8E 33) %!Afrost2024/05/05 17:47:362026/06/02 21:35:24AS1ea43S2fe00S10006S26a00S1dc40M515x539S1ea43488x511S26a00485x496S1dc40491x462noun a concave plastic disk designed for skimming through the air as an outdoor game or amusement.
        • the game or amusement of skimming a Frisbee: kids were playing Frisbee.
        Adam Frost{"video":"dominance: right;\\n\ud8d6\udc04\ud8fc\udc61\u00d8\ud8e1\udfc1\ud8d4\udec1.mov"} uuF 33ik !Yfrost2024/05/05 17:51:482026/09/11 05:12:28AS18510S30007S10006S2ef00S22a03S14c11M577x518S2ff00482x483S18510536x449S2ef00559x436S22a03534x460S14c11508x464M511x540S20320496x461S11520496x480S11920490x514
        noun
        1. the light or warmth received from the earth's sun: we sat outside in the sun.
          • the natural light of the day: there were two hours of daylight left | [as modifier] : the daylight hours.
          • the direct sunlight unbroken by cloud, especially over a comparatively large area: we walked in the warm sunshine.
        SIGN VARIATIONS
        sun fingerspelled
        Adam Frost{"video":"dominance: right;\\n\ud8cc\uddf1\ud8f0\udc08\u00d8\ud8ee\udda1\ud8db\udfc4\ud8c7\udc92.mov"} eG 33 ]!frost2024/05/05 17:55:182026/06/02 22:06:12AS18510S30007S10006S2ef00S22a03S14c11S15a51S2fe00S2035aS2fe00S21400S21100S2ea06M577x566S2ff00482x483S18510536x449S2ef00559x436S22a03534x460S14c11508x464S2035a487x537S15a51501x543S21100503x526noun a cream or lotion rubbed on to the skin to protect it from the sun: she brings along plenty of sunscreen | [count noun] : use high-factor sunscreens.Adam Frost{"video":"dominance: right;\\n\ud8cc\uddf1\ud8f0\udc08\u00d8\ud8ee\udda1\ud8db\udfc4\ud8c7\udc92\ud8c8\ude12\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8ed\udfc7.mov"} H 33[ I!}frost2024/05/05 18:00:092026/06/02 20:42:56AS1ea1bS2fe00S1ea15S2fe00S37f05S2880eS2881eM530x529S1ea1b509x501S1ea15492x471S2880e486x514S2881e471x485noun a game played on a large open-air course, in which a small hard ball is struck with a club into a series of small holes in the ground, the object being to use the fewest possible strokes to complete the course.Adam Frost{"video":"dominance: right;\\n\ud8d5\udfdc\ud8fc\udc61\ud8d5\udfd6\ud8fc\udc61\ud8fb\udfa6\ud8e4\udf0f\ud8e4\udf1f.mov"}u wear quick-dry technical clothing        .
    4. resulting from mechanical failure: technical difficulties.
    5. according to a strict application or interpretation of the law or rules: the arrest was a technical violation of the treaty.
    adverb
    1. in a way that relates to or involves technology: a technologically advanced society | [sentence adverb] : the cars are among the best in the world technologically speaking.
    2. [usually sentence adverb] according to the facts or exact meaning of something; strictly: technically, a nut is a single-seeded fruit.
    3. with reference to the technique displayed: a technically brilliant boxing contest.
    4. involving or regarding the technology available: technically advanced tools.
    Adam Frost{"video":"dominance: right;\\n\ud8d2\udde2\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf91\ud8d8\ude41.mov"} nMI 33A O!)frost2024/05/05 18:08:272026/06/02 21:13:53AS18741S2fe00S1870aS2fe00S21400S2e734S20500M520x524S1870a489x506S18741481x483S2e734504x477noun
    1. (usually the world) the earth, together with all of its countries, peoples, and natural features: he was doing his bit to save the world.
      • (the world) all of the people, societies, and institutions on the earth: the whole world hates a Monday | [as modifier] : world affairs.
      • [as modifier] denoting one of the most important or influential people or things of its class: a world superstar | they had been brought up to regard France as a world power.
      • another planet like the earth: the possibility of life on other worlds.
      • the material universe or all that exists; everything.
    2. a region or g aJ 33skc!-frost2024/05/05 18:12:192026/06/02 21:13:40AS14c51S2fe00S14c59S2fe00S21406S20500S2880cS28814S20500M537x524S14c51501x477S14c59473x477S2880c525x502S28814464x502M520x524S1870a489x506S18741481x483S2e734504x477noun
      1. a spherical or rounded object: orange trees clipped into giant globes.
      2. (the globe) the earth: collecting goodies from all over the globe.
        • the world.
      adverb throughout the world: she travels worldwide as a consultant.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd2\ud8fc\udc61\ud8c7\udcda\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e4\udf0d\ud8e4\udf15\ud8d8\udde1.mov"}5a40S2fe00S15a48S2fe00S38006S22a04S22a14M523x550S1f548487x466S1f540499x474S26520495x451S15a40510x505S15a48478x505S22a04510x535S22a14477x535M514x524S1f548487x492S1f540499x500S26520495x476
      noun
      1. an adherent or devotee of a particular person, cause, or activity: a freethinker and follower of Voltaire.
        • someone who is tracking a particular person, group, organization, etc. on a social media site or application: she remains an immensely divisive figure, but she has a million followers on Facebook.
      2. a person who follows someone or something.
      Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8d7\udc29\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1\ud8e1\ude01\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"}57x519S1f550506x504S1f558470x504S2a200534x482S2a218444x482
      verb [with object]
      1. to display (a notice) in a public place: a curt notice had been posted on the door | the exam results were posted this morning.
      2. to publish (a piece of writing, image, or other item of content) online, typically on a blog or on social media: she posted a photo of herself with the singer on Twitter | I'll post an article next week revealing the results of the poll | [no object] : she hadn't posted for a while.
      noun
      1. a piece of writing, image, or other item of content published online, typically on a blog or on social media: in a recent post, he cautioned investors to be wary of these predictions.
      Adam Frost{"video":"dominance: equal;\\n\ud8d7\udc31\ud8fc\udc61\ud8d7\udc39\ud8fc\udc61\ud8fc\udc07\ud8e7\udcc1\ud8e7\udcd9.mov"} aaK 335 #!efrost2024/05/05 18:16:042026/09/20 19:23:43AS1c501S2fe00S15a18S2fe00S21410S20600M518x521S15a18482x494S1c501493x480S20600496x506
      noun
      1. the application of scientific knowledge for practical purposes, especially in industry: advances in computer technology | recycling technologies.
        • machinery and equipment developed from the application of scientific knowledge: it will reduce the industry's ability to spend money on new technology.
        • the field concerned with engineering and applied science.
      2. a way of carrying out a particular task, especially the execution or performance of an artistic work or a scientific procedure: new surgical techniques mean a shorter hospital stay | the techniques used by Turner, Rembrandt, and Degas.
        • skill or ability in a particular field: he has excellent  11KL 33A w!}frost2024/05/05 18:18:482026/06/02 21:14:08AS15a12S2fe00S15a16S2fe00S21400S20500S2c400M520x526S15a16488x514S15a12487x501S2c400480x475noun a portable computer that is small and light with a hinged screen that closes over the keyboard when not in use: Malcolm was tapping at the keyboard of the laptop.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd3\ud8fc\udc61\ud8c8\uddd7\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8ea\udd81.mov"} vvM335#y!efrost2024/05/05 18:21:432026/06/01 21:11:09AS18210S2fe00S16d18S2fe00S38006S26b00M519x523S16d18481x499S18210493x508S26b00492x478S38b00470x493 M521x523S16d18479x498S10012491x508S26b00490x477 S38b04470x493noun messages distributed by electronic means from one computer user to one or more recipients via a network: reading email has become the first task of the morning | [as modifier] : email messages.
          • the system of sending messages by electronic means from one computer to another: a contract communicated by email.
          • a message sent by email: I got three emails from my mother today.

          PHONOLOGICAL VARIANTS
          email with index handAdam Frost{"video":"dominance: right;\\n\ud8cc\udcd1\ud8fc\udc61\ud8ca\udcf9\ud8fc\udc61\ud8fc\udc07\ud8e2\udc21.mov"} {O 33g !frost2024/05/05 18:31:592026/06/02 17:49:39AS1c510S2fe00S1c518S2fe00S21406S21100S2c500S2c510M543x527S1c510502x499S1c518471x499S2c500503x473S2c510458x473noun (the internet or the Internet) a global computer network providing a variety of information and communication facilities, consisting of interconnected networks using standardized communication protocols: the guide is also available on the internet | [as modifier] : internet access | an internet connection.Adam Frost{"video":"dominance: right;\\n\ud8d2\uddf1\ud8fc\udc61\ud8d2\uddf9\ud8fc\udc61\ud8d9\udf87\ud8d9\ude61\ud8ea\udde1\ud8ea\uddf1.mov"}lN 33 !Ufrost2024/05/05 18:28:222026/06/02 17:39:10AS1f720S2fe00S10006S2e300M512x523S1f720488x478S2e300489x496noun the symbol @.
          • used in email addresses between the user's name and the domain name: jscott@oup.com.
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8ed\udd21.mov"}researching my novel           | it's a piece of work that's carefully researched, strongly argued, and beautifully written.
      noun
      1. the systematic investigation into and study of materials and sources in order to establish facts and reach new conclusions: we are fighting meningitis by raising money for medical research.
        • (researches) acts or periods of investigation and study: his pathological researches were included in official reports.
        • [as modifier] engaged in or intended for use in investigation and discovery: a research student | a research paper.
      SIGN VARIATIONS
      investigate with 1-hand
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\ude11\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc8.mov"} ??5P 335 o!efrost2024/05/05 18:34:432026/05/19 20:36:04AS10602S2fe00S1060aS2fe00S21406S20600M527x514S10602501x499S1060a474x499S20600489x486noun
      1. a form of energy resulting from the existence of charged particles (such as electrons or protons), either statically as an accumulation of charge or dynamically as a current.
        • the supply of electric current to a house or other building for heating, lighting, or pow R 335 !efrost2024/05/05 19:02:112026/05/09 22:43:40AS15a41S2fe00S15a06S2fe00S21404S20600M524x518S15a06477x482S15a41483x495S20600502x492Adam Frost{"video":"dominance: right;\\n\ud8c8\ude02\ud8fc\udc61\ud8c8\uddc7\ud8fc\udc61\ud8d9\udf85\ud8d8\ude41.mov"}HQ 33 /!efrost2024/05/05 18:50:432026/09/20 18:17:27AS10602S2fe00S1060aS2fe00S21406S20500M527x508S10602501x493S1060a474x493
          verb [with object]
          1. to store electrical energy in (a battery or battery-operated device): the shaver can be charged up and used while traveling.
            • [no object] (of a battery or battery-operated device) to receive and store electrical energy.
          Adam Frost{"video":"dominance: equal;\\n\ud8c0\ude43\ud8fc\udc61\ud8c0\ude4b\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1.mov"} uGT 33[ U!}frost2024/05/05 19:16:042026/09/20 18:12:49AS1f550S2fe00S1f558S2fe00S38006S2a200S2a218M5+_S 33 %!9frost2024/05/05 19:05:332026/09/04 19:26:39AS1f711S33d00S10006S20500S1f010S2fe00S10018S2fe00S21406S20500M518x568S33b00482x483S1f711482x509S10018484x538S1f010487x538
          noun
          1. a secret word or phrase that must be used to gain admission to something: if you don't know the password you can't come in.
          2. a string of characters that must be keyed to gain access to a computer, network, or service or to a phone or similar device: each user has a password in order to log on to the network.
          Adam Frost{"video":"dominance: right;\\n\ud8d7\udcb2\ud8f5\udee1\u00d8\ud8d8\udde1\ud8d6\ude11\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1.mov"}0x504M526x530S15a5a476x518S14c20475x492S2a400501x471
          noun
          1. the recording, reproducing, or broadcasting of moving visual images: it's a great option for anyone looking to start using video to talk over the Net | [as modifier] : video equipment.
          2. a recording of moving visual images made digitally or on videotape: they sat down to watch a video | [as modifier] : a site on which people can post their own video clips.
            • a short film made by a singer or group to accompany a song: a pop video.
            • a videocassette: a blank video | the film will soon be released on video.
          SIGN VARIATIONS
          video with 5-hand
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c1\udd61\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8ed\udea1\ud8d8\udde1.mov"}  4W 33g !frost2024/05/05 20:12:392026/05/09 22:44:51AS1f550S2fe00S1f558S2fe00S21406S20500S28805S2881dM525x520S1f550501x481S1f558475x481S28805503x500S2881d477x500Adam Frost{"video":"dominance: equal;\\n\ud8d7\udc31\ud8fc\udc61\ud8d7\udc39\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e4\udf06\ud8e4\udf1e.mov"}kV 33) !Afrost2024/05/05 20:05:302026/05/09 22:44:17AS1ea40S2fe00S10006S22a07S1f540M527x527S1ea40473x506S22a07496x499S1f540512x473Adam Frost{"video":"dominance: right;\\n\ud8d6\udc01\ud8fc\udc61\u00d8\ud8db\udfc8\ud8d7\udc21.mov"}U 335 !efrost2024/05/05 19:37:402026/05/09 22:44:10AS10e02S2fe00S20308S2fe00S21410S20600M520x515S10e02488x500S20308481x491S20600498x486Adam Frost{"video":"dominance: right;\\n\ud8c1\udd43\ud8fc\udc61\ud8d8\udd29\ud8fc\udc61\ud8d9\udf91\ud8d8\ude41.mov"} }pNZ 33 !frost2024/05/05 20:33:252026/05/09 22:49:12AS10e17S2fe00S10e19S38006S22f03S22f13S11019S11017M553x534S10e17523x475S10e19483x466S22f03511x491S22f13469x487S11019448x504S11017490x506Adam Frost{"video":"dominance: right;\\n\ud8c1\udd58\ud8fc\udc61\ud8c1\udd5a\ud8fc\udc07\ud8dc\udda4\ud8dc\uddb4\ud8c1\ude1a\ud8c1\ude18.mov"} Y 33) !}frost2024/05/05 20:32:232026/05/09 22:42:50AS10120S2fe00S10006S22a03S1dc20M528x529S10120512x471S22a03500x499S1dc20472x499Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c0\udc81\ud8fc\udc61\u00d8\ud8db\udfc4\ud8d4\udea1.mov"}X 33M !Efrost2024/05/05 20:28:422026/05/09 22:48:47AS10e40S2fe00S10e48S2fe00S38006S2d524S11040S11048S10e40S10e48M557x536S10e40470x465S10e48444x465S2d524490x496S11040506x509S11048479x509S10e40542x465S10e48515x465Adam Frost{"video":"dominance: equal;\\n\ud8c1\udd81\ud8fc\udc61\ud8c1\udd89\ud8fc\udc61\ud8fc\udc07\ud8ec\udc05\ud8c1\ude41\ud8c1\ude49\ud8c1\udd81\ud8c1\udd89.mov"} PP`] 33' !-frost2024/05/05 20:56:402026/05/09 22:50:30AS11019S2fe00S11017S2fe00S38006S22f07S22f17S10e17S10e19M553x534S11019448x504S11017490x506S22f07509x493S22f17468x490S10e17523x475S10e19483x466Adam Frost{"video":"dominance: right;\\n\ud8c1\ude1a\ud8fc\udc61\ud8c1\ude18\ud8fc\udc61\ud8fc\udc07\ud8dc\udda8\ud8dc\uddb8\ud8c1\udd58\ud8c1\udd5a.mov"}"\ 33[ !}frost2024/05/05 20:53:202026/05/09 22:50:18AS14440S2fe00S14448S2fe00S37f07S23007S23017M539x528S14440504x486S14448461x497S23007513x472S23017475x482Adam Frost{"video":"dominance: right;\\n\ud8c6\uddc1\ud8fc\udc61\ud8c6\uddc9\ud8fc\udc61\ud8fb\udfa8\ud8dc\ude08\ud8dc\ude18.mov"}"[ 33[ !}frost2024/05/05 20:37:222026/05/09 22:50:07AS14440S2fe00S14448S2fe00S37f07S23003S23013M539x531S14440517x470S14448474x481S23003500x493S23013461x506Adam Frost{"video":"dominance: right;\\n\ud8c6\uddc1\ud8fc\udc61\ud8c6\uddc9\ud8fc\udc61\ud8fb\udfa8\ud8dc\ude04\ud8dc\ude14.mov"} 0TK_ 33' a!-frost2024/05/05 21:12:312026/10/04 17:52:17AS1f540S2fe00S1f548S2fe00S38006S26500S26510S1f740S1f748M525x531S1f540505x507S1f548481x507S26500505x488S26510482x488S1f740505x469S1f748476x469
          verb [center to front loci]
          1. to send a text message to: [with left front to center loci] : I thought it was fantastic that he took the trouble to text me.
          Adam Frost{"video":"dominance: equal;\\n\ud8d7\udc21\ud8fc\udc61\ud8d7\udc29\ud8fc\udc61\ud8fc\udc07\ud8e1\udde1\ud8e1\uddf1\ud8d7\udce1\ud8d7\udce9.mov"}L^ 33 !)frost2024/05/05 21:08:092026/05/09 22:50:45AS11040S2fe00S10006S28806M519x519S11040481x481S28806497x507Adam Frost{"video":"dominance: right;\\n\ud8c1\ude41\ud8fc\udc61\u00d8\ud8e4\udf07.mov"};9x474S26520495x451S15a40510x505S15a48478x505S22a04510x535S22a14477x535
          verb [with object]
          1. to go or come after (a person or thing proceeding ahead); move or travel behind: she went back into the house, and Ben followed her | [no object] : he was following behind in his car.
            • to go after (someone) in order to observe or monitor: the KGB man followed her everywhere.
            • to go along (a route or path): follow the yellow line to the waiting room.
            • to keep track of or trace the movement or direction of: his eyes followed the ball across the room.
          2. to act according to (an instruction or precept): he has difficulty in following written instructions.
            • to conform to: the film faithfully follows Shakespeare's plot.
            • to act according to the lead or example of (someone): he follows Aristotle in believing this.
            • to treat as a teacher or guide: those ## a 33Akm!)frost2024/05/05 21:18:172026/09/04 20:52:08AS10e20S2fe00S15a18S2fe00S21406S2e700S20500M515x529S15a18486x491S10e20498x472S2e700504:`33[!)frost2024/05/05 21:15:322026/09/04 20:30:04AS11a50S2fe00S15a39S2fe00S21400S20e00S26a07M524x525S15a39476x481S11a50481x495S20e00496x492S26a07503x476M525x523S15a39475x482S10050486x493S20e00496x492S26a07504x477
              verb [with object]
              1. to investigate systematically: she has spent the last five years researching her people's history | [no object] : the team has been researching into flora and fauna.
                • to discover facts by investigation for use in (a book, program, etc.): I was in New York 0 who seek to follow Jesus Christ.
                • to undertake or carry out (a course of action or study): she followed a strict diet.
              2. to pay close attention to (something): I've been following this discussion closely.
                • to maintain awareness of the current state or progress of (events in a particular sphere or account): young Italians follow football.
                • to track (a person, group, or organization) by subscribing to their account on a social media site or application: if you've been following me on Facebook recently you may have seen a bunch of different posts about surgery and back trouble | I don't follow many celebrities on Twitter anymore.
              DERIVATIVES
              follower noun
              Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8d7\udc29\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1\ud8e1\ude01.mov"} vb 33g c!Afrost2024/05/05 21:18:562026/09/04 21:02:46AS10e20S2fe00S15a18S2fe00S21406S2e700S1fb20S20500M515x540S15a18486x502S10e20498x460S2e700500x515S1fb20498x494
              noun
              1. magnetic tape for recording and reproducing visual images and sound: film can be copied onto videotape | [as modifier] : videotape machines.
                • a videocassette: videotapes played in separate screening room.
                • a film or other piece of material recorded on videotape.
              verb [with object]
              1. to make a video recording of (an event or broadcast): his arrest was videotaped.
              Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c1\udd61\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8ed\udea1\ud8d7\ude41\ud8d8\udde1.mov"} )):d 33 +!efrost2024/05/05 21:44:402026/10/10 20:37:34AS20320S2fe00S10006S18d20M510x522S20320495x478S18d20490x497
              noun
              1. [treated as singular or plural] websites and applications that enable users to create and share content or to participate in social networking.
              2. sadomasochism (as a sexual practice).
              ORIGIN
              based on the spelling of S-M.
              Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8cd\udd01.mov"}c 33A !}frost2024/05/05 21:41:512026/05/09 22:52:00AS15720S2fe00S10018S2fe00S21400S20500S23704M531x529S10018479x499S15720469x471S23704492x480Adam Frost{"video":"dominance: right;\\n\ud8c8\udcc1\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8dd\udca5.mov"}
              1. in a way that relates to the design and arrangement of steps and movements in dance or figure skating: the two performances were choreographically very different.
          noun
          1. the sequence of steps and movements in dance or figure skating, especially in a ballet or other staged dance: the lively choreography reflects the themes of the original play.
            • the art or practice of designing choreographic sequences: as well as dancing she did a great deal of choreography.
            • the written notation for a choreographic sequence.
          ORIGIN
          based on dance with a C handshape.
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udd01\ud8fc\udc61\ud8c8\uddfb\ud8fc\udc61\ud8fb\udfa1\ud8e4\udf07\ud8e4\udf0f\ud8e4\udf07.mov"}l>
        • an American multinational technology corporation focused on information technology, online advertising, search engine technology, email, cloud computing, software, quantum computing, e-commerce, consumer electronics, and artificial intelligence.
      verb [with object]
      1. to search for information about (someone or something) on the internet, especially using the search engine Google: he googled the name of the airline | she googled the resort and found dozens of reviews | I googled him as I was not familiar with his work | [no object] : I've tried googling for information.
      ORIGIN
      based on search with a G handshape.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d6\ude11\ud8ef\udfa1\u00d8\ud8ed\udde1.mov"} Fwf 33}k !%frost2024/05/05 21:52:392026/09/11 17:28:46AS1f540S2fe00S1f548S2fe00S21414S20500S26520S1**e33ASm!}frost2024/05/05 21:47:012026/09/11 17:29:32AS1f540S2fe00S1f548S2fe00S21414S20500S26520M514x524S1f548487x492S1f540499x500S26520495x476M523x550S1f548487x466S1f540499535x536S37600488x513S1ce01466x493S1ce09508x493S28136484x483S2814e484x465M532x519S2035a469x504S1c551474x482S20e00502x495S26a06518x488
      adjective
      1. given or available without charge: free healthcare | a complimentary bottle of wine.
      2. not subject to or constrained by engagements or obligations; available: she spent her free time shopping.
        • (of a facility or piece of equipment) not occupied or in use: the bathroom was free.
      adverb
      1. without cost or payment: ladies were admitted free.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d3\udd42\ud8fc\ude73\ud8d3\udd4a\ud8fc\ude75\ud8d8\udde1\ud8e4\udc97\ud8e4\udcaf.mov"} aLg 33 O!efrost2024/05/05 21:54:272026/10/10 20:38:30AS1ce20S2fe00S10006S14720M511x528S1ce20489x472S14720491x506
      noun
      1. American football an offensive player in the backfield.
      2. (in a game such as soccer or field hockey) a player in a defensive position at the side of the field.
      proper noun
      1. an American social networking service owned by the American technology conglomerate Meta Platforms.
      ORIGIN
      based on the spelling of F-B.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8d3\udd61\ud8fc\udc61\u00d8\ud8c6\udec1.mov"} qch 33 }!efrost2024/05/05 21:56:092026/10/10 20:38:43AS19220S2fe00S10006S1f000M518x519S19220497x481S1f000483x504
      proper noun
      1. an American photo and short-form video sharing social networking service owned by Meta Platforms.
      ORIGIN
      based on the spelling of I-G.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8cd\udee1\ud8fc\udc61\u00d8\ud8d6\ude01.mov"} )i 33k!cfrost2024/05/05 21:57:152026/10/10 20:38:52AS19a20S2fe00S10006S1fb20M514x522S19a20486x479S1fb20493x503M520x524S15a18480x477S19a20492x476S2e700501x499
      proper noun
      1. an American online video-sharing platform owned by Google.
      SIGN VARIATIONS
      YouTube with Y-hand in circular movement
      ORIGIN
      based on the spelling of Y-T.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: integrated;\\n\ud8ce\udde1\ud8fc\udc61\u00d8\ud8d7\ude41.mov"} >/k 33 !Ufrost2024/05/05 22:00:032026/10/10 20:39:09AS1f010S2ff00S10006S2e500M539x535S2ff00482x483S1f010507x491S2e500516x508
      proper noun j 33AQK!Kfrost2024/05/05 21:58:002026/09/11 18:31:46AS19a20S2fe00S15a18S2fe00S21406S2e700S20500M520x524S15a18480x477S19a20492x476S2e700501x499M514x522S19a20486x479S1fb20493x503
      proper noun
      1. YouTube.
      ORIGIN
      based on video with a Y handshape.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\nvisible: sign;\\n\ud8ce\udde1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8ed\udea1\ud8d8\udde1.mov"} hall | [as modifier] : a theater workshop was held for students | a theater performance.
    3. an exciting, emotional, or unexpected series of events or set of circumstances: a hostage drama | an afternoon of high drama at Fenway Park.
      4. verb [with object] to represent (a character) in a theatrical performance or a film: she played Ophelia.
      • [no object] to perform in a theatrical production or on film: he was proud to be playing opposite a famous actor.
      • to put on or take part in (a theatrical performance or concert): the show was one of the best we ever played.
      • to give a dramatic performance at (a particular theater or place).
      • to behave as though one were (a specified type of person): the skipper played the innocent, but smuggled goods were found on his vessel.
      Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\uddf8\ud8d7\udc29\ud8fc\uddf2\ud8d9\udd41\ud8ed\udfc5\ud8ee\udc09.mov"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx           ! "! =4m 33g !frost2024/05/05 22:05:332026/05/09 22:56:01AS1f540S2fe00S1f548S2fe00S21406S20e00S27200S27214M529x535S1f540501x488S1f548484x488S27200489x465S27214471x516Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8d7\udc29\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8e2\udec1\ud8e2\uded5.mov"}gl 335 S!efrost2024/05/05 22:03:242026/09/11 21:28:02AS1a003S2fe00S2035aS2fe00S21400S20600M526x521S2035a499x506S1a003496x480S20600474x503
      proper noun
      1. an open-source operating system used for smartphones and tablet computers: [as modifier] : I have an Android phone and I like it a lot.
      Adam Frost{"video":"dominance: right;\\n\ud8cf\udc04\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} ovo o 335 !efrost2024/05/05 22:11:182026/05/09 22:56:35AS15410S2fe00S15418S2fe00S21406S20600M516x520S15410501x495S15418484x495S20600489x480Adam Frost{"video":"dominance: equal;\\n\ud8c7\udf91\ud8fc\udc61\ud8c7\udf99\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"}n 33 Y!7frost2024/05/05 22:09:402026/09/22 21:52:12AS20320S2fe00S10006S14051S17620S11a20S1fb20S20320M516x570S20320498x431S14051485x450S17620498x478S11a20498x498S1fb20498x532S20320498x555
      noun
      1. activities involving physical exertion and skill in which an individual or team competes against another or others for entertainment: team sports such as baseball and soccer | [as modifier] : a sports center.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8c6\udc52\ud8cb\udc61\ud8c2\udde1\ud8d7\ude41\ud8d8\udd41.mov"} yp 33[ 9!}frost2024/05/05 22:12:472026/06/01 18:26:25AS1bb20S2fe00S1bb28S2fe00S38006S21d00S21d00M531x520S1bb20510x492S1bb28469x492S21d00509x481S21d00472x481noun a game for two teams, usually of six players, in which a large ball is hit by hand over a high net, the aim being to score points by making the ball reach the ground on the opponent's side of the court.Adam Frost{"video":"dominance: equal;\\n\ud8d1\ude41\ud8fc\udc61\ud8d1\ude49\ud8fc\udc61\ud8fc\udc07\ud8da\udee1\ud8da\udee1.mov"} wwq 33[ S!{frost2024/05/05 22:14:042026/06/01 18:38:17AS14c11S2fe00S14c19S2fe00S21406S20700S27220M525x535S14c11499x505S14c19476x508S20700492x488S27220481x466noun the sport or activity of grappling with an opponent and trying to throw or hold them down on the ground, typically according to a code of rules.
      verb to take part in a sport that involves grappling with one's opponent and trying to throw or force them to the ground: he wrestled with the state champion before being pinned.Adam Frost{"video":"dominance: left;\\n\ud8c7\udc92\ud8fc\udc61\ud8c7\udc9a\ud8fc\udc61\ud8d9\udf87\ud8d8\udea1\ud8e2\udee1.mov"} {{r 33 !frost2024/05/05 22:16:572026/06/01 18:47:25AS1ce10S2fe00S1ce4fS2fe00S21406S20a10S2c500S2c514M563x532S1ce10504x482S1ce4f478x490S20a10487x517S2c500523x468S2c514437x501noun a modern sports festival held traditionally every four years in different venues: I've always wanted to go to the Olympics | she's aiming for her first medal in her third Olympics.
      adjective [attributive] relating to the Olympic Games: an Olympic champion | Olympic events.Adam Frost{"video":"dominance: right;\\n\ud8d3\udd51\ud8fc\udc61\ud8d3\udd90\ud8fc\udc61\ud8d9\udf87\ud8d8\udfd1\ud8ea\udde1\ud8ea\uddf5.mov"} ([(8/t 33u !}frost2024/05/05 22:31:412026/05/10 00:15:00AS20301S38632S20309S38634S20500S28136S2814eM526x536S37600488x513S20301475x498S20309505x498S28136484x483S2814e484x465Adam Frost{"video":"dominance: right;\\n\ud8d8\udd22\ud8fc\ude73\ud8d8\udd2a\ud8fc\ude75\ud8d8\udde1\ud8e4\udc97\ud8e4\udcaf.mov"}!s 33 K!frost2024/05/05 22:19:052026/09/11 23:21:06AS20341S2fe00S20349S2fe00S38006S26a00S26a10S2fd04M530x531S20341505x487S20349474x504S26a00503x469S26a10470x488S2fd04492x525
      noun
      1. the sport or practice of fighting with the fists, especially with padded gloves in a roped square ring according to prescribed rules: I grew up watching boxing with my dad and grandfather | [as modifier] : she is confident that she could beat him in a boxing match.
      Adam Frost{"video":"dominance: right;\\n\ud8d8\udd62\ud8fc\udc61\ud8d8\udd6a\ud8fc\udc61\ud8fc\udc07\ud8e1\udfc1\ud8e1\udfd1\ud8ef\udee5.mov"}al architecture of the human brain.
      • the conceptual structure and logical organization of a computer or computer-based system: a client/server architecture.
    4. a table or flat-topped block used as the focus for a religious ritual, especially for making sacrifices or offerings to a deity: the altar is a crisply hewn block of granite.
      • the table in a Christian church at which the bread and wine are consecrated in communion services: the huge jeweled tabernacle above the altar was executed by Jacopo da Trezzo.
      • the altar in a Christian church as the place at which marriages are celebrated: his fiancée leaves him at the altar | several guessed that the two would end up at the altar | the happy couple had a long road to the altar.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d7\udcc1\ud8fc\udc61\ud8d7\udcc9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8dd\ude25\ud8dd\ude3d.mov"} Bv 33g !)frost2024/05/19 19:46:522026/06/01 18:48:29AS18710S30004S10006S20500S15420S2fe00S10006S26a00M518x596S2ff00482x483S18710491x514S15420494x571S26a00487x554noun a seven-a-side game played by swimmers in a pool, with a ball like a volleyball that is thrown into the opponent's net.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cc\udeb1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8c7\udfa1\ud8fc\udc61\u00d8\ud8e1\udfc1.mov"}_u33uE!)frost2024/05/05 22:32:332026/10/04 23:30:49AS1ce01S38632S1ce09S38634S20500S28136S2814eMA vw 33uk;!}frost2024/05/19 21:01:532026/05/26 03:45:31AS15a01S30004S15a09S2fe00S20500S26a00S26a10M541x571S2ff00482x483S15a01496x512S15a09477x548S26a00514x508S26a10477x531M531x535S2ff00482x483S15a01494x512S26500517x508adjective pleased and relieved: [with clause] : they were thankful that the war was finally over | [with infinitive] : I was very thankful to be alive.
    • expressing gratitude and relief: an earnest and thankful prayer.
    exclamation [frequentative, intensive, to front locus] used to express thanks.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc2\ud8f0\udc05\ud8c8\uddca\ud8fc\udc61\ud8d8\udde1\ud8e1\udfc1\ud8e1\udfd1.mov"} O7y 335ks!frost2024/05/23 22:18:342026/06/01 21:12:07AS10012S2fe00S16d18S2fe00S38006S26b00M521x523S16d18479x498S10012491x508S26b00490x477M519x523S16d18481x499S18210493x508S26b00492x478noun a phonological variant (index hand) of email.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc13\ud8fc\udc61\ud8ca\udcf9\ud8fc\udc61\ud8fc\udc07\ud8e2\udc21.mov"}-x 335 a!cfrost2024/05/23 21:43:492026/06/01 18:24:58AS14c11S2fe00S14c19S2fe00S21406S20710M525x524S14c11499x494S14c19476x497S20710484x477noun a form of team game with an oval ball on a field marked out as a gridiron: he started playing football when he was 5 | [as modifier] : a football game.Adam Frost{"video":"dominance: left;\\n\ud8c7\udc92\ud8fc\udc61\ud8c7\udc9a\ud8fc\udc61\ud8d9\udf87\ud8d8\udeb1.mov"} [U[v{ 33 !efrost2024/05/24 01:38:192026/05/10 01:19:11AS10e02S2fe00S20308S2fe00S21410S20500M519x512S10e02489x497S20308482x488Adam Frost{"video":"dominance: right;\\n\ud8c1\udd43\ud8fc\udc61\ud8d8\udd29\ud8fc\udc61\ud8d9\udf91\ud8d8\udde1.mov"}'z 335Qm!frost2024/05/24 00:09:072026/06/03 17:53:35AS18510S2fe00S18518S2fe00S21406S20600M526x515S18510501x500S18518474x500S20600489x486M526x508S18510501x493S18518474x493determiner, pronoun [in isolation] more.Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8cc\uddf1\ud8fc\udc61\ud8cc\uddf9\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"} ee|33qq![frost2024/05/24 02:24:372026/09/16 01:58:07AS1f702S38517S1f70aS38511S21100S22a00S22a10S1f010S2fe00S1f018S2fe00S21414S20500M527x534S1f70a474x486S1f702511x486S21100493x478S22a00510x467S22a10475x467S1f018498x513S1f010473x519M526x535S1f70a474x485S1f702511x485S21100493x477S22a00510x466S22a10475x466S15a19488x512S15a11489x512 M526x533S1f70a474x486S1f702511x486S21100493x478S22a00510x467S22a10475x467S20319495x512S20311485x512
    noun
    1. a lifeguard (with flat hands) or lifeguard (with fist hands).
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\nvisible: sign;\\n\ud8d7\udca3\ud8fc\uddf8\ud8d7\udcab\ud8fc\uddf2\ud8d9\ude61\ud8db\udfc1\ud8db\udfd1\ud8d6\ude11\ud8fc\udc61\ud8d6\ude19\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1.mov"} DD_~ 33) s!Afrost2024/05/24 18:30:012026/06/01 18:03:45AS1c511S38507S10006S20500S2c500M550x528S36d00479x524S1c511521x499S2c500510x472noun a person employed to display fashionable clothes by wearing them: they both dressed like models.Adam Frost{"video":"dominance: right;\\n\ud8d2\uddf2\ud8fc\udde8\u00d8\ud8d8\udde1\ud8ea\udde1.mov"}U} 335 /!efrost2024/05/24 02:32:072026/06/01 18:02:20AS10e20S2fe00S1001aS2fe00S37f07S2f000M521x530S10e20505x470S1001a479x505S2f000500x510noun exercises developing or displaying physical agility and coordination.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd61\ud8fc\udc61\ud8c0\udc1b\ud8fc\udc61\ud8fb\udfa8\ud8ee\ude01.mov"} ggV 33 !)frost2024/05/29 15:18:322026/03/29 19:45:01AS10020S2fe00S10006S2df00M517x526S10020502x496S2df00483x475noun a monetary amount equivalent to one unit of the currency of the United States: I only have one dollar and fifty cents.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ec\udfa1.mov"}8 33C !Afrost2024/05/24 18:34:162026/03/22 18:40:08AS10610S38404S10006S20e00S26a00M536x545S2ff00482x483S10610489x519S20e00516x532S26a00509x515noun a solid material that is typically hard, shiny, malleable, fusible, and ductile, with good electrical and thermal conductivity: being a metal, aluminum readily conducts heat | vessels made of ceramics or metal.
    • heavy metal or similar rock music: crunching power-trio metal.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\ude51\ud8fc\udd85\u00d8\ud8d9\udd41\ud8e1\udfc1.mov"} 99^ 33 /!)frost2024/05/29 15:22:222026/03/29 19:45:40AS11e20S2fe00S10006S2df00M517x526S11e20494x496S2df00483x475noun a monetary amount equivalent to three units of the currency of the United States: I paid three dollars and seventy-five cents.Adam Frost{"video":"dominance: right;\\n\ud8c2\udf61\ud8fc\udc61\u00d8\ud8ec\udfa1.mov"}a 33 5!)frost2024/05/29 15:20:192026/03/29 19:45:22AS10e20S2fe00S10006S2df00M517x526S10e20502x496S2df00483x475noun a monetary amount equivalent to two units of the currency of the United States: it came out to two dollars and twenty-five cents.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd61\ud8fc\udc61\u00d8\ud8ec\udfa1.mov"} ??\ 33 +!)frost2024/05/29 15:27:262026/03/29 19:46:14AS14c20S2fe00S10006S2df00M519x525S14c20496x494S2df00482x475noun a monetary amount equivalent to five units of the currency of the United States: I spent five dollars and sixty cents on it.Adam Frost{"video":"dominance: right;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8ec\udfa1.mov"}] 33 -!)frost2024/05/29 15:25:192026/03/29 19:45:58AS14420S2fe00S10006S2df00M520x525S14420498x494S2df00481x475noun a monetary amount equivalent to four units of the currency of the United States: I paid three dollars and seventy-five cents.Adam Frost{"video":"dominance: right;\\n\ud8c6\udda1\ud8fc\udc61\u00d8\ud8ec\udfa1.mov"} ;;_ 33 1!)frost2024/05/29 15:32:352026/03/29 19:46:45AS1a520S2fe00S10006S2df00M520x525S1a520499x497S2df00481x476noun a monetary amount equivalent to seven units of the currency of the United States: the total was seven dollars and eighty cents.Adam Frost{"video":"dominance: right;\\n\ud8cf\ude01\ud8fc\udc61\u00d8\ud8ec\udfa1.mov"}^ 33 /!)frost2024/05/29 15:29:142026/03/29 19:46:32AS18720S2fe00S10006S2df00M517x524S18720499x495S2df00483x476noun a monetary amount equivalent to six units of the currency of the United States: it was six dollars and thirty cents after tax.Adam Frost{"video":"dominance: right;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8ec\udfa1.mov"} ( 33u }!} frost2024/05/29 15:35:542026/05/19 20:37:04AS1f540S38517S1f548S38511S20e00S2ea04S2ea48M526x526S1f540509x474S1f548475x474S2ea04511x501S2ea48478x501S20e00495x506noun a dramatic work for the stage or to be broadcast: the actors put on a new play.
    • a building or outdoor area in which plays are performed and other dramatic performances are given: the building opened as a theater and lectureF_ 33 1!)frost2024/05/29 15:34:272026/03/29 19:46:59AS1bb20S2fe00S10006S2df00M520x525S1bb20499x497S2df00481x476noun a monetary amount equivalent to eight units of the currency of the United States: I owe you eight dollars and forty-five cents.Adam Frost{"video":"dominance: right;\\n\ud8d1\ude41\ud8fc\udc61\u00d8\ud8ec\udfa1.mov"}
    adjective
    1. having or denoting the lowest adult male singing voice: his bass voice rings out attractively.
    2. denoting or relating to the member of a family of instruments that is the lowest in pitch: a bass clarinet | a bass drum.
    3. denoting or relating to the low-frequency output of an audio system, corresponding to the bass in music: if the speaker is small it will be limited in its ability to reproduce sound in the bass range.
    ORIGIN
    based on the spelling of B-A-S-S.
    Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udec1\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8d8\udd41\ud8d8\udd41.mov"} _ 33i !e frost2024/05/29 16:02:332026/06/01 18:08:31AS10020S30007S10028S30001S27200S27214M541x518S2ff00482x483S10020511x462S10028474x462S27200501x439S27214459x439noun a hypothetical or fictional being from another world.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8f0\udc08\ud8c0\udc29\ud8f0\udc02\ud8e2\udec1\ud8e2\uded5.mov"} hh 33 1! frost2024/05/29 16:06:322026/06/01 18:13:10AS18211S38507S18219S38501S20500S20500S2df08S2df10M565x517S36d00479x513S18211521x496S18219454x496S2df08544x484S2df10435x484noun
    1. a spiritual being believed to act as an attendant, agent, or messenger of God, conventionally represented in human form with wings and a long robe: God sent an angel to talk to Gideon | the Angel of Death.
      • an attendant spirit, especially a benevolent one; a guardian angel: there was an angel watching over me.
      • in traditional Christian angelology, a being of the lowest order of the celestial hierarchy.
    2. a person of exemplary conduct or virtue: I know I'm no angel | their parents think they are angels.
    Adam Frost{"video":"dominance: equal;\\n\ud8cc\udcd2\ud8fc\udde8\ud8cc\udcda\ud8fc\udde2\ud8d8\udde1\ud8d8\udde1\ud8ec\udfa9\ud8ec\udfb1.mov"}biology or living organisms.
    • (of a detergent or other cleaning product) containing enzymes to assist the process of cleaning.
    • relating to or involving the use of microorganisms or toxins of biological origin as weapons of war.
  • (of a member of a person's family) genetically related; related by blood: the rights of the biological father.
    • adverb
    1. in a way that concerns biology or living organisms: the world's most biologically diverse ecosystems.
    2. in an inherited or innate way: biologically rooted instincts.
    ORIGIN
    based on science with a B handshape.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udec2\ud8fc\udc61\ud8c6\udeca\ud8fc\udc61\ud8fc\udc07\ud8ed\udfc5\ud8ee\udc09.mov"} 7" 33[ !} frost2024/05/29 16:14:272026/05/10 01:25:34AS19201S2fe00S15a18S2fe00S21406S20e00S22f04M520x523S15a18481x477S19201494x478S20e00495x495S22f04489x509Adam Frost{"video":"dominance: right;\\n\ud8cd\udec2\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8dc\udda5.mov"}4 33g _!A frost2024/05/29 16:10:112026/10/04 18:28:48AS1f720S2fe00S1f728S2fe00S21406S20500S23b04S23b1cM543x513S1f720501x487S1f728480x487S23b04524x492S23b1c458x492
    noun
    1. the art or practice of designing and constructing buildings: schools of architecture and design.
      • the style in which a building is designed and constructed, especially with regard to a specific period, place, or culture: Victorian architecture.
    2. the complex or carefully designed structure of something: the chemicN ##Y 33[ y!}frost2024/05/29 16:31:382026/06/01 18:17:44AS20330S2fe00S20358S2fe00S21406S20500S26a20M556x518S36d00479x505S20330541x500S20358525x503S26a20526x482noun a ball game played between two teams of nine on a field with a diamond-shaped circuit of four bases: they are playing baseball | [as modifier] : a baseball player.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd51\ud8fc\udc61\ud8d8\udd79\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\udfe1.mov"} SS) 33[ !}frost2024/05/29 16:37:102026/05/03 22:14:30AS14e10S2fe00S14e18S2fe00S38006S23000S23010M537x527S14e10511x474S14e18463x474S23000512x509S23010463x508noun a game played between two teams of five players in which goals are scored by throwing a ball through a netted hoop fixed above each end of the court: I played basketball at college | [as modifier] : the team had not won a basketball game in over a month.
      • the inflated ball used in the game of basketball: I taught him how to shoot a basketball.
      Adam Frost{"video":"dominance: equal;\\n\ud8c7\udd51\ud8fc\udc61\ud8c7\udd59\ud8fc\udc61\ud8fc\udc07\ud8dc\ude01\ud8dc\ude11.mov"}ve nature of something: gas lamps give the area its character.
    3. the quality of being individual in an interesting or unusual way: the island is full of character.
    4. strength and originality in a person's nature: she had character as well as beauty.
    5. a person's good reputation: to what do I owe this attack on my character?.
    6. a person in a novel, play, or movie: the author's compassionate identification with his characters.
      • a part played by an actor: the actor's TV character is often on the wrong side of the law.
      • [with adjective] a person seen in terms of a particular aspect of character: he was a larger-than-life character | shady characters.
      • informal an interesting or amusing individual: he's a real character.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udcf1\ud8fc\uddf2\u00d8\ud8ee\udda1\ud8d8\udde1.mov"} GG- 33O #!frost2024/05/29 16:39:362026/10/10 20:39:25AS14720S2fe00S10006S1f720S20320S20320M510x540S14720496x461S1f720490x487S20320495x506S20320495x525
    noun
    1. the lowest adult male singing voice.
      • a singer with a bass voice: the society is always welcoming new singers, especially tenors and basses.
      • a part written for a bass voice.
    2. a bass guitar or double bass: he also plays bass in a rock band | Gallagher is joined by Gerry McAvoy on bass.
    3. the low-frequency output of an audio system, corresponding to the bass in music: she is feeling the bass coming from a nearby speaker.
    4. the common European freshwater perch.
    5. any of various fish similar to or related to a perch.
      • a mainly marine fish found in temperate waters.
      • an American freshwater fish of the sunfish family, popular with anglers.
        • Zgsubstances of which matter is composed; the investigation of their properties and the ways in which they interact, combine, and change; and the use of these processes to form new substances.
        • the chemical composition and properties of a substance or body: the chemistry of soil.
      • the complex emotional or psychological interaction between two people: their affair was triggered by intense sexual chemistry.
      • a compound or substance that has been purified or prepared, especially artificially: never mix disinfectant with other chemicals | controversy arose over treatment of apples with this chemical.
    adjective
    1. relating to chemistry, or the interactions of substances as studied in chemistry: the chemical composition of the atmosphere.
      • relating to chemicals: chemical treatments for killing fungi.
      • relating to, involving, or denoting the use of poison gas or other lA 33[ !)frost2024/05/29 16:43:282026/10/10 20:39:50AS14721S2fe00S14729S2fe00S38006S2ea04S2ea48M525x525S14721504x475S14729476x475S2ea04510x500S2ea48480x500
        noun
        1. the study of living organisms, divided into many specialized fields that cover their morphology, physiology, anatomy, behavior, origin, and distribution.
          • the physiology, behavior, and other qualities of a particular organism or class of organisms: human biology.
        adjective
        1. relating to ] 00L 335 !efrost2024/05/29 16:56:302025/03/05 22:58:23AS15a50S2fe00S14c0aS2fe00S21406S20700M527x521S14c0a473x480S15a50495x494S20700509x485noun a pause in work or during an activity or event: I need a break from mental activity | they take long coffee breaks.
          • a short vacation: the Christmas break.
          Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\ud8c7\udc8b\ud8fc\udc61\ud8d9\udf87\ud8d8\udea1.mov"} +t+^= 33) !mfrost2024/05/29 17:14:222026/09/29 01:23:25AS16d10S38511S10006S2ef00S20500M521x515S36d00479x486S16d10474x495S2ef00493x495
          noun
          1. the mental and moral qualities distinctive to an individual: running away was not in keeping with her character.
            • the distinctia 33) E!Afrost2024/05/29 17:03:132026/05/19 20:37:39AS10001S30007S10006S20500S26500M528x520S2ff00482x483S10001507x490S26500513x479noun a monetary unit of the US, Canada, and various other countries, equal to one hundredth of a dollar, euro, or other decimal currency unit: he was paid 40 cents an hour.
              • informal a small sum of money: she saved every cent possible.
              • [with negative] informal used for emphasis to denote any money at all: he hadn't yet earned a cent.
              Adam Frost{"video":"dominance: right;\\n\ud8c0\udc02\ud8f0\udc08\u00d8\ud8d8\udde1\ud8e1\udde1.mov"}chemicals as weapons of war: the manufacture of chemical weapons.
          adverb
          1. in a way that relates to chemistry, or to the interactions of substances as studied in chemistry: many of these compounds are chemically reactive.
            • by use of chemicals: chemically modified vegetable oil | her naturally wavy blonde hair was chemically straightened.
            • relating to or by means of alcohol or intoxicating drugs: a chemically dependent person | drugs and alcohol offered a chemically induced sense of belonging.
          ORIGIN
          based on science with a C handshape.
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udd02\ud8fc\udc61\ud8ca\udd0a\ud8fc\udc61\ud8fc\udc07\ud8ed\udfc5\ud8ee\udc09.mov"} U}iU7 33[ #!)frost2024/05/29 17:58:052026/10/10 20:40:15AS16d21S2fe00S16d29S2fe00S38006S2ea04S2ea48M524x525S16d21503x476S16d29476x476S2ea04509x500S2ea48479x500
          noun
          1. the branch of science that deals with the identification of the c 33O !efrost2024/05/29 17:53:302026/05/10 16:46:44AS15a12S38510S15a1aS38530S20600S20600M515x526S15a12486x487S15a1a488x514S20600491x474S20600488x501Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd3\ud8fc\uddf1\ud8c8\udddb\ud8fc\ude11\ud8d8\ude41\ud8d8\ude41.mov"} 33M !Efrost2024/05/29 17:18:532026/05/10 16:46:31AS20340S2fe00S20348S2fe00S38006S22a04S22a14S26526S22a04S22a14M557x517S20340477x484S20348444x484S22a04478x502S22a14445x502S26526494x500S22a04544x502S22a14513x502Adam Frost{"video":"dominance: right;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5\ud8e1\ude07\ud8db\udfc5\ud8db\udfd5.mov"}o13x530S15a18487x491S15a20500x503S20e00500x488S22a00500x470
            verb
            1. to become greater over a period of time: turnover grew to more than $100,000 within three years.
              • to prosper; flourish: education groups thrive on organization.
              • to enjoy a period of great prosperity or rapid economic growth: business is booming | the popularity of soy-based foods has boomed in the last two decades.
              • [with object] to cause (something, especially a business) to increase: entrepreneurs who are struggling to grow their businesses.
            2. to develop.
            adjective
            1. becoming greater over a period of time; increasing: the growing demand for electric vehicles.
              • prosperous and growing; flourishing: a thriving economy | the thriving business George has built up.
                • the prisoner was forbidden to communicate with his family.
                • impart or pass on (information, news, or ideas): he communicated his findings to the inspector.
                • convey or transmit (an emotion or feeling) in a nonverbal way: the ability of good teachers to communicate their own enthusiasm | his sudden fear communicated itself.
                • succeed in conveying one's ideas or in evoking understanding in others: a politician must have the ability to communicate.
                • (of two people) be able to share and understand each other's thoughts and feelings: we don't seem to be communicating—we need a break from each other.
            noun
            1. the imparting or exchanging of information or news: at the moment I am in communication with London | direct communication between the two countries will produce greater understanding.
              • a letter or message containing information or news: a telephone communication.
              • the successful conveying or sharing of ideas and feelings: there was a lack of communication between Pamela and her parents.
              • social contact: she gave him some hope of her return, or at least of their future communication.
            2. (communications) means of sending or receiving information, such as phone lines or computers: satellite communications | [as modifier] : a communications network.
              • [treated as singular] the field of study concerned with the transmission of information by various means.
            ORIGIN
            based on talk with a C handshape.
            Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udcf1\ud8f0\udc06\ud8ca\udcf9\ud8f0\udc04\ud8e2\ude61\ud8e2\ude75.mov"} N"33Ka!Afrost2024/05/29 18:01:202026/10/10 20:40:29AS16d20S2fe00S15a3aS2fe00S37f00S28806S2880eS28806M529x523S15a3a471x511S16d20485x487S28806506x507S2880e506x492S28806507x477M531x528S15a3a470x516S10e04488x483S28806508x502S2880e508x487S28806509x472 M509x510S16d20492x490
            verb [with object]
            1. to compose the sequence of steps and moves for (a performance of dance or ice skating): he is now choreographing a ballet.
            adjective
            1. relating to the design and arrangement of steps and movements in dance or figure skating: he made his choreographic debut at the age of 17 | she was bursting with new choreographic ideas.
            adverb>  335 !efrost2024/05/29 18:04:122026/05/10 16:49:41AS15a51S2fe00S15a39S2fe00S21400S20c00M527x518S15a39474x482S15a51482x495S20c00499x489Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udc81.mov"} --O 33i o!efrost2024/05/29 18:19:042026/09/12 21:37:09AS15451S30006S1543fS30006S2ea06S2ea42M576x527S2ff00482x483S15451523x481S1543f519x503S2ea06551x486S2ea42547x505
            noun
            1. a visible mass of condensed water vapor floating in the atmosphere, typically high above the ground: the sun had disappeared behind a cloud | the full moon, hidden by veils of cloud.
              • an indistinct or billowing mass, especially of smoke or dust: a cloud of dust.
            2. (the cloud) networked computing facilities providing remote data storage and processing services via the internet: [as modifier] : once you are logged in to your cloud storage space, you can upload files to it and share them with others | $13 per month gets you 25GB of storage in the cloud.
            Adam Frost{"video":"dominance: right;\\n\ud8c7\udfd2\ud8f0\udc07\ud8c7\udfc0\ud8f0\udc07\ud8ed\udfc7\ud8ee\udc03.mov"}>having a period of great prosperity or rapid economic growth: the booming economy.
    2. developed/developing.
    noun
    1. the process of becoming greater over time: the company has experienced steady growth over the past five years.
      • increase in economic value or activity: the government aims to get growth back into the economy.
      • a period of great prosperity or rapid economic growth: a boom in precious metal mining | [as modifier] : a boom economy.
    2. a development.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\udde1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8db\udfc1.mov"}scompany developed a chain of hotels    .
  • [with object] to elaborate (a musical theme) by modification of the melody, harmony, or rhythm: the piano develops the melody into a short cadenza.
  • to start to exist, experience, or possess: [no object] : a strange closeness developed | [with object] : I developed an interest in law | [with object] : a head injury that caused him to develop a rare form of memory loss.
  • [with object] to treat (a photographic film) with chemicals to make a visible image: she came to get the film developed.
    • adjective
    1. advanced or elaborated to a specified degree: a fully developed system of public law.
      • (of a person or part of the body) having specified physical proportions: a strongman with well-developed muscles.
      • (of a country or region) advanced economically and socially: the deve ZZ<33iK]!frost2024/05/29 18:23:342026/10/10 20:40:49AS16d10S30005S16d18S30003S27100S27114M541x564S2ff00482x483S16d10505x519S16d18478x527S27100501x541S27114459x549M541x564S2ff00482x483S10010505x509S10018480x517S27100501x541S27114459x549 M509x510S16d20492x490
        verb
        1. share or exchangejV 33g #!Afrost2024/05/29 22:52:282026/09/22 21:57:39AS16d10S2fe00S15a08S2fe00S21414S20500S22a04S20500M520x518S15a08481x489S16d10489x482S22a04507x500S20500495x507
          noun
          1. series of lectures or lessons in a particular subject, typically leading to a qualification: a business studies course | a two-year training course | she took a course in medicine.
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udcf1\ud8fc\udc61\ud8c8\uddc9\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1\ud8db\udfc5\ud8d8\udde1.mov"} &&g 33= s!=frost2024/05/29 23:00:112026/05/30 01:11:53AS10e04S2fe00S15a3aS2fe00S37f00S28806S2880eS28806S15a40S2fe00S15a48S2fe00S38006S22a04S22a14M531x556S15a3a470x489S10e04488x456S28806508x475S2880e508x460S28806509x445S15a40510x511S15a48478x511S22a04510x541S22a14477x541noun a person who dances or whose profession is dancing: she thought he would become a ballet dancer.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd45\ud8fc\udc61\ud8c8\uddfb\ud8fc\udc61\ud8fb\udfa1\ud8e4\udf07\ud8e4\udf0f\ud8e4\udf07\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"}f 33[ !}frost2024/05/29 23:04:062026/09/26 22:44:34AS15a20S2fe00S15a18S2fe00S21406S20e00S22a00M5itloped world           | economic assistance to the less-developed countries.
    2. growing and becoming more mature, advanced, or elaborate: this is a rapidly developing field.
      • denoting or relating to a poor agricultural country that is seeking to become more advanced economically and socially: the developing world.
    3. denoting or relating to the process of treating a photographic film with chemicals to make a visible image: a developing tank.
    noun
    1. the process of developing or being developed: she traces the development of the novel | the development of less invasive treatment.
      • a specified state of growth or advancement: the wings attain their full development several hours after birth.
      • a new and refined product or idea: the latest developments in information technology.
      • an event constituting a new stage in a changing situation: I don't think there have been any new developments since yesterday.
      • the process of converting land to a new purpose by constructing buildings or making use of its resources: land suitable for development.
      • an area of land with new buildings on it: a major housing development in Chicago.
    2. the process of starting to experience or suffer from an ailment or feeling: the development of brittle bones.
    3. the process of treating photographic film with chemicals to make a visible image: agitation is carried out while a film is processed to ensure even development.
    ORIGIN
    based on increase with a D handshape.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c0\udc71\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8db\udfc1.mov"} ,,@33[1u!)frost2024/05/29 23:04:432026/10/10 20:41:08AS10110S2fe00S15a18S2fe00S21406S20e00S22a00M515x530S15a18486x499S10110499x500S20e00499x488S22a00499x470M513x530S15a18487x491S15a20500x503S20e00500x488S22a00500x470 M508x515S10120492x485
    verb
    1. to grow or cause to grow and become more mature, advanced, or elaborate: [no object] : motion pictures developed into mass entertainment | [with object] : entrepreneurs develop their skills through trial and error.
      • [no object] (of a poor agricultural country) to become more economically and socially advanced: the country is developing at a rapid rate and the economy is booming.
      • [with object] to convert (land) to a new purpose by constructing buildings or making other use of its resources: plans to develop the area.
      • to construct or convert (a building) so as to improve existing resources: the pi> (of a product) offering the best value for the money: [in combination] : an economy pack.
      • designed to be economical to use: an economy car.
    adverb
    1. in a way that relates to economics or finance: [sentence adverb] : the region is important economically.
      • in a way that involves careful use of money or resources: the new building was erected as economically as possible.
      • in a way that uses no more of something than is necessary: a précis aims to express a passage more economically.
    ORIGIN
    based on money with an E handshape.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udff2\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"}v: we flew economy.
    adjective
    1. relating to economics or the economy: the government's economic policy | pest species of great economic importance.
      • (of a subject) considered in relation to trade, industry, and the creation of wealth: economic history.
    2. giving good value or service in relation to the amount of money, time, or effort spent: a small, economical car.
      • justified in terms of profitability: many organizations must become larger if they are to remain economic.
      • requiring fewer resources or costing less money: solar power may provide a more economic solution.
      • (of a person or lifestyle) careful not to waste money or resources: he was economical in all areas of life.
      • using no more of something than is necessary: this chassis is economical in metal and therefore light in weight.
      • [attributive] noun
        1. the wealth and resources of a country or region, especially in terms of the production and consumption of goods and services.
          • a particular system or stage of an economy: a free-market economy | the less-developed economies.
          • the condition of a region or group as regards material prosperity: he is responsible for the island's modest economics.
        2. the branch of knowledge concerned with the production, consumption, and transfer of wealth.
        3. careful management of available resources: even heat distribution and fuel economy.
          • sparing or careful use of something: economy of words.
          • (usually economies) a financial saving: there were many economies to be made by giving up our offices in Manhattan.
          • (also economy class) the cheapest class of air or rail travel <<@ 33[ G!} frost2024/05/29 23:16:012025/03/05 20:15:45AS1f720S2fe00S15a0aS2fe00S21400S21000S26506M530x515S15a0a478x503S1f720470x496S21000492x486S26506515x486noun the basic monetary unit of the US, Canada, Australia, and certain countries in the Pacific, Caribbean, Southeast Asia, Africa, and South America.Adam Frost{"video":"dominance: right;\\n\ud8d7\udcc1\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf81\ud8d9\ude01\ud8e1\udde7.mov"} _q"33K!A#frost2024/05/29 23:34:012026/10/10 20:41:32AS1ce11S38507S1ce19S38501S20500S20500S2df08S{S!335s!"frost2024/05/29 23:32:462026/10/10 20:41:24AS14a31S2fe00S15a39S2fe00S21400S20600M519x51x 33[ !}!frost2024/05/29 23:18:342026/05/30 01:56:24AS1bb11S2fe00S2031aS2fe00S21400S20800S2c500M520x533S2031a488x518S1bb11489x493S20800507x521S2c500480x467noun
            1. (also Earth) the planet we live on: the diversity of life on earth.
              • a celestial body moving in an elliptical orbit around a star; a planet.
            2. one of the four elements in ancient and medieval philosophy and in astrology: [as modifier] : an earth sign.
            Adam Frost{"video":"dominance: right;\\n\ud8d1\ude32\ud8fc\udc61\ud8d8\udd3b\ud8fc\udc61\ud8d9\udf81\ud8d8\udf01\ud8ea\udde1.mov"}2df10M556x516S36d00479x512S1ce11512x487S1ce19465x487S2df08535x484S2df10444x484M565x517S36d00479x513S18211521x496S18219454x496S2df08544x484S2df10435x484 M511x515S1ce20489x485
            noun
            1. a small imaginary being of human form that has magical powers, especially a female one: she believed she had had fairies at the bottom of her garden | [as modifier] : she dressed up as a colorful fairy princess with her sister | the mischievous ways of the fairy folk.
            ORIGIN
            based on angel with an F handshape.
            Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d3\udd52\ud8fc\udde8\ud8d3\udd5a\ud8fc\udde2\ud8d8\udde1\ud8d8\udde1\ud8ec\udfa9\ud8ec\udfb1.mov"}power over nature or human fortunes; a deity: a moon god | an incarnation of the god Vishnu.
            • an image, idol, animal, or other object worshiped as divine or symbolizing a god: wooden gods from the Congo.
            • used as a conventional personification of fate: he dialed the number and, the gods relenting, got through at once.
          • (god) an adored, admired, or influential person: he has little time for the fashion victims for whom he is a god.
            • a thing accorded the supreme importance appropriate to a god: don't make money your god.
    exclamation
    1. used for emphasis or to express emotions such as surprise, anger, or distress: God, what did I do to deserve this? | my God, why didn't you tell us before! | good God, where have you been?.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd1\ud8f0\udc07\u00d8\ud8e9\udca6.mov"} involving magic and adventure, especially in a setting other than the real world.
  • [as modifier] denoting a competition or league in which participants select imaginary teams from among the players in a real sports league and score points according to the actual performance of their players: he's my second-round draft choice in fantasy baseball this year | look at their dedication to fantasy leagues and the enormous minutiae of the stats they memorize.
  • Music a musical composition, free in form, typically involving variation on an existing work or the imaginative representation of a situation or story; a fantasia.
    • ORIGIN
    based on imagine with F handshapes.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d3\udd51\ud8f0\udc08\ud8d3\udd59\ud8f0\udc02\ud8ed\udfc1\ud8ee\udc0d.mov"}ent     | a license is required by law.
    • an individual rule as part of a system of law: an initiative to tighten up the laws on pornography.
    • systems of law as a subject of study or as the basis of the legal profession: he was still practicing law | [as modifier] : a law firm.
    • statutory law and the common law.
    • a thing regarded as having the binding force or effect of a formal system of rules: what he said was law.
    • (the law) informal the police: he'd never been in trouble with the law in his life.
  • a rule defining correct procedure or behavior in a sport: the laws of the game.
  • a statement of fact, deduced from observation, to the effect that a particular natural or scientific phenomenon always occurs if certain conditions are present: the second law of thermodynamics.
    • a generalization based on a fact or event perceived to be recurrent: the first law of American corporate life is that dead wood floats.
  • the body of divine commandments as expressed in the Bible or other religious texts.
    • (the Law) the Pentateuch as distinct from the other parts of the Hebrew Bible (the Prophets and the Writings).
    • (also the Law of Moses) the law of God as revealed to Moses and recorded in the first five books of the Old Testament (the Pentateuch). Also called Mosaic Law.
    • adjective
    1. [attributive] of, based on, or concerned with the law: the American legal system.
      • appointed or required by the law: a legal requirement.
      • Law recognized by common or statutory law, as distinct from equity.
      • relating to theological legalism.
    Adam Frost{"video":"dominance: right;\\nletter; integrated;\\n\ud8d4\udec1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8db\udfc5\ud8d8\udde1.mov"}  # 33i7!$frost2024/05/29 23:42:292026/10/10 20:41:47AS1ce10S30007S1ce18S30001S2ea00S2ea4cM539x518S2ff00482x483S1ce10517x443S1ce18460x443S2ea00519x475S2ea4c469x475M511x515S1ce20489x485
    noun
    1. 1 the faculty or activity of imagining things, especially things that are impossible or improbable: his research had moved into the realm of fantasy.
      • a fanciful mental image, typically one on which a person dwells at length or repeatedly and which reflects their conscious or unconscious wishes: the notion of being independent is a child's ultimate fantasy.
      • an idea with no basis in reality: it is a misleading fantasy to suggest that the bill can be implemented.
      • a genre of imaginative fiction}er and space considered as a whole.
        • (especially in science fiction and fantasy) an imaginary world that forms the setting of a fictional work or series of works: the drama is set in the Star Wars universe | even though magic is no secret in this universe, it is considered a relic of the past.
        • a particular sphere of activity or experience: the front parlor was the hub of her universe | he explored the universe of childhood in several paintings.
      • [chiefly in translation] a person or thing having universal effect, currency, or application.
        • Logic a universal proposition.
        • Philosophy a term or concept of general application.
        • Philosophy a nature or essence signified by a general term.
        • Linguistics a universal grammatical rule or linguistic feature.
    adjective
    1. relating to the universe or cosmos, especially attalions.
    2. Art two or more figures or objects forming a design.
    3. Chemistry a set of elements occupying a column in the periodic table and having broadly similar properties arising from their similar electronic structure.
    4. Chemistry a combination of atoms having a recognizable identity in a number of compounds.
    5. Mathematics a set of elements, together with an associative binary operation, that contains an inverse for each element and an identity element.
    6. Geology a stratigraphic division consisting of two or more formations.
    ORIGIN
    based on group with G handshapes.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d6\ude21\ud8fc\udc61\ud8d6\ude29\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ec\udfa7\ud8ec\udfbf\ud8d8\udde1.mov"} oo% 33 !)&frost2024/05/30 00:31:182026/09/12 20:26:33AS15a10S30006S10006S2b705M534x518S2ff00482x483S15a10522x485S2b705520x458
    noun
    1. (in Christianity and other monotheistic religions) the creator and ruler of the universe and source of all moral authority; the supreme being.
    2. (god) (in certain other religions) a superhuman being or spirit worshiped as having |`$ 33g 7!A%frost2024/05/30 00:27:402026/09/25 20:20:58AS1dc40S2fe00S15a18S2fe00S21406S20500S22a04S20500M521x523S15a18479x494S1dc40492x478S22a04508x505S20500494x512
      noun
      1. (often the law) the system of rules which a particular country or community recognizes as regulating the actions of its members and which it may enforce by the imposition of penalties: they were taken to court for breaking the law | [as modifier] : law enforcem~2S22a05504x504
        noun
        1. a place regarded in various religions as a spiritual realm of evil and suffering, often traditionally depicted as a place of perpetual fire beneath the earth where the wicked are punished after death: irreligious children were assumed to have passed straight to the eternal fires of hell.
          • a state or place of great suffering; an unbearable experience: I've been through hell | he made her life hell.
        exclamation
        1. used to express annoyance or surprise or for emphasis: oh, hell—where will this all end? | hell, no, we were all married.
          • (the hell) informal expressing anger, contempt, or disbelief: who the hell are you?.
        Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udc22\ud8fc\udc61\u00d8\ud8db\udfc6.mov"} "& 33[ !}'frost2024/05/30 00:43:462026/05/10 16:54:01AS15410S2fe00S15418S2fe00S38006S2df06S2df1eM522x527S15410507x502S15418478x502S2df06502x474S2df1e478x474Adam Frost{"video":"dominance: equal;\\n\ud8c7\udf91\ud8fc\udc61\ud8c7\udf99\ud8fc\udc61\ud8fc\udc07\ud8ec\udfa7\ud8ec\udfbf.mov"}ing the study of morphology, syntax, phonetics, and semantics: as a professor of linguistics, I have been studying how electronic communication compares to traditional print when it comes to learning | [as modifier] : a linguistics student.
      adjective
      1. relating to language or linguistics: a child's linguistic ability.
      adverb
      1. in a way that relates to language or linguistics: the country is very diverse culturally and linguistically.
      ORIGIN
      based on language ending with S handshapes.
      Adam Frost{"video":"dominance: equal;\\nletter: integrated;\\n\ud8d4\uded1\ud8fc\udc61\ud8d4\uded9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\udde7\ud8e1\uddf3\ud8d8\udd71\ud8d8\udd79.mov"} u'33s1!Y(frost2024/05/30 00:56:242026/10/10 20:42:10AS1f020S2fe00S1f028S2fe00S21406S20500S2df06S2df1eS20500M531x522S1f020502x507S1f028470x507S2df06502x479S2df1e479x479M522x527S15410507x502S15418478x502S2df06502x474S2df1e478x474 M515x508S1f000486x493
      noun
      1. a number of people or things that are located close together or are considered or classed together: these bodies fall into four distinct groups.
        • a number of people who work together or share certain beliefs: I now belong to my local drama group.
        • a commercial organization consisting of several companies under common ownership.
        • a number of musicians who play popular music together.
        • Military a unit of the US Air Force, consisting of two or more squadrons.
        • Military a unit of the US Army, consisting of two or more bi>humans are social creatures and form attachments all the time.
      adjective
      1. relating to or characteristic of people or human beings: the human body.
        • of or characteristic of people as opposed to God or animals or machines, especially in being susceptible to weaknesses: they are only human and therefore mistakes do occur | the risk of human error.
        • of or characteristic of people's better qualities, such as kindness or sensitivity: the human side of politics is getting stronger.
      ORIGIN
      based on body with an H handshape.
      Adam Frost{"video":"dominance: equal;\\nletter: integrated;\\n\ud8c1\udfe3\ud8fc\uddf8\ud8c1\udfeb\ud8fc\uddf2\ud8d8\udde1\ud8d8\udde1\ud8db\udfc5\ud8db\udfd5\ud8d8\udde1\ud8d8\udde1.mov"} ww) 33) a!A*frost2024/05/30 01:03:572026/09/25 20:10:12AS1ce40S2fe00S10006S22f04S26606M517x526S1ce40489x474S26606487x501S22f04484x512
      noun
      1. a style of popular music that features rapping over a rhythm track, often with sampling and scratching: he learned to fuse jazz with R & B and hip-hop | [as modifier] : a rich and diverse playlist of hip-hop artists.
      Adam Frost{"video":"dominance: right;\\n\ud8d3\udd81\ud8fc\udc61\u00d8\ud8dc\udda5\ud8e1\ude47.mov"},( 33 !U)frost2024/05/30 01:02:542026/09/27 17:51:28AS11541S2fe00S10006S22a05M517x518S11541484x48tory.
      • the past considered as a whole: letters that have changed the course of history.
    3. the whole series of past events connected with someone or something: the history of Aegean painting.
      • an eventful past: the group has quite a history.
      • a past characterized by a particular thing: his family had a history of insanity.
    4. a continuous, typically chronological, record of important or public events or of a particular trend or institution: a history of the labor movement.
      • a historical play: Shakespeare's comedies, histories, and tragedies.
    5. a record kept by a web browser of the web pages and other files it has been used to access: when you see advertisements on the site, they are in relation to what you're searching for, not your history.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udc28\ud8fc\udc61\u00d8\ud8dc\udda5.mov"} EsEG*+ 33) !A,frost2024/05/30 01:12:042026/05/30 01:10:35AS1ed10S31410S10006S20500S22a07M547x518S2ff00482x483S1ed10507x486S22a07534x476noun (the moon or the Moon) the natural satellite of the earth, visible (chiefly at night) by reflected light from the sun: there was no moon, but a sky sparkling with brilliant stars | the first man on the moon.
    • a natural satellite of any planet: Titan, Saturn's largest moon.
    Adam Frost{"video":"dominance: right;\\n\ud8d6\udcf1\ud8f1\udf91\u00d8\ud8d8\udde1\ud8db\udfc8.mov"}*3331W!q+frost2024/05/30 01:09:022026/10/10 20:42:23AS1dc50S2fe00S1dc58S2fe00S21406S20500S26506S26512S20350S20358M565x515S1dc50502x485S1dc58475x485S26506530x500S26512455x500S20350550x500S20358435x500M535x527S1dc50502x473S1dc58475x473S28805515x507S2881d466x507 M508x508S20320493x493
    noun
    1. the scientific study of language and its structure, includ EE7, 33K M!u-frost2024/05/30 14:03:022026/05/30 01:07:19AS19a40S2fe00S19a48S2fe00S38006S15a40S2fe00S15a48S2fe00S38006S22a04S22a14M532x536S19a40504x464S19a48469x464S15a40512x490S15a48477x490S22a04511x521S22a14476x521noun a person taking part in a sport or game: a tennis player.
      • informal (also playa) a confident, successful man with many sexual partners: she knows Harry is something of a player | she's so wary of playas, she's declared herself celibate.
      Adam Frost{"video":"dominance: equal;\\n\ud8ce\ude01\ud8fc\udc61\ud8ce\ude09\ud8fc\udc61\ud8fc\udc07\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"} p- 33k!!e.frost2024/05/30 14:08:042026/09/24 02:49:48AS10012S2fe00S10018S2fe00S21407S20500M517x517S10012487x484S10018484x487M521x523S10012491x490S10018489x493S20600480x477
      noun
      1. (in sports and games) a mark or unit of scoring: he scored 13 of his team's final 19 points against Houston.
      2. a unit used in measuring value, achievement, or extent: the shares index was down seven points.
      3. a unit of credit toward an award or benefit: points were allocated according to the inadequacy of the existing accommodation.
      INFLECTED FORMS
      point [in isolation]
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf88\ud8d8\udde1.mov"} ,,P. 335Q?!/frost2024/05/30 14:09:292026/09/24 02:49:13AS10012S2fe00S10018S2fe00S21407S20600M521x523S10012491x490S10018489x493S20600480x477M517x517S10012487x484S10018484x487
      noun [in isolation]
      1. a point.
      Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc13\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf88\ud8d8\ude41.mov"} 77E/ 335 !e0frost2024/05/30 15:41:332026/09/19 23:04:58AS15a47S2fe00S14c0aS2fe00S21405S20600M532x518S14c0a468x482S15a47491x493S20600510x507
      adjective
      1. of or relating to the first year at a university, college, or high school: my freshmen year | all first-year students must attend orientation.
      noun
      1. a first-year student at a university, college, or high school: we invited the freshmen | [as modifier] : a freshman second baseman.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\ude08\ud8fc\udc61\ud8c7\udc8b\ud8fc\udc61\ud8d9\udf86\ud8d8\ude41.mov"} u0 335 o!e1frost2024/05/30 15:48:522026/09/19 23:04:48AS15a40S2fe00S14c0aS2fe00S21406S20600M535x515S14c0a466x492S15a40498x486S20600513x498
      adjective
      1. of or relating to the second year at a university, college, or high school: Frances taught sophomore English.
      noun
      1. a second-year student at a university, college, or high school: her 16-year-old twin sons are sophomores.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c7\udc8b\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"} }1 335 !e2frost2024/05/30 15:58:592026/09/19 23:04:38AS15a41S2fe00S14c0aS2fe00S21407S20600M533x519S14c0a467x496S15a41486x481S20600511x491
      adjective
      1. of or relating to the third year at a university, college, or high school: his junior year in college.
      noun
      1. a third-year student at a university, college, or high school: [with modifier] : high-school juniors and seniors.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\ude02\ud8fc\udc61\ud8c7\udc8b\ud8fc\udc61\ud8d9\udf88\ud8d8\ude41.mov"} ~~~2 335 !e3frost2024/05/30 16:03:222026/09/19 23:04:28AS15a51S2fe00S14c0aS2fe00S21400S20600M522x522S14c0a478x499S15a51482x480S20600500x478
      adjective
      1. of or relating to the final year at a university, college, or high school: she is finishing her senior project.
      noun
      1. a student in their final year at a university, college, or high school: there are twenty seniors in the program.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c7\udc8b\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"}~  $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|IoJpKqLrMtOvPwQyR{S|T~UVWXY[ \ ^ _ `bdefhlmnqruyz"#%&')+,-./01245789;=?ABCEGIJLMOQRSTUW[_cehjŽmÎpĎqŎrƎsǎuȎvɎxʎzˎ~̎͏ΏϏЏ яӏՏ׏؏ُۏ܏ݏޏߏ!"$%&()*,/1478:=?@ACFHJgy.
    adjective
    1. based on or characterized by the methods and principles of science: the scientific study of earthquakes | high-level scientific research | the scientific establishment.
      • relating to or used in science: scientific instruments | a scientific approach to psychology.
    2. systematic; methodical: how many people buy food in an organized, scientific way?.
    adverb
    1. by means of scientific methods and principles: scientifically proven treatments | both theories can be explained scientifically.
      • in a way that relates to or is used in science: scientifically minded people | a scientifically important site.
    Adam Frost{"video":"dominance: right;\\n\ud8d7\udc02\ud8fc\udc61\ud8d7\udc0a\ud8fc\udc61\ud8fc\udc07\ud8ed\udfc5\ud8ee\udc09.mov"} m4 33 !!U5frost2024/05/30 16:15:072026/09/19 21:42:54AS11547S2fe00S10006S22f04M515x521S11547488x480S22f04486x507
    noun
    1. the study of past events, particularly in human affairs: medieval European his8333g)!q4frost2024/05/30 16:10:002026/10/10 20:42:37AS11502S38517S1150aS38511S20500S20500S22a04S22a14S20500S20500M537x527S11502507x474S1150a464x474S20500509x484S20500482x484S22a04508x498S22a14481x498S20500510x516S20500482x516M532x529S15a02505x471S15a0a469x471S20500509x486S20500482x486S22a04508x500S22a14481x500S20500510x518S20500482x518 M515x508S11502485x493
      noun
      1. a man, woman, or child of the species Homo sapiens or other (extinct) species of the genus Homo: this poses relatively little risk to humans or wildlife | <e made rocky road for dessert.
        • an ice cream flavor that contains chocolate, marshmallows, and nuts: rocky road is my favorite ice cream.
      2. a type of popular dance music originating in the 1950s, characterized by a heavy beat and simple melodies: the band meld rockabilly with pure rock and roll | he popularized rock and roll in the 1950s and early 1960s.
        • rock music: they play a wide variety of rock and roll, particularly favoring psychedelia and hard rock | [as modifier] : a rock and roll icon | their relationship couldn't survive the rock and roll lifestyle they adopted.
      ORIGIN
      based on the spelling of R and R.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8c2\udde1\ud8fc\udc61\u00d8\ud8c2\udde1.mov"}5x515
      verb [no object]
      1. to perform rap music: he raps under the name of Mr. T.
      noun
      1. a type of popular music originating among African American communities in which words are recited rapidly and rhythmically over a prerecorded, typically electronic instrumental backing: the label specializes in rap and modern soul | [as modifier] : rap artists.
        • a piece of music performed in rap style, or the words themselves: the track's a surprisingly lyrical rap.
      2. informal a criminal charge, especially of a specified kind: he's just been acquitted on a murder rap.
      3. informal a person or thing's reputation, typically a bad one: there's no reason why drag queens should get a bad rap.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c2\udde1\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8c6\udc52.mov"} NN&5 33[ !}6frost2024/05/30 16:17:022026/09/12 20:18:06AS1f521S2fe00S1f529S2fe00S38006S2ea04S2ea48M527x525S1f521505x476S1f529474x476S2ea04510x500S2ea48480x500
      noun
      1. the systematic study of the structure and behavior of the physical and natural world through observation, experimentation, and the testing of theories against the evidence obtained: the world of science and technology | science laboratories.
        • a particular area of science: veterinary science | [count noun] : the agricultural sciences.
        • a systematically organized body of knowledge on a particular subject: the science of criminolo[treated as singular or plural]
          1. a group of players forming one side in a competitive game or sport: his team played well | [as modifier] : team members.
            • informal used before another word to form the name of a real or notional group which supports or favors the person or thing indicated: are you team Mac or team PC? | we're totally Team Jenna and can't wait for this delightful show to return. [from the way in which some national sports teams are named, e.g. Team GB, Team USA]
          2. two or more people working together: a team of researchers | [as modifier] : a team effort.
          3. two or more animals, especially horses, harnessed together to pull a vehicle: the abbey's wagon and a team of horses are gone.
      Adam Frost{"video":"dominance: equal;\\nletter: integrated;\\n\ud8d7\ude41\ud8fc\udc61\ud8d7\ude49\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ec\udfa7\ud8ec\udfbf\ud8d8\udde1.mov"} 7 33) !o8frost2024/05/30 16:23:242026/09/29 02:17:17AS11a20S2fe00S10006S1f720S14051M516x539S11a20498x462S1f720493x496S1405148a6 33c#!e7frost2024/05/30 16:20:582026/10/10 20:42:54AS11a20S2fe00S10006S11a20M508x532S11a20493x468S11a20493x502M508x515S11a20493x485 M508x515S11a20493x485
      noun
      1. a track or set of tracks made of steel rails along which passenger and freight trains run: his uncle works on the railroad | [as modifier] : railroad tracks.
        • a system of tracks with the trains, organization, and personnel required for its working: [in names] : the Union Pacific Railroad.
      2. a dessert made from chocolate, marshmallows, and nuts: sh/i>.
      3. a symbol (*) used to mark printed or written text, typically as a reference to an annotation or to stand for omitted matter: the captain has an asterisk against his name.
      4. a famous or exceptionally talented performer in the world of entertainment or sports: a pop star | [as modifier] : singers of star quality.
        • an outstandingly good or successful person or thing in a group: a rising star in the party | [as modifier] : Ellen was a star student.
      5. Astrology a planet, constellation, or configuration regarded as influencing someone's fortunes or personality: his golf destiny was written in the stars.
        • (stars) informal a horoscope published in a newspaper or magazine: what do my stars say?.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8dd\udc41\ud8dd\udc55.mov"} ??=8 33 W!A9frost2024/05/30 16:27:312026/05/09 00:41:03AS18d41S2fe00S18d49S2fe00S21400S20e00S26a02S26a16M526x525S18d49497x481S18d41475x476S20e00495x505S26a02479x498S26a16509x498noun the abstract science of number, quantity, and space: she teaches math and science.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\udd22\ud8fc\udc61\ud8cd\udd2a\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc3\ud8e1\udfd7.mov"} ==?9 33 )!u:frost2024/05/30 16:43:222026/10/10 20:43:08AS15a40S38622S15a3aS2fe00S2a404S15a40S2fe00S15a48S2fe00S38006S22a04S22a14M534x551S37806475x490S15a3a507x485S15a40497x451S2a404467x449S15a40510x506S15a48478x506S22a04510x536S22a14477x536
      noun
      1. a person who plays a musical instrument, especially as an occupation, or is musically talented: your father was a fine musician | aspiring rock and pop musicians.
      2. a person who sings, especially professionally: a pop singer.
      ORIGIN
      a compound of music and -er.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\ude63\ud8c8\uddfb\ud8fc\udc61\ud8e7\udd85\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"} Fe\; 33s !Y noun [treated as singular]
      1. the branch of science concerned with the nature and properties of matter and energy.
    Adam Frost{"video":"dominance: equal;\\n\ud8c1\ude03\ud8fc\udc61\ud8c1\ude0b\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"}hat criminals should be severely punished | I have done wrong and I'm being punished for it.
    • to inflict or impose a restriction, financial charge, form of suffering, or other undesired consequence on someone for (an offense, especially a transgression of a legal or moral code): fraudulent acts would be punished by up to two years in prison.
    • to treat (someone) in an unfairly harsh way: a rise in prescription charges would punish the poor.
  • to subject to severe and debilitating treatment: unforgiving cold has punished the eastern third of the country for the past ten days.
    • noun
    1. the infliction or imposition of a restriction, financial charge, form of suffering, or other undesired consequence for an offense: officials who are found to be negligent of their duty will face severe punishment | he vowed the culprits would not escape punishment for the crime | crime dema )`L=33)+!o>frost2024/05/30 17:11:512026/09/11 05:13:07AS20320S2fe00S10006S11520S11920M511x540S20320496x461S11520496x480S11920490x514M536x518S2ff00482x483S16d10507x482S22a07523x470 M577x518S2ff00482x483S18510536x449S2ef00559x436S22a03534x460S14c11508x464
      noun
      1. the sun.
      2. sunlight.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8c2\udc01\ud8c2\udd81.mov"}K< 33s i!Y=frost2024/05/30 17:08:422026/09/11 04:40:09AS1fb20S2fe00S1fb28S2fe00S21406S20500S2df06S2df1eS20500M522x522S1fb20502x503S1fb28484x503S2df06502x479S2df1e479x479
      noun  \>? 33 !@frost2024/05/30 17:32:092026/09/11 05:37:21AS10020S2fe00S10028S2fe00S21406S20e00S23600S23614M547x531S10020501x481S10028484x470S20e00494x515S23600508x514S23614453x514
      noun
      1. a fixed luminous point in the night sky which is a large, remote incandescent body like the sun.
      2. a conventional or stylized representation of a star, typically one having five or more points: the walls were painted with silver moons and stars.
        • a star symbol used to indicate a category of excellence: the hotel has three stars<v> 33 !e?frost2024/05/30 17:30:512026/05/10 19:34:52AS15a12S2fe00S15a18S2fe00S21400S20500M514x520S15a12487x481S15a18496x493Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd3\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1.mov"}nds just punishment.
          • a restriction, financial charge, form of suffering, or other undesired consequence inflicted or imposed for an offense: the charge carries a maximum penalty of ten years' imprisonment | he approved of stiff punishments for criminals | breaching this rule could result in a wide range of punishments.
        • rough treatment or handling inflicted on or suffered by a person or thing: your machine can take a fair amount of punishment before falling to pieces.
        • (in sports and games) a disadvantage or handicap imposed on a player or team, typically for breaking a rule.
          • a kick or shot awarded to a team because of a serious infringement of the rules by an opponent: City players appealed for a penalty | the referee awarded a penalty | [as modifier] : a penalty corner.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8fc\ude52\u00d8\ud8d9\udd41\ud8db\udfc4.mov"}as distinct from the earth: cosmic matter.
    2. [chiefly in translation] of, affecting, or done by all people or things in the world or in a particular group; applicable to all cases: universal adult suffrage | the incidents caused universal concern.
      • Logic denoting a proposition in which something is asserted of all of a class.
      • Linguistics denoting or relating to a grammatical rule, set of rules, or other linguistic feature that is found in all languages.
      • (of a tool or machine) adjustable to or appropriate for all requirements; not restricted to a single purpose or position.
    adverb [chiefly in translation]
    1. by everyone; in every case: progress is not always universally welcomed.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udc22\ud8fc\udc61\ud8c1\udfeb\ud8fc\udc61\ud8d9\udf81\ud8ed\uded5\ud8d8\udde1.mov"}ion, or group or in the thought and attitudes of a particular period: the university is a symbol of the nation's egalitarian spirit.
    • a specified emotion or mood, especially one prevailing at a particular time: I hope the team will build on this spirit of confidence.
    • the attitude or intentions with which someone undertakes or regards something: he confessed in a spirit of self-respect, not defiance.
    • the quality of courage, energy, and determination or assertiveness: his visitors admired his spirit and good temper.
    • the real meaning or the intention behind something as opposed to its strict verbal interpretation: the rule had been broken in spirit if not in letter.

    PHONOLOGICAL VARIANTS
    spirit with 8-handAdam Frost{"video":"dominance: right;\\n\ud8d3\udd92\ud8fc\udc61\ud8d3\udd7b\ud8fc\udc61\ud8d9\udf81\ud8d8\udf01\ud8db\udfc1.mov"} o!WA 33A c!)Bfrost2024/05/30 17:55:502026/09/25 00:34:43AS11541S2fe00S1150aS2fe00S21400S2e734S20500M519x523S1150a488x508S11541481x481S2e734503x477
    noun
    1. (the universe) all existing matt@ 33C !AAfrost2024/05/30 17:39:342026/10/04 20:15:16AS10011S38611S10006S20e00S22a03M524x534S37602495x467S10011503x501S20e00488x510S22a03476x520
      verb [with object]
      1. to inflict or impose a restriction, financial charge, form of suffering, or other undesired consequence on (someone) because they have committed an offense: they take the view tn the accomplishment of an aim or purpose: there is a thin line between success and failure | the region has had some success in attracting light industry.
        • the attainment of fame, wealth, or social status: her success owed more to hard work than luck | the success of his play.
        • a person or thing that achieves desired aims or attains fame, wealth, etc.: overall the fair was a great success | I must make a success of my business.
        adjective accomplishing an aim or purpose: the focus should be on a successful outcome | the successful candidate will be responsible for building a good relationship with the financial operations team.
        • having achieved popularity, profit, or distinction: a successful actor | building a successful business takes time | he has embarked on a successful solo career.
        Adam Frost{"video":"dominance: equal;\\n\ud8c0\udc01\ud8fc\udc61\ud8c0\udc09\ud8fc\udc61\ud8fc\udc07\ud8df\uddaa\ud8df\uddb2.mov"}18S2ff00482x483S18210497x460S18218480x470S2e700525x460S2e740459x460S26506544x466S26512442x466
        noun
        1. a place regarded in various religions as the abode of God (or the gods) and the angels, and of the good after death, often traditionally depicted as being above the sky: those who practiced good deeds would receive the reward of a place in heaven | Juno, Queen of Heaven and wife of Jupiter.
          • God (or the gods): Constantine was persuaded that disunity in the Church was displeasing to heaven.
          • Theology a state of being eternally in the presence of God after death: the everlasting happiness with God that we call heaven.
        2. informal a place, state, or experience of supreme bliss: lying by the pool with a good book is my idea of heaven.
        Adam Frost{"video":"dominance: right;\\n\ud8cc\udcd1\ud8f0\udc01\ud8cc\udcd9\ud8f0\udc01\ud8ed\udea1\ud8ed\udee1\ud8e1\udde7\ud8e1\uddf3.mov"} FF6B 33 E!)Cfrost2024/05/30 18:05:442026/09/11 05:39:47AS11011S36a00S10006S20600M535x536S36a00482x477S11011507x508S20600493x525
        noun
        1. a corpse supposed, in European folklore, to leave its grave at night to drink the blood of the living by biting their necks with long pointed canine teeth.
        Adam Frost{"video":"dominance: right;\\n\ud8c1\ude12\ud8f9\udfc1\u00d8\ud8d8\ude41.mov"} !C 33) ]!ADfrost2024/05/30 18:07:162026/09/11 05:44:08AS11a20S30000S10006S20500S22a00M518x518S2ff00482x483S11a20493x461S22a00493x444
        noun
        1. a mythical animal typically represented as a horse with a single straight horn projecting from its forehead.
        2. something that is highly desirable but difficult to find or obtain: an album like this is something of a unicorn.
          • a start-up company valued at more than a billion dollars, typically in the software or technology sector: a currency-exchange unicorn | [as modifier] : many unicorn start-ups have little revenue to speak of.
        Adam Frost{"video":"dominance: right;\\n\ud8c2\udde1\ud8f0\udc01\u00d8\ud8d8\udde1\ud8db\udfc1.mov"} \u\E 33A !}Ffrost2024/05/30 18:15:312026/05/10 19:36:22AS14041S2fe00S14049S2fe00S21400S2e734S20500M522x526S14049491x502S14041478x491S2e734503x475Adam Frost{"video":"dominance: right;\\n\ud8c6\udc42\ud8fc\udc61\ud8c6\udc4a\ud8fc\udc61\ud8d9\udf81\ud8ed\uded5\ud8d8\udde1.mov"}D 33C }!mEfrost2024/05/30 18:10:012026/10/05 02:22:43AS10e00S36a00S10006S20e00S22f00M536x552S36a00482x477S10e00491x522S20e00517x534S22f00511x518
        noun [in isolation]
        1. a voice.
        Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c1\udd41\ud8f9\udfc1\u00d8\ud8d9\udd41\ud8dc\udda1.mov"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx$#%$&%'&(')(*)+*,+-,.-/.0/102132435465768798:9;:<;=<>=?>@?A@BACBDCEDFEGFHGIHJIKJLKMLNMONPOQPRQSRTSUTVUWVXWYXZY[Z\[]\^]_^`_a`bacbdcedfegfhgihjikjlkmlnmonpoqprqsrtsutvuwvxwyxzy{z|{ PEG 33[ g!iHfrost2024/05/30 18:24:302026/08/27 18:32:06AS15a40S2fe00S15a48S2fe00S21400S21100S26500M511x539S15a48490x512S15a40498x495S21100498x479S26500497x462
        You might be looking for main.
        Adam Frost{"video":"dominance: right;\\nvisible: sign;"}_F33C=!cGfrost2024/05/30 18:20:092026/09/19 21:23:35AS14c00S33200S10006S26a00S18501M549x532S33100482x483S14c00491x501S26a00522x503S18501521x484M548x532S33100482x483S14c00491x501S26500526x503S18501521x484
        noun [in isolation]
        1. a wolf.
        Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udc81\ud8f4\udec1\u00d8\ud8e1\udfc1\ud8cc\udde2.mov"} BI 33[ K!}Jfrost2024/05/30 18:33:122026/09/24 23:13:20AS10040S2fe00S15a48S2fe00S21404S21100S26500M517x529S10040483x499S15a48489x472S21100504x511S26500503x494
        noun
        1. a college student's subsidiary subject or area of concentration: a minor in philosophy.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc41\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf85\ud8d9\ude61\ud8e1\udde1.mov"}"H 33[ !}Ifrost2024/05/30 18:26:542026/05/10 19:40:39AS10041S2fe00S15a48S2fe00S21400S21100S26500M514x528S15a48486x480S10041493x498S26500499x472S21100500x489Adam Frost{"video":"dominance: right;\\n\ud8c0\udc42\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e1\udde1.mov"} L@J 33[ G!}Kfrost2024/05/30 18:37:262026/09/11 05:52:19AS10631S2fe00S15a37S2fe00S21400S20e00S26a03M527x526S15a37495x475S10631504x494S20e00490x499S26a03474x505
        noun
        1. a fast contact sport played on an ice rink between two teams of six skaters, who attempt to drive a small rubber disk (the puck) into the opposing goal with hooked or angled sticks: I play hockey two or three times a week in the winter | [as modifier] : hockey equipment | a hockey team.
          • a game played between two teams of eleven players who use hooked sticks to drive a small hard ball toward goals at opposite ends of a field.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\ude72\ud8fc\udc61\ud8c8\uddf8\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc4.mov"} `L33[k!Mfrost2024/05/30 18:50:542026/05/23 20:17:23AS1bb51S2fe00S1bb3aS2fe00S21400S20800S22a00M522x529S1bb3a494x508S1bb51478x490S20800505x493S22a00489x472M522x530S1ce3a492x508S1ce51478x488S20800502x497S22a00487x471noun a phonological variant (8-hand) of ghost.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d1\ude72\ud8fc\udc61\ud8d1\ude5b\ud8fc\udc61\ud8d9\udf81\ud8d8\udf01\ud8db\udfc1.mov"}pK 335 e!eLfrost2024/05/30 18:44:112026/03/22 19:28:47AS10010S2fe00S14c0aS2fe00S38006S28801M523x527S14c0a478x488S10010508x497S28801499x474verb to go through the years from freshman to senior: we went through all four years together.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc11\ud8fc\udc61\ud8c7\udc8b\ud8fc\udc61\ud8fc\udc07\ud8e4\udf02.mov"}S2ff00482x483S10011518x502S22a05536x527S20320551x543
        noun
        1. (Symbol: Ag) a precious shiny grayish-white metal, the chemical element of atomic number 47.
        2. a shiny gray-white color or appearance like that of silver: the dark hair was now highlighted with silver.
        3. silver dishes, containers, or cutlery: thieves stole $5,000 worth of silver | the family silver.
          • household cutlery of any material: it is important to wash table silver in hot soapy water immediately after each meal.
        4. short for silver medal: she won three silvers.
        adjective
        1. made of or colored like silver: a silver necklace | the car was silver.
        Adam Frost{"video":"dominance: right;\\nletter: abbreviated;\\n\ud8c0\udc12\ud8f4\ude11\u00d8\ud8d8\udde1\ud8db\udfc6\ud8d8\udd41.mov"} ==7M33[=!}Nfrost2024/05/30 19:11:562026/05/23 20:16:05AS1ce51S2fe00S1ce3aS2fe00S21400S20800S22a00M522x530S1ce3a492x508S1ce51478x488S20800502x497S22a00487x471S38b00470x493 M522x529S1bb3a494x508S1bb51478x490S20800505x493S22a00489x472 S38b04470x493noun
        1. the nonphysical part of a person which is the seat of emotions and character; the soul: we seek a harmony between body and spirit.
          • the nonphysical part of a person regarded as their true self and as capable of surviving physical death or separation: a year after he left, his spirit is still present.
          • the nonphysical part of a person manifested as an apparition after their death: a priest performed a rite of exorcism and the wandering spirit was ousted.
          • a supernatural being: shrines to nature spirits.
        2. those qualities regarded as forming the definitive or typical elements in the character of a person, nat eemO 335 /!Pfrost2024/05/31 20:49:072026/09/27 17:10:44AS18210S30000S18218S30000S2e700S2e740S26506S26512M559x5N 33 !)Ofrost2024/05/31 20:46:292026/09/11 05:47:20AS20341S30004S10006S20600M534x530S2ff00482x483S20341489x509S20600512x515
          noun
          1. an instrument for converting sound waves into electrical energy variations which may then be amplified, transmitted, or recorded: please mute your microphone when it's not your turn to speak | I'd never sung with a microphone before my audition.
          Adam Frost{"video":"dominance: right;\\n\ud8d8\udd62\ud8f0\udc05\u00d8\ud8d8\ude41.mov"}i>to watch over in order to protect or control: the gates were guarded by uniformed soldiers | they were sent to guard villagers from attack by bandits.
          • to watch over (someone) to prevent them escaping: his task was to help guard Japanese soldiers.
          • to watch over (someone) to prevent them from escaping: police officers were guarding inmates who could not be accommodated in prison.
          • Basketball to stay close to (an opponent) in order to prevent a good shot, pass, or drive: when a player is so closely guarded he cannot pass the ball.
        3. to protect against damage or harm: the company fiercely guarded its independence.
          • (guard against) [no object] to take precautions against: farmers must guard against sudden changes in the market.
      Adam Frost{"video":"dominance: right;\\nletter: integrated; \ud8d6\ude11\ud8fc\udc61\ud8d6\ude19\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1.mov"} vv8Q 33[ !)Rfrost2024/05/31 20:59:392026/05/10 19:45:17AS14051S2fe00S15a48S2fe00S21400S21100S26500M519x531S15a48482x504S14051488x499S21100495x487S26500495x469Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc52\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e1\udde1.mov"}JP 33g !AQfrost2024/05/31 20:52:312026/05/10 19:44:48AS20340S2fe00S15a39S2fe00S21400S20500S18740S20500M518x531S15a39495x494S20340486x470S18740485x488S20600483x520Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d8\udd61\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8cc\udee1\ud8d8\udde1.mov"} aaR 335 ;!eSfrost2024/05/31 21:07:502026/09/19 21:37:16AS14c20S2fe00S10018S2fe00S21414S20600M520x529S10018490x499S14c20480x471S20600498x496
      adjective
      1. liked, admired, or enjoyed by many people or by a particular person or group: she was one of the most popular girls in the school | these cheeses are very popular in Europe.
        • (of an opinion, belief, or attitude) held by many people: many adult cats, contrary to popular opinion, dislike milk.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udca1\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf95\ud8d8\ude41.mov"} qq S 33A K!)Tfrost2024/05/31 21:11:252026/05/30 01:48:03AS14051S2fe00S2031aS2fe00S21400S2e700S20500M527x520S2031a473x505S14051478x480S2e700512x480noun a planet (noun sense 1a).Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc52\ud8fc\udc61\ud8d8\udd3b\ud8fc\udc61\ud8d9\udf81\ud8ed\udea1\ud8d8\udde1.mov"} T 33C !AUfrost2024/06/01 05:46:422026/10/05 00:52:11AS15a50S38620S10006S21100S26506M532x524S37605469x477S15a50489x497S21100501x488S26506517x488
      adjective
      1. having a flat, level upper surface: the boulder was flat on top.
      noun
      1. a raised level surface on which people or things can stand: there are viewing platforms where visitors may gape at the chasm.
        • a raised floor or stage used by public speakers or performers so that they can be seen by their audience: earning her living on the concert platform.
      Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\ude61\u00d8\ud8d9\ude61\ud8e1\udde7.mov"} &U 33C !!mVfrost2024/06/01 05:48:332026/10/04 23:35:35AS20320S38620S10006S21100S26506M533x516S37605467x484S20320486x497S21100503x497S26506518x497
      noun
      1. a raised floor or platform, typically in a theater, on which actors, entertainers, or speakers perform: there are only two characters on stage.
        • (the stage) the acting or theatrical profession: I've always wanted to go on the stage.
        • [in singular] a scene of action or forum of debate, especially in a particular political context: Argentina is playing a leading role on the international stage.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d8\udd41\ud8fc\ude61\u00d8\ud8d9\ude61\ud8e1\udde7.mov"} ExE</W 33u !}Xfrost2024/06/01 05:53:472026/05/10 19:46:34AS12120S30007S12128S2fe00S20500S21800S21800M535x552S2ff00482x483S12120511x473S12128462x525S21800515x463S21800465x515Adam Frost{"video":"dominance: right;\\n\ud8c3\udc81\ud8f0\udc08\ud8c3\udc89\ud8fc\udc61\ud8d8\udde1\ud8da\udd01\ud8da\udd01.mov"}V 33) =!AWfrost2024/06/01 05:51:042026/09/19 21:03:09AS10620S33200S10006S20500S2b700M518x526S33100482x483S10620489x500S2b700465x497
      noun
      1. a person thought to have magic powers, especially evil ones, popularly depicted as a woman wearing a black cloak and pointed hat and flying on a broomstick.
        • a follower or practitioner of Wicca or of modern witchcraft.
      2. derogatory an ugly or unpleasant woman: he can marry the old witch for all I care.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\ude61\ud8f4\udec1\u00d8\ud8d8\udde1\ud8e9\udca1.mov"} HiH[ 33i !e\frost2024/06/01 06:19:532026/05/10 19:48:08AS14c13S30005S14c1bS30003S27100S27110M547x547S2ff00482x483S14c13517x503S14c1b456x503S27100507x532S27110453x532Adam Frost{"video":"dominance: equal;\\n\ud8c7\udc94\ud8f0\udc06\ud8c7\udc9c\ud8f0\udc04\ud8e2\ude61\ud8e2\ude71.mov"}Z 33i !e[frost2024/06/01 06:14:372026/05/10 19:47:28AS14e20S30006S14e28S30002S26500S26510M544x523S2ff00482x483S14e20519x492S14e28456x492S26500525x474S26510461x474Adam Frost{"video":"dominance: equal;\\n\ud8c7\udd61\ud8f0\udc07\ud8c7\udd69\ud8f0\udc03\ud8e1\udde1\ud8e1\uddf1.mov"}%Y 33O !Zfrost2024/06/01 06:09:462026/09/19 21:08:35AS10011S33010S10006S20500S22a05S20320M566x558X 335 !eYfrost2024/06/01 06:07:262026/05/10 19:46:43AS15a52S2fe00S15a5aS2fe00S38000S26a20M518x526S15a52491x514S15a5a483x494S26a20489x474Adam Frost{"video":"dominance: right;\\n\ud8c8\ude13\ud8fc\udc61\ud8c8\ude1b\ud8fc\udc61\ud8fc\udc01\ud8e1\udfe1.mov"}544x526S10000508x496S10008478x496S24e09522x474S24e11457x474S38b00470x493 M543x537S2ff00482x483S10001507x507S10009473x507S24e09521x485S24e11457x485 S38b04470x493adverb after a long time, typically involving difficulty or delay: he finally arrived to join us.
      verb
      1. (of a plan or method) to have the desired result or effect: the desperate ploy had worked.
      2. [no object] to achieve the desired aim or result: keep trying and you will eventually succeed | he succeeded in winning a pardon | it was a mission that could not possibly succeed.
        • to attain fame, wealth, or social status: the management and business skills you need to succeed.

      PHONOLOGICAL VARIANTS
      finally with chin contactAdam Frost{"video":"dominance: equal;\\n\ud8c0\udc01\ud8fc\udc61\ud8c0\udc09\ud8fc\udc61\ud8fc\udc07\ud8df\udd4a\ud8df\udd52.mov"} 34:3_ 335 !e`frost2024/06/03 16:12:032026/05/10 19:48:55AS15a11S2fe00S15a19S2fe00S21414S20600M512x518S15a19488x482S15a11489x482S20600489x507Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8fc\udc61\ud8c8\uddda\ud8fc\udc61\ud8d9\udf95\ud8d8\ude41.mov"}v^ 33 !e_frost2024/06/03 16:09:462026/09/02 20:39:17AS15a11S2fe00S15a19S2fe00S21414S20500M512x512S15a19488x489S15a11489x489Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8fc\udc61\ud8c8\uddda\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1.mov"}b] 33 !U^frost2024/06/03 16:07:262026/05/10 19:48:35AS18d20S2fe00S10006S2e508M512x528S18d20488x472S2e508489x501Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\udd01\ud8fc\udc61\u00d8\ud8ed\udde9.mov"}b\ 33 !U]frost2024/06/03 16:06:222026/05/10 19:48:26AS14720S2fe00S10006S2e508M512x527S14720493x474S2e508489x500Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udec1\ud8fc\udc61\u00d8\ud8ed\udde9.mov"} E"EYc 33 !)dfrost2024/06/03 16:33:282026/05/10 19:50:40AS1f510S30006S10006S26a04M545x527S2ff00482x483S1f510524x495S26a04518x513Adam Frost{"video":"dominance: right;\\n\ud8d6\udff1\ud8f0\udc07\u00d8\ud8e1\udfc5.mov"}Yb 33 !)cfrost2024/06/03 16:31:332026/05/10 19:50:30AS1f510S30006S10006S26504M539x528S2ff00482x483S1f510524x495S26504525x513Adam Frost{"video":"dominance: right;\\n\ud8d6\udff1\ud8f0\udc07\u00d8\ud8e1\udde5.mov"}a 335 !ebfrost2024/06/03 16:27:312026/05/10 19:49:09AS20311S2fe00S20319S2fe00S21414S20600M516x518S20319495x483S20311485x483S20600490x507Adam Frost{"video":"dominance: right;\\n\ud8d8\udd32\ud8fc\udc61\ud8d8\udd3a\ud8fc\udc61\ud8d9\udf95\ud8d8\ude41.mov"}v` 33 !eafrost2024/06/03 16:15:372026/09/02 20:39:28AS20311S2fe00S20319S2fe00S21414S20500M516x511S20319495x490S20311485x490Adam Frost{"video":"dominance: right;\\n\ud8d8\udd32\ud8fc\udc61\ud8d8\udd3a\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1.mov"}  e 33O c!ffrost2024/06/03 16:37:102026/05/04 04:00:44AS16d20S2fe00S10006S1dc20S1f720S19a20M515x549S16d20493x452S1dc20485x476S1f720489x510S19a20487x529noun a stiff, sticky fine-grained earth, typically yellow, red, or bluish-gray in color and often forming an impermeable layer in the soil. It can be molded when wet, and is dried and baked to make bricks, pottery, and ceramics.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8ca\udd01\ud8fc\udc61\u00d8\ud8d4\udea1\ud8d7\udcc1\ud8ce\udde1.mov"}d 33) !oefrost2024/06/03 16:36:092026/05/10 19:50:55AS1f720S2fe00S10006S11a20S18d20M510x539S1f720490x461S11a20495x480S18d20490x514Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8c2\udde1\ud8cd\udd01.mov"} G+dG+h 335 !ifrost2024/06/03 16:48:152026/05/10 19:51:51AS1f010S2fe00S1f018S2fe00S21414S20600M527x518S1f018498x483S1f010473x489S20600489x507Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d6\ude11\ud8fc\udc61\ud8d6\ude19\ud8fc\udc61\ud8d9\udf95\ud8d8\ude41.mov"};g 33 m! hfrost2024/06/03 16:41:182026/09/02 20:20:11AS1f010S2fe00S1f018S2fe00S21414S20500M527x511S1f018498x490S1f010473x496
      verb [with object]
        noun material made from clay hardened by heat: tableware in ceramic.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8ca\udd01\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8c2\udde1\ud8d7\udcc1\ud8cd\udd01\ud8cd\udee1\ud8ca\udd01.mov"}S37600488x496S20301474x481S20309505x481S20500480x504S20500511x504verb [with object] to feel deep affection for (someone): he loved his sister dearly | there were four memorial pages set up by her friends in honor of Phoebe, saying how much they loved and missed her.
        • feel a deep romantic or sexual attachment to (someone): she really loved him | I do realize that people get married because they love each other.
        noun an intense feeling of deep affection: babies fill parents with feelings of love | their love for their country.
        • a feeling of deep romantic or sexual attachment to someone: it was love at first sight | [as modifier] : love songs.
        • affectionate greetings conveyed to someone on one's behalf: give her my love.
        Adam Frost{"video":"dominance: right;\\n\ud8d8\udd22\ud8fc\uddf2\ud8d8\udd2a\ud8fc\uddf8\ud8d8\udde1\ud8d8\udde1.mov"} zzJj 33g !Akfrost2024/06/03 16:58:082026/05/10 19:52:15AS18d51S2fe00S15a38S2fe00S21400S20500S26500S20500M520x519S15a38481x485S18d51486x499S26500506x487S20500495x481Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\udd32\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udde1\ud8d8\udde1.mov"}4i 33g !jfrost2024/06/03 16:54:142026/05/11 22:28:49AS10020S2fe00S15a38S2fe00S21400S22a04S18251S20500M515x536S15a38485x509S10020498x465S22a04499x498S18251491x516Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8d9\udf81\ud8db\udfc5\ud8cc\udd12\ud8d8\udde1.mov"} p8"m 33[ !}nfrost2024/06/03 17:18:592026/05/10 19:53:16AS15a50S2fe00S15a48S2fe00S21406S20e00S28804M520x528S15a48481x473S15a50494x481S20e00494x510S28804508x506Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8e4\udf05.mov"}4l 33g !mfrost2024/06/03 17:07:302026/05/10 19:53:09AS18550S2fe00S15a37S2fe00S21400S20500S24b3aS14c50M546x517S15a37454x483S18550462x497S24b3a490x494S14c50522x486Adam Frost{"video":"dominance: right;\\n\ud8cc\ude31\ud8fc\udc61\ud8c8\uddf8\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8df\udc5b\ud8c7\udcd1.mov"} k 33g !Elfrost2024/06/03 17:01:042026/05/10 19:52:44AS15a02S38517S15a0aS38511S20500S20500S22a04S22a14S20500S20500M532x529S15a02505x471S15a0a469x471S20500509x486S20500482x486S22a04508x500S22a14481x500S20500510x518S20500482x518Adam Frost{"video":"dominance: equal;\\n\ud8c8\uddc3\ud8fc\uddf8\ud8c8\uddcb\ud8fc\uddf2\ud8d8\udde1\ud8d8\udde1\ud8db\udfc5\ud8db\udfd5\ud8d8\udde1\ud8d8\udde1.mov"}  p 33O !Yqfrost2024/06/03 20:06:202026/05/10 19:53:43AS1a521S30007S10006S20500S26500S14c20M538x518S2ff00482x483S1a521510x485S26500519x468S14c20515x434Adam Frost{"video":"dominance: right;\\n\ud8cf\ude02\ud8f0\udc08\u00d8\ud8d8\udde1\ud8e1\udde1\ud8c7\udca1.mov"} o 33O !Ypfrost2024/06/03 20:00:182026/05/10 19:53:36AS14c21S30007S10006S20500S26500S17620M540x518S2ff00482x483S14c21513x484S26500516x466S17620515x447Adam Frost{"video":"dominance: right;\\n\ud8c7\udca2\ud8f0\udc08\u00d8\ud8d8\udde1\ud8e1\udde1\ud8cb\udc61.mov"}"n 33[ !}ofrost2024/06/03 17:24:582026/05/10 19:53:25AS10050S2fe00S15a0aS2fe00S21414S20e00S2330bM514x537S15a0a487x464S10050493x469S20e00494x501S2330b488x515Adam Frost{"video":"dominance: right;\\n\ud8c0\udc51\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8dc\udf2c.mov"} q 33A !}rfrost2024/06/03 20:08:442026/05/10 19:53:53AS15a40S2fe00S15a0aS2fe00S21414S26500S20500M514x526S15a0a487x475S15a40494x480S26500493x511Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf95\ud8e1\udde1\ud8d8\udde1.mov"} dYr 33K !isfrost2024/06/03 20:13:502025/07/19 17:46:50AS10001S33200S10006S20500S10002S2fe00S1000aS2fe00S21406S20500S26506S26512M550x558S33100482x483S10001503x504S10002501x543S1000a469x543S26506535x543S26512450x543noun a damaging immune response by the body to airborne substances, such as pollen, dust, or fur, typically resulting in nasal or respiratory symptoms due to hypersensitivity.
        • a similar response by the body to a particular food.
        adjective caused by or relating to an allergy: an allergic reaction to penicillin.
        • having an allergy to a substance: Heather was allergic to the sting of bees.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc02\ud8f4\udec1\u00d8\ud8d8\udde1\ud8c0\udc03\ud8fc\udc61\ud8c0\udc0b\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\udde7\ud8e1\uddf3.mov"} s 33 y!)tfrost2024/06/03 20:16:072025/07/12 18:01:38AS10001S33200S10006S20500M524x534S33100482x483S10001503x504noun the part projecting above the mouth on the face of a person or animal, containing the nostrils and used for breathing and smelling: he slowly breathed out the air through his nose | he pushed his glasses higher onto the bridge of his nose | the dog pressed his nose into the palm of my hand.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc02\ud8f4\udec1\u00d8\ud8d8\udde1.mov"}  u 33) !ovfrost2024/06/03 20:18:432026/05/10 19:54:08AS1dc20S2fe00S10006S14a20S1f000M515x534S1dc20491x466S14a20500x500S1f000486x519Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8d6\ude01.mov"}at 33u M!ufrost2024/06/03 20:17:312026/05/04 04:01:19AS20320S2fe00S10006S1fb20S19220S1ce20S1ce20M511x565S20320490x436S1fb20490x455S19220490x478S1ce20489x501S1ce20489x535adjective not easily bent or changed in shape; rigid: a stiff black collar | stiff cardboard.
        • not moving as freely as is usual or desirable; difficult to turn or operate: a stiff drawer | the faucet in the shower is a little stiff.
        • (of a person or part of the body) unable to move easily and without pain: he was stiff from sitting on the desk | a stiff back.
        Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8d7\ude41\ud8cd\udee1\ud8d3\udd61\ud8d3\udd61.mov"} fv33A=)!Owfrost2024/06/03 20:19:572026/05/04 04:01:43AS14051S2fe00S10006S1dc20S1f720S20320S1fb20S19220S16d20M517x583S14051483x417S1dc20487x445S1f720491x479S20320496x498S1fb20496x517S19220496x540S16d20495x563S38b00470x493 M536x556S2ff00482x483S14051505x507S20e00494x530S22f03480x535 S38b04470x493noun a synthetic material made from a wide range of organic polymers such as polyethylene, PVC, nylon, etc., that can be molded into shape while soft and then set into a rigid or slightly elastic form: bottles can be made from a variety of plastics.
        adjective made of plastic: plastic bottles.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udc52\ud8fc\udc61\u00d8\ud8d4\udea1\ud8d7\udcc1\ud8d8\udd41\ud8d7\ude41\ud8cd\udee1\ud8ca\udd01.mov"} eaexx 33C !Ayfrost2024/06/03 20:26:182026/05/10 19:54:29AS14c11S30004S10006S20e00S26a06M524x538S2ff00482x483S14c11468x504S20e00495x519S26a06510x511Adam Frost{"video":"dominance: right;\\n\ud8c7\udc92\ud8f0\udc05\u00d8\ud8d9\udd41\ud8e1\udfc7.mov"}w 33) k!Axfrost2024/06/03 20:22:572025/03/20 02:20:22AS14c52S38404S10006S20500S22512M518x535S2ff00482x483S14c52470x511S22512456x512adjective covered or marked with an unclean substance: a tray of dirty cups and saucers | her boots were dirty.
        • causing a person or environment to become unclean: farming is a hard, dirty job.
        • concerned with sex in an unpleasant or obscene way: he told a stream of dirty jokes.
        • (of an activity) dishonest; dishonorable: he had a reputation for dirty dealing.
        Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd3\ud8fc\udd85\u00d8\ud8d8\udde1\ud8db\uddf3.mov"} r[z 335 !{frost2024/06/03 20:35:142026/05/10 19:55:08AS20310S33d00S20318S33d00S26506S26512S16d10S16d18M550x527S2ff00482x483S20318486x504S20310496x510S26506514x511S26512467x506S16d10533x507S16d18446x502Adam Frost{"video":"dominance: right;\\n\ud8d8\udd31\ud8f5\udee1\ud8d8\udd39\ud8f5\udee1\ud8e1\udde7\ud8e1\uddf3\ud8ca\udcf1\ud8ca\udcf9.mov"} y 33M ![zfrost2024/06/03 20:30:582026/05/10 19:54:46AS1f510S30006S10006S26504S19a20S2fe00S10006S1f720S11a20S10120M539x639S2ff00482x483S1f510524x493S26504525x511S19a20486x532S1f720488x556S11a20493x575S10120493x609Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d6\udff1\ud8f0\udc07\u00d8\ud8e1\udde5\ud8ce\udde1\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8c2\udde1\ud8c0\udc81.mov"} ?"~ 33[ !}frost2024/06/03 20:54:142026/05/10 19:55:59AS10640S2fe00S15a0aS2fe00S21414S20e00S22a04M517x522S15a0a484x478S10640485x491S20e00504x492S22a04504x507Adam Frost{"video":"dominance: right;\\n\ud8c0\ude81\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8db\udfc5.mov"}Y} 33 !)~frost2024/06/03 20:49:452026/05/10 19:55:50AS1f710S30007S10006S26a04M546x518S2ff00482x483S1f710521x482S26a04519x500Adam Frost{"video":"dominance: right;\\n\ud8d7\udcb1\ud8f0\udc08\u00d8\ud8e1\udfc5.mov"}Y| 33 !)}frost2024/06/03 20:47:302026/05/10 19:55:43AS14e01S30007S10006S26a04M547x522S2ff00482x483S14e01519x478S26a04520x508Adam Frost{"video":"dominance: right;\\n\ud8c7\udd42\ud8f0\udc08\u00d8\ud8e1\udfc5.mov"}{ 335 !e|frost2024/06/03 20:39:532026/05/10 19:55:22AS11001S2fe00S11009S2fe00S21414S20600M524x520S11009496x481S11001477x481S20600490x509Adam Frost{"video":"dominance: right;\\n\ud8c1\ude02\ud8fc\udc61\ud8c1\ude0a\ud8fc\udc61\ud8d9\udf95\ud8d8\ude41.mov"} {{33'#5!-frost2024/06/05 16:20:402026/06/17 17:05:28AS1bb10S2fe00S1bb18S2fe00S38006S26500S26510S14c40S14c48M533x541S1bb10508x513S1bb18471x513S26500514x496S26510472x496S14c40509x460S14c48467x460S38b00470x493 M513x541S1bb10488x513S14c40489x460S26500494x496 S38b04470x493adjective very bad or unpleasant: the place smelled awful | I look awful in a swimsuit | an awful speech.
        • extremely shocking: awful, bloody images.
        • (of a person) very unwell, troubled, or unhappy: I felt awful for being so angry with him | you look awful—you should go and lie down.

        PHONOLOGICAL VARIANTS
        awful right-handedAdam Frost{"video":"dominance: right;\\n\ud8d1\ude31\ud8fc\udc61\ud8d1\ude39\ud8fc\udc61\ud8fc\udc07\ud8e1\udde1\ud8e1\uddf1\ud8c7\udcc1\ud8c7\udcc9.mov"} Y 33 !)frost2024/06/05 16:33:522026/05/10 19:56:29AS15400S33200S10006S2a400M547x528S33100482x483S15400503x498S2a400522x492Adam Frost{"video":"dominance: right;\\n\ud8c7\udf81\ud8f4\udec1\u00d8\ud8e7\udd81.mov"} 33A !}frost2024/06/05 16:27:032026/05/10 19:56:22AS1c550S2fe00S15a39S2fe00S21400S2e736S20500M520x524S15a39480x496S1c550490x496S2e736493x477Adam Frost{"video":"dominance: right;\\n\ud8d2\ude31\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8ed\uded7\ud8d8\udde1.mov"} 33A !}frost2024/06/05 16:23:592026/05/10 19:56:14AS18250S2fe00S15a39S2fe00S21400S2e736S20500M525x517S15a39475x489S18250483x502S2e736500x483Adam Frost{"video":"dominance: right;\\n\ud8cc\udd11\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8ed\uded7\ud8d8\udde1.mov"} qq8 33[ !)frost2024/06/05 17:01:112026/05/10 20:18:47AS10110S2fe00S15a1aS38615S20500S29902S20500M527x536S15a1a500x524S37800517x492S10110505x465S29902474x491Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c0\udc71\ud8fc\udc61\ud8c8\udddb\ud8fc\ude56\ud8d8\udde1\ud8e6\udd63\ud8d8\udde1.mov"}) 33u !qfrost2024/06/05 16:52:342026/05/10 19:57:26AS10011S30007S10006S20500S26500S1f540S2a408M557x520S2ff00482x483S10011507x490S26500513x479S1f540512x452S2a408532x443Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f0\udc08\u00d8\ud8d8\udde1\ud8e1\udde1\ud8d7\udc21\ud8e7\udd89.mov"}" 33[ !}frost2024/06/05 16:40:092026/05/10 19:57:04AS15420S2fe00S15428S2fe00S38006S29508S29510M528x530S15420513x505S15428473x505S29508513x470S29510475x471Adam Frost{"video":"dominance: right;\\n\ud8c7\udfa1\ud8fc\udc61\ud8c7\udfa9\ud8fc\udc61\ud8fc\udc07\ud8e5\udfe9\ud8e5\udff1.mov"} ::` 33' !-frost2024/06/05 17:40:122026/05/10 20:19:22AS14c12S2fe00S14c1aS2fe00S38006S22512S22516S26506S26512M566x512S14c12517x489S14c1a452x489S22512501x489S22516486x489S26506551x493S26512434x493Adam Frost{"video":"dominance: equal;\\n\ud8c7\udc93\ud8fc\udc61\ud8c7\udc9b\ud8fc\udc61\ud8fc\udc07\ud8db\uddf3\ud8db\uddf7\ud8e1\udde7\ud8e1\uddf3.mov"}8 33[ !)frost2024/06/05 17:32:192026/05/10 20:19:08AS10120S2fe00S15a0aS2fe00S21414S20e00S2330bM514x536S15a0a487x486S10120491x464S20e00493x500S2330b487x514Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c0\udc81\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8dc\udf2c.mov"}" 33[ !}frost2024/06/05 17:05:462026/05/10 20:18:55AS18510S2fe00S15a1aS38615S20500S29902S20500M528x530S15a1a501x518S37800518x486S18510495x471S29902473x480Adam Frost{"video":"dominance: right;\\n\ud8cc\uddf1\ud8fc\udc61\ud8c8\udddb\ud8fc\ude56\ud8d8\udde1\ud8e6\udd63\ud8d8\udde1.mov"} 66҅J 33O !Yfrost2024/06/05 17:46:542025/07/12 17:58:42AS10001S31410S10006S20500S26502S20500M528x534S31400482x483S10001507x501S26502490x520S20500477x521noun the pair of globular organs in the head through which people and vertebrate animals see, the visible part typically appearing almond-shaped in animals with eyelids: my cat is blind in one eye | closing her eyes, she tried to relax.
        • the corresponding visual or light-detecting organs of many invertebrate animals.
        • the region of the face surrounding the eyes: her eyes were swollen with crying.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc02\ud8f1\udf91\u00d8\ud8d8\udde1\ud8e1\udde3\ud8d8\udde1.mov"}x 33C !Afrost2024/06/05 17:44:592026/05/10 20:19:32AS1ea20S33010S10006S20800S27106M555x537S33010479x483S1ea20514x503S20800523x495S27106540x497Adam Frost{"video":"dominance: right;\\n\ud8d5\udfe1\ud8f4\ude11\u00d8\ud8d8\udf01\ud8e2\ude67.mov"} nnO33[W!}frost2024/06/05 18:44:112026/05/23 20:20:23AS10000S2fe00S10008S2fe00S38006S24e09S24e11Mk 33) !Afrost2024/06/05 18:36:182026/05/10 20:20:18AS1f730S2fe00S10006S26506S14430M530x516S1f730470x501S26506493x502S14430508x485Adam Frost{"video":"dominance: right;\\n\ud8d7\udcd1\ud8fc\udc61\u00d8\ud8e1\udde7\ud8c6\uddb1.mov"}k 33) !Afrost2024/06/05 18:17:122026/05/10 20:20:10AS1ce02S33200S10006S20500S2c600M518x530S33100482x483S1ce02478x506S2c600461x504Adam Frost{"video":"dominance: right;\\n\ud8d3\udd43\ud8f4\udec1\u00d8\ud8d8\udde1\ud8ea\ude41.mov"}A 33 !frost2024/06/05 17:50:082026/05/10 20:19:59AS10004S2fe00S1000cS2fe00S38006S22a04S22a14S2fd04M524x530S10004509x471S1000c477x483S22a04511x503S22a14478x515S2fd04494x521Adam Frost{"video":"dominance: right;\\n\ud8c0\udc05\ud8fc\udc61\ud8c0\udc0d\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5\ud8ef\udee5.mov"}510noun either of two equal or corresponding parts into which something is or can be divided: two and a half years | the northern half of the island | divide the cake in half | spending was reduced by half.
        • either of two equal periods of time into which a sports game or a performance is divided.
        predeterminer, pronoun, adjective an amount equal to a half: [as predeterminer] : almost half the children turned up | [as pronoun] : half of the lectures are delivered by him | [as adjective] : the last half century.
        • an amount thought of as roughly a half: [as pronoun] : half of them are gatecrashers | [as predeterminer] : half the letters were sent first class.
        adverb to the extent of half: the glass was half full.
        • [often in combination] to a certain extent; partly: the chicken is half-cooked.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8fc\udc61\u00d8\ud8db\udfc5\ud8c1\udd41.mov"} c0cs 33i !efrost2024/06/05 18:55:432026/05/19 20:38:36AS20301S38511S20309S38517S20500S20500M526x519Z 33C O!Afrost2024/06/05 18:52:372025/02/20 17:31:52AS1f700S30004S10006S21100S27102M518x541S2ff00482x483S1f700492x511S21100476x514S27102458x501noun
        1. (also table napkin) a square piece of cloth or paper used at a meal to wipe the fingers or lips and to protect garments, or to serve food on: she unfolded her napkin and put it on her lap.
        2. a piece of cloth for a particular purpose, such as a dishcloth or a tablecloth: wipe clean with a damp cloth.
        Adam Frost{"video":"dominance: right;\\n\ud8d7\udca1\ud8f0\udc05\u00d8\ud8d9\ude61\ud8e2\ude63.mov"}L 33 !)frost2024/06/05 18:50:262026/05/10 20:20:25AS1821dS2fe00S10006S26504M513x518S1821d488x483S26504495x503Adam Frost{"video":"dominance: right;\\n\ud8cc\udcde\ud8fc\udc61\u00d8\ud8e1\udde5.mov"}e informed that no risk was involved | [no object] : the role of television is to inform and entertain.
        • [no object] to give incriminating information about someone to the police or other authority: people called a confidential hotline to inform on friends, neighbors, and family members.
      1. [with object] to give an essential or formative principle or quality to: the relationship of the citizen to the state is informed by the democratic ideal.
      noun information.

      PHONOLOGICAL VARIANTS
      inform with right hand

      DERIVATIVES
      information [frequentative]Adam Frost{"video":"dominance: right;\\n\ud8cc\ude18\ud8f0\udc08\ud8cc\ude20\ud8fc\udc61\ud8d8\udde1\ud8e1\udde1\ud8e1\uddf1\ud8c7\udcb1\ud8c7\udcb9.mov"}  33) 7!Afrost2024/06/05 19:01:272026/05/19 20:41:38AS10000S2fe00S10006S22a04S10e00M508x540S10000493x460S22a04494x493S10e00493x҂` 33' !-frost2024/06/05 18:58:462026/05/10 20:20:56AS1bb40S2fe00S1bb48S2fe00S38006S26500S26510S14c40S14c48M533x541S1bb40508x513S1bb48471x513S26500514x496S26510472x496S14c40509x460S14c48467x460Adam Frost{"video":"dominance: equal;\\n\ud8d1\ude61\ud8fc\udc61\ud8d1\ude69\ud8fc\udc61\ud8fc\udc07\ud8e1\udde1\ud8e1\uddf1\ud8c7\udcc1\ud8c7\udcc9.mov"} pursue and kill (a wild animal) for sport or food: in the autumn they hunted deer | [no object] : they hunted and fished.
      • (of an animal) to chase and kill (its prey): mice are hunted by weasels and foxes | [no object] : lionesses hunt in groups.
    2. [no object] to search determinedly for someone or something: he desperately hunted for a new job.
      • [with object] (of the police) to search for (a criminal): the gang is being hunted by police | [no object] : police are hunting for her attacker.
    noun
    1. an act of hunting wild animals or game: a bear-hunt.
      • an association of people who meet regularly to hunt, especially with hounds.
      • an area where hunting takes place.
    2. a search: police launched a hunt for the killer.
    Adam Frost{"video":"dominance: right;\\n\ud8c4\udd21\ud8fc\udc61\ud8c4\udd29\ud8fc\udc61\ud8fc\udc08\ud8dc\ude05\ud8dc\ude15.mov"} u 33 C!)frost2024/06/05 19:04:272026/10/09 20:33:22AS10611S30007S10006S26a04M545x525S2ff00482x483S10611519x480S26a04518x511
    verb [with object and at right side of head locus]
    1. to apply (liquid) to someone or something in the form of a shower of tiny drops: the product can be sprayed onto wet or dry hair.
      • sprinkle or cover (someone or something) with a shower of tiny drops of liquid: she sprayed herself with the hair product.
    noun
    1. a solution sprayed on to a person's hair to keep it in place: hairspray is a versatile styling product | [count noun] : the new hairsprays come in aerosol and nonaerosol spray.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\ude52\ud8f0\udc08\u00d8\ud8e1\udfc5.mov"} j 335kY!frost2024/06/05 19:07:502026/10/09 20:08:09AS20301S2fe00S20309S2fe00S21405S20600M523x519S20301484x498S20309478x482S20600501x491M519x524S20301488x492S20309482x476S22a01506x510
    verb, noun, adjective [in isolation]
    1. support.
    Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d8\udd22\ud8fc\udc61\ud8d8\udd2a\ud8fc\udc61\ud8d9\udf86\ud8d8\ude41.mov"} _ 33[ !}frost2024/06/05 19:11:062026/06/23 16:54:08AS15440S2fe00S15448S2fe00S38006S2880aS28812M549x513S15440508x488S15448478x488S2880a527x494S28812452x494determiner a great amount or quantity of: I didn't get much sleep | there's so much traffic | we should see lots of sun and not much rain over the next few days | did you get much time to rehearse?.
    pronoun a great amount or quantity: he doesn't eat much | they must bear much of the blame | I still have so much to do | the company has already done much to improve security.
    adverb to a great extent; a great deal: did it hurt much? | thanks very much | they did not mind, much to my surprise | they look much better.Adam Frost{"video":"dominance: equal;\\n\ud8c7\udfc1\ud8fc\udc61\ud8c7\udfc9\ud8fc\udc61\ud8fc\udc07\ud8e4\udf0b\ud8e4\udf13.mov"}2fe00S38006S22a04S22a14S1853dS18535M538x592S2ff00482x483S15a10517x487S14c31506x529S14c39468x529S22a04519x558S22a14468x558S1853d511x573S18535462x573M553x544S2ff00482x483S15410538x487S15418520x517S26a02521x487S26a16538x517 M529x518S2ff00482x483S15a10517x487 M538x532S14c31506x469S14c39468x469S22a04518x499S22a14468x499S1853d511x513S18535462x513
    noun
    1. a pillow.
    ORIGIN
    a compound of bed and soft (adjective sense 3).
    Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c8\uddd1\ud8f0\udc07\u00d8\ud8d8\udde1\ud8c7\udcb2\ud8fc\udc61\ud8c7\udcba\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5\ud8cc\ude1e\ud8cc\ude16.mov"} p33A!{!-frost2024/06/05 19:22:372026/08/06 19:31:33AS18537S30007S1853fS2fe00S20500S26500S26510S14c30S14c38M536x540S2ff00482x483S18537516x488S1853f460x513S26500518x473S26510463x498S14c30512x440S14c38459x465S38b00470x493 M536x518S2ff00482x483S18537516x488S26500518x473S14c30512x440 S38b04470x493 S38a00464x490 M538x540S2ff00482x483S18537516x488S1853f456x513S26a00511x472S26a10453x497S14c30512x440S14c38455x465verb [to front locus]
    1. [reporting verb] to give (someone) facts or information: [with object] : he wrote to her, informing her of the situation | [with object and clause] : they wer yy33ASo!-frost2024/06/05 19:24:322026/06/09 17:40:01AS18537S30007S1853fS2fe00S20500S26a00S26a10S14c30S14c38M538x540S2ff00482x483S18537516x488S1853f456x513S26a00511x472S26a10453x497S14c30512x440S14c38455x465M536x540S2ff00482x483S18537516x488S1853f460x513S26500518x473S26510463x498S14c30512x440S14c38459x465noun [frequentative]
      1. facts informed or learned about something or someone: a vital piece of information.
      2. what is conveyed or represented by a particular arrangement or sequence of things: genetically transmitted information.
        • Computing data as processed, stored, or transmitted by a computer.
      Adam Frost{"video":"dominance: right;\\n\ud8cc\ude18\ud8f0\udc08\ud8cc\ude20\ud8fc\udc61\ud8d8\udde1\ud8e1\udfc1\ud8e1\udfd1\ud8c7\udcb1\ud8c7\udcb9.mov"} " 33[ !}frost2024/06/06 21:49:212026/05/10 20:22:26AS17150S2fe00S17158S2fe00S38006S2b704S2b715M521x524S17150503x477S17158479x477S2b704505x500S2b715481x500Adam Frost{"video":"dominance: equal;\\n\ud8ca\udeb1\ud8fc\udc61\ud8ca\udeb9\ud8fc\udc61\ud8fc\udc07\ud8e9\udca5\ud8e9\udcb6.mov"}z33OS!{frost2024/06/05 19:27:472026/08/06 19:31:14AS18537S30007S10006S20500S26500S14c30M536x518S2ff00482x483S18537516x488S26500518x473S14c30512x440M536x540S2ff00482x483S18537516x488S1853f460x513S26500518x473S26510463x498S14c30512x440S14c38459x465verb, noun a phonological variant (right hand) of inform.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8cc\ude18\ud8f0\udc08\u00d8\ud8d8\udde1\ud8e1\udde1\ud8c7\udcb1.mov"} }~ 33? !Qfrost2024/06/06 23:13:062026/05/10 20:22:50AS17150S2fe00S17158S2fe00S38006S2b704S2b715S14c50S2fe00S10006S2e732M521x552S17150503x448S17158479x448S2b704505x471S2b715481x471S14c50489x501S2e732488x536Adam Frost{"video":"dominance: right;\\n\ud8ca\udeb1\ud8fc\udc61\ud8ca\udeb9\ud8fc\udc61\ud8fc\udc07\ud8e9\udca5\ud8e9\udcb6\ud8c7\udcd1\ud8fc\udc61\u00d8\ud8ed\uded3.mov"} 33M !Efrost2024/06/06 23:07:422026/05/10 20:22:35AS17150S2fe00S17158S2fe00S38006S2b704S2b715S26526S2b704S2b715M549x524S17150475x477S17158451x477S2b704477x500S2b715453x500S26526494x505S2b704535x500S2b715511x500Adam Frost{"video":"dominance: right;\\n\ud8ca\udeb1\ud8fc\udc61\ud8ca\udeb9\ud8fc\udc61\ud8fc\udc07\ud8e9\udca5\ud8e9\udcb6\ud8e1\ude07\ud8e9\udca5\ud8e9\udcb6.mov"} c8cI 33[ Y!}frost2024/06/06 23:38:392026/05/19 20:42:24AS12d40S2fe00S12d48S2fe00S38007S23004S23014M528x536S12d40505x464S12d48473x485S23004500x497S23014476x518verb
      1. [with object] toւ 33M !Efrost2024/06/06 23:29:442026/05/10 20:23:58AS15401S38507S15409S38501S20500S20500S26500S26510S20301S20309M539x533S36d00479x508S15401515x510S15409461x510S26500521x492S26510465x492S20301518x468S20309461x468Adam Frost{"video":"dominance: equal;\\n\ud8c7\udf82\ud8fc\udde8\ud8c7\udf8a\ud8fc\udde2\ud8d8\udde1\ud8d8\udde1\ud8e1\udde1\ud8e1\uddf1\ud8d8\udd22\ud8d8\udd2a.mov"}A 33 !frost2024/06/06 23:18:112026/05/10 20:23:29AS15a01S2fe00S15a09S2fe00S21414S20e00S2ea0cS2ea40M523x528S15a09484x473S15a01495x481S20e00494x509S2ea0c508x503S2ea40477x503Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc2\ud8fc\udc61\ud8c8\uddca\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8ed\udfcd\ud8ee\udc01.mov"} physically demanding tasks; lacking physical strength and energy: she was recovering from the flu and was very weak.
        • lacking political or social power or influence: the central government had grown too weak to impose order | (the weak as plural noun) : the new king used his powers to protect the weak.
        • (of a crew, team, or army) containing too few members or members of insufficient quality: their problems arose from fielding weak teams in league matches.
        • (of a faculty or part of the body) not able to fulfill its functions properly: he had a weak stomach.
        • of a low standard; performing or performed badly: the choruses on this recording are weak.
        • not convincing or logically forceful: the argument is an extremely weak one | a weak plot.
      2. liable to break or give way under pressure; easily damaged: the salamander's tail may be broken off at a weak spot near the base.
          Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx~}~ DD|! 33C !Afrost2024/06/07 15:05:572026/10/09 17:03:02AS18241S38517S10006S20e00S22f04M542x525S36d00479x477S18241517x475S20e00513x496S22f04507x511
          noun
          1. a material made from the skin of an animal by tanning or a similar process: [as modifier] : a leather jacket.
            • (leathers) leather clothes, especially those worn by a motorcyclist: he was dressed head to toe in black leathers.
          2. a piece of leather as a polishing cloth.
          Adam Frost{"video":"dominance: right;\\n\ud8cc\udd02\ud8fc\uddf8\u00d8\ud8d9\udd41\ud8dc\udda5.mov"}8 33[ !)frost2024/06/06 23:48:492026/05/10 20:25:00AS19220S2fe00S2035aS2fe00S21414S20e00S27102M527x521S2035a490x506S19220506x490S20e00491x492S27102474x479Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\udee1\ud8fc\udc61\ud8d8\udd7b\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8e2\ude63.mov"} jP" 335k!frost2024/06/07 15:08:352026/10/09 17:16:38AS1dc50S2fe00S15a48S2fe00S21406S20600M518x522S15a48483x481S1dc50494x478S20600487x511M523x516S15a39500x493S1dc52486x484S20600477x503
          noun
          1. a follower of Martin Luther.
            • a member of the Lutheran Church.
          adjective
          1. of or characterized by the theology of Martin Luther.
            • relating to the Lutheran Church.
          PHONOLOGICAL VARIANTS
          Lutheran with base hand palm facing up
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d4\uded1\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"} "$ 33[ !}frost2024/06/07 15:24:072026/05/10 20:36:31AS15450S2fe00S15438S2fe00S38006S28809S28819M526x525S15450504x500S15438474x500S28809506x476S28819479x476Adam Frost{"video":"dominance: right;\\n\ud8c7\udfd1\ud8fc\udc61\ud8c7\udfb9\ud8fc\udc61\ud8fc\udc07\ud8e4\udf0a\ud8e4\udf1a.mov"}# 33i !efrost2024/06/07 15:17:022026/05/10 20:36:17AS18507S30006S1850fS30002S2503cS25044M531x564S2ff00482x483S18507511x497S1850f470x497S2503c509x528S25044469x528Adam Frost{"video":"dominance: right;\\n\ud8cc\udde8\ud8f0\udc07\ud8cc\uddf0\ud8f0\udc03\ud8df\ude3d\ud8df\ude45.mov"} ""Z% 33 !)frost2024/06/07 15:30:012025/07/13 22:15:35AS10001S33d00S10006S2e306M538x544S33b00482x483S10001517x510S2e306489x521noun the opening in the lower part of the human face, surrounded by the lips, through which food is taken in and from which speech and other sounds are emitted: Ben stood transfixed with disbelief, his mouth open | he leaned over and kissed her on the mouth | she could have bitten her tongue the moment the words left her mouth.
          • the opening through which an animal takes in food, corresponding to the human mouth: the carp picks up the bait by sucking it into its mouth.
          Adam Frost{"video":"dominance: right;\\n\ud8c0\udc02\ud8f5\udee1\u00d8\ud8ed\udd27.mov"} MM/& 33 7!)frost2024/06/07 15:35:052026/10/09 18:11:01AS18241S38603S10006S20600M515x534S37606485x466S18241487x468S20600489x488
          noun
          1. a band or bundle of fibrous tissue in a human or animal body that has the ability to contract, producing movement in or maintaining the position of parts of the body: the calf muscle | the sheet of muscle between the abdomen and chest.
            • a band or bundle of tissue when well developed or prominently visible under the skin: showing off our muscles to prove how strong we were.
          2. physical power; strength: he had muscle but no brains.
            • informal a person or people exhibiting physical power or strength: an ex-marine of enormous proportions who'd been brought along as muscle.
          Adam Frost{"video":"dominance: right;\\n\ud8cc\udd02\ud8fc\ude44\u00d8\ud8d8\ude41.mov"} k( 33) !Afrost2024/06/07 19:07:292026/05/10 20:37:14AS14c01S30007S10006S20500S26500M524x518S2ff00482x483S14c01498x488S26500508x469Adam Frost{"video":"dominance: right;\\n\ud8c7\udc82\ud8f0\udc08\u00d8\ud8d8\udde1\ud8e1\udde1.mov"}0' 33 9!)frost2024/06/07 15:37:012026/10/09 18:22:01AS18210S36a00S10006S20600M531x534S36a00482x477S18210508x514S20600498x523
          noun
          1. the part of a person's or animal's body connecting the head to the rest of the body: she is wearing a silk scarf around her neck | [as modifier] : the neck muscles.
            • meat from an animal's neck: neck of lamb made an excellent stew.
          Adam Frost{"video":"dominance: right;\\n\ud8cc\udcd1\ud8f9\udfc1\u00d8\ud8d8\ude41.mov"} ) 33A !}frost2024/06/07 19:14:442026/05/10 20:37:24AS15a50S2fe00S20348S2fe00S21400S20500S2b720M519x519S20348481x482S15a50487x492S2b720500x486Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e9\udcc1.mov"} x* 33[ 7!}frost2024/06/07 20:56:162025/03/06 01:33:36AS14404S2fe00S1440cS2fe00S38005S26b00S26b10M526x535S14404504x504S1440c476x486S26b00499x483S26b10475x465noun a public procession, especially one celebrating a special day or event and including marching bands and floats: the festival began with a parade of the competitors.
          • a formal march or gathering of troops for inspection or display: a military parade | [mass noun] : the men massed for parade.
          verb to walk in a military manner with a regular measured tread: three companies of soldiers marched around the field.Adam Frost{"video":"dominance: right;\\n\ud8c6\udd85\ud8fc\udc61\ud8c6\udd8d\ud8fc\udc61\ud8fc\udc06\ud8e2\udc21\ud8e2\udc31.mov"} G, 33C )!Afrost2024/06/07 21:05:052025/02/27 23:30:08AS16d17S2ff00S10006S28802S16d11M535x526S2ff00482x483S16d17515x503S28802489x494S16d11465x506adjective unusual or surprising in a way that is unsettling or hard to understand: children have some strange ideas | he's a very strange man | [with clause] : it is strange how things change.Adam Frost{"video":"dominance: right;\\n\ud8ca\udcf8\ud8ef\udfa1\u00d8\ud8e4\udf03\ud8ca\udcf2.mov"}+ 33 '!)frost2024/06/07 21:00:482026/10/09 18:26:03AS10e01S2fe00S10006S22713M515x522S10e01486x492S22713492x479
          noun
          1. an instrument used for cutting cloth, paper, and other thin material, consisting of two blades laid one on top of the other and fastened in the middle so as to allow them to be opened and closed by a thumb and finger inserted through rings on the end of their handles.
          Adam Frost{"video":"dominance: right;\\n\ud8c1\udd42\ud8fc\udc61\u00d8\ud8db\udeb4.mov"} "/ 33[ !}frost2024/06/07 21:23:472026/05/10 20:39:19AS14c11S2fe00S14c19S2fe00S38006S27102S27112M531x535S14c11505x466S14c19470x466S27102513x495S27112475x495Adam Frost{"video":"dominance: right;\\n\ud8c7\udc92\ud8fc\udc61\ud8c7\udc9a\ud8fc\udc61\ud8fc\udc07\ud8e2\ude63\ud8e2\ude73.mov"}/. 33u !}frost2024/06/07 21:17:582026/05/10 20:38:53AS14711S33d00S14719S2fe00S20500S28805S2881dM521x560S33b00482x483S14711493x512S14719477x518S28805501x534S2881d470x540Adam Frost{"video":"dominance: right;\\n\ud8c6\udeb2\ud8f5\udee1\ud8c6\udeba\ud8fc\udc61\ud8d8\udde1\ud8e4\udf06\ud8e4\udf1e.mov"}"- 33[ !}frost2024/06/07 21:12:582026/05/10 20:37:48AS20301S2fe00S20309S2fe00S38005S26500S26510M526x527S20301505x506S20309474x492S26500509x487S26510477x473Adam Frost{"video":"dominance: right;\\n\ud8d8\udd22\ud8fc\udc61\ud8d8\udd2a\ud8fc\udc61\ud8fc\udc06\ud8e1\udde1\ud8e1\uddf1.mov"} Y1 33 !)frost2024/06/09 16:31:292026/05/10 20:48:22AS1ce02S33200S10006S20800M520x527S33100482x483S1ce02477x505S20800510x514Adam Frost{"video":"dominance: right;\\n\ud8d3\udd43\ud8f4\udec1\u00d8\ud8d8\udf01.mov"}40 33C W!mfrost2024/06/07 21:27:222026/10/09 18:29:51AS18b10S33200S10006S21800S26502M529x540S33100482x483S18b10509x510S21800509x501S26502493x520
          adjective
          1. suggesting something supernatural; uncanny: the weird crying of a seal.
            • informal very strange; bizarre: a weird coincidence | all sorts of weird and wonderful characters.
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\udc31\ud8f4\udec1\u00d8\ud8da\udd01\ud8e1\udde3.mov"} A#A4 33C )!Afrost2024/06/09 16:40:572026/03/27 17:51:25AS10620S30005S10006S20e00S22f03M534x547S2ff00482x483S10620513x513S20e00502x521S22f03488x526noun a tough elastic polymeric substance made from the latex of a tropical plant or synthetically: the tires are made of rubber.Adam Frost{"video":"dominance: right;\\n\ud8c0\ude61\ud8f0\udc06\u00d8\ud8d9\udd41\ud8dc\udda4.mov"}S3 33 !-frost2024/06/09 16:37:522026/05/10 20:48:52AS14c40S2fe00S14c48S2fe00S21400S26524S20340S20348S20500M522x548S14c40498x453S14c48478x467S26524494x498S20340493x516S20348492x533Adam Frost{"video":"dominance: right;\\n\ud8c7\udcc1\ud8fc\udc61\ud8c7\udcc9\ud8fc\udc61\ud8d9\udf81\ud8e1\ude05\ud8d8\udd61\ud8d8\udd69\ud8d8\udde1.mov"}Y2 33 !)frost2024/06/09 16:33:062026/05/10 20:48:42AS15a11S33200S10006S27103M528x546S33100482x483S15a11505x502S27103495x520Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd2\ud8f4\udec1\u00d8\ud8e2\ude64.mov"}  7 33O !Yfrost2024/06/09 16:54:352026/05/10 21:36:24AS10620S30005S10006S20500S22a04S20500M539x546S2ff00482x483S10620518x504S20500510x535S22a04509x517Adam Frost{"video":"dominance: right;\\n\ud8c0\ude61\ud8f0\udc06\u00d8\ud8d8\udde1\ud8db\udfc5\ud8d8\udde1.mov"}633 g!#frost2024/06/09 16:47:102026/10/10 20:43:36AS15a10S30006S10006S20500S14c31S2fe00S14c39Sڃh533C ?!mfrost2024/06/09 16:43:332026/05/09 00:41:19AS14051S30005S10006S20e00S22f03M536x556S2ff00482x483S14051505x507S20e00494x530S22f03480x535S38b00470x493 M517x583S14051483x417S1dc20487x445S1f720491x479S20320496x498S1fb20496x517S19220496x540S16d20495x563 S38b04470x493noun, adjective plastic.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc52\ud8f0\udc06\u00d8\ud8d9\udd41\ud8dc\udda4.mov"}
        • lacking the force of character to hold to one's own decisions, beliefs, or principles; irresolute: he was not weak or a compromiser.
        • (of a belief, emotion, or attitude) not held or felt with such conviction or intensity as to prevent its being abandoned or dispelled: their commitment to the project is weak.
        • not in a secure financial position: people have no faith in weak banks.
      3. lacking intensity or brightness: a weak light from a single street lamp.
        • (of a liquid or solution) heavily diluted: a cup of weak coffee.
        • (of an acid) only slightly ionized.
        • displaying or characterized by a lack of enthusiasm or energy: she managed a weak, nervous smile.
        • (of features) not striking or strongly marked: his beard covered a weak chin.
    Adam Frost{"video":"dominance: right;\\n\ud8c7\udd92\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e2\ude62.mov"} qc833i3o!efrost2024/06/09 17:00:112026/10/09 18:53:41AS15410S30006S15418S30005S26a02S26a16M553x544S2ff00482x483S15410538x487S15418520x517S26a02521x487S26a16538x517M538x592S2ff00482x483S15a10517x487S14c31506x529S14c39468x529S22a04519x558S22a14468x558S1853d511x573S18535462x573 M529x518S2ff00482x483S15a10517x487
    noun
    1. a rectangular cloth bag stuffed with feathers, foam rubber, or other soft materials, used to support the head when lying down: I need a new pillow.
    SIGN VARIATIONS
    pillow beginning with bed
    Adam Frost{"video":"dominance: right;\\n\ud8c7\udf91\ud8f0\udc07\ud8c7\udf99\ud8f0\udc06\ud8e1\udfc3\ud8e1\udfd7.mov"} &&k: 33) !Afrost2024/06/09 17:09:202026/05/11 20:35:18AS1c521S30007S10006S20500S22115M546x518S2ff00482x483S1c52f515x488S22115527x465Adam Frost{"video":"dominance: right;\\n\ud8d2\ude02\ud8f0\udc08\u00d8\ud8d8\udde1\ud8db\udc76.mov"}g9 33O E!Yfrost2024/06/09 17:04:522026/10/09 18:57:03AS14c32S38611S10006S20e00S22a04S1853dM517x547S37602493x454S14c32483x489S22a04498x513S1853d490x528
    adjective
    1. lacking sufficient money to live at a standard considered comfortable or normal in a society: people who were too poor to afford a telephone | (the poor as plural noun) : the gap between the rich and the poor has widened.
      • (of a place) inhabited by people without sufficient money: a poor area with run-down movie theaters and overcrowded schools.
    Adam Frost{"video":"dominance: right;\\n\ud8c7\udcb3\ud8fc\ude52\u00d8\ud8d9\udd41\ud8db\udfc5\ud8cc\ude1e.mov"} oo4= 33g !frost2024/06/09 17:55:592026/05/11 20:36:05AS20340S2fe00S15a39S2fe00S21400S20500S22a00S14c40M518x536S15a39495x513S20340487x515S22a00488x497S14c40482x464Adam Frost{"video":"dominance: right;\\n\ud8d8\udd61\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8db\udfc1\ud8c7\udcc1.mov"}4< 33g !frost2024/06/09 17:50:592026/05/11 20:35:51AS1851cS2fe00S15a39S2fe00S21400S20500S28800S14c50M527x532S15a39473x509S1851c485x505S28800515x490S14c50493x468Adam Frost{"video":"dominance: right;\\n\ud8cc\uddfd\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e4\udf01\ud8c7\udcd1.mov"}; 33i !efrost2024/06/09 17:20:472026/05/11 20:35:02AS15a01S38511S15a07S38517S20500S20500M532x520S37600488x497S15a01471x480S15a07506x480S20500468x495S20500522x495Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc2\ud8fc\uddf2\ud8c8\uddc8\ud8fc\uddf8\ud8d8\udde1\ud8d8\udde1.mov"} Y? 33 !)frost2024/06/09 18:00:592026/05/11 20:40:58AS18207S38501S10006S20600M521x517S36d00479x483S18207478x492S20600453x488Adam Frost{"video":"dominance: right;\\n\ud8cc\udcc8\ud8fc\udde2\u00d8\ud8d8\ude41.mov"}> 33i !efrost2024/06/09 17:58:232026/05/11 20:36:22AS14e10S30007S14e18S30001S27104S27114M552x532S2ff00482x483S14e10520x484S14e18455x484S27104512x517S27114448x517Adam Frost{"video":"dominance: equal;\\n\ud8c7\udd51\ud8f0\udc08\ud8c7\udd59\ud8f0\udc02\ud8e2\ude65\ud8e2\ude75.mov"} y@ 33C !Afrost2024/06/09 18:05:052026/10/09 19:06:28AS1ea10S30005S10006S20800S27100M558x530S2ff00482x483S1ea10510x509S20800522x502S27100518x485
    noun
    1. the thin layer of tissue forming the natural outer covering of the body of a person or animal: I use body lotion to keep my skin soft | a flap of skin.
      • the skin of a dead animal with or without the fur, used as material for clothing or other items: is this real crocodile skin?.
    Adam Frost{"video":"dominance: right;\\n\ud8d5\udfd1\ud8f0\udc06\u00d8\ud8d8\udf01\ud8e2\ude61.mov"} ]IA33)M!Afrost2024/06/09 18:11:512026/10/09 19:16:27AS10012S33200S10006S20500S30124M528x528S30124482x477S33110499x499S10012498x513M520x532S30124482x477S33110499x499S1ce02477x510S20800510x519
    verb [no object]
    1. to make a sudden involuntary expulsion of air from the nose and mouth due to irritation of one's nostrils: the smoke made her sneeze.
    noun
    1. an act or the sound of expelling air from the nose in a sneeze: he stopped a sudden sneeze.
    PHONOLOGICAL VARIANTS
    sneeze with F-hand
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8f4\udec1\u00d8\ud8d8\udde1\ud8f0\udc85.mov"}  C 33k !)frost2024/06/09 18:21:252026/10/10 18:54:09AS10012S36110S10006S27102M529x554S36100482x483S10012499x520S27102479x514M529x541S36100482x483S10012499x520S26a02479x514
    verb
    1. to clean (one's teeth) by scrubbing with a toothbrush.
    noun
    1. a toothbrush.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8f9\udc61\u00d8\ud8e2\ude63.mov"}"B 33[ !}frost2024/06/09 18:15:322026/05/11 20:41:24AS14c04S2fe00S14c08S2fe00S37f00S2ea0aS2ea42M532x529S14c04509x472S14c08497x498S2ea0a478x478S2ea42469x502Adam Frost{"video":"dominance: right;\\n\ud8c7\udc85\ud8fc\udc61\ud8c7\udc89\ud8fc\udc61\ud8fb\udfa1\ud8ed\udfcb\ud8ee\udc03.mov"}  Q4F 33g !frost2024/06/09 18:33:252026/05/11 20:42:41AS10051S2fe00S10059S2fe00S21406S20500S2480aS2481eM563x511S10051502x490S10059470x490S2480a535x491S2481e438x495Adam Frost{"video":"dominance: right;\\n\ud8c0\udc52\ud8fc\udc61\ud8c0\udc5a\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8de\udf0b\ud8de\udf1f.mov"}]E 33A !}frost2024/06/09 18:28:002026/10/10 18:51:56AS14e51S2fe00S15a39S2fe00S21400S20500S27101M528x525S15a39472x475S14e51483x481S27101501x499
    adjective
    1. lacking the power to performD 335 !efrost2024/06/09 18:25:012026/05/11 20:41:43AS1ce10S2fe00S1ce18S2fe00S21406S20600M523x522S1ce10501x479S1ce18478x479S20600489x511Adam Frost{"video":"dominance: equal;\\n\ud8d3\udd51\ud8fc\udc61\ud8d3\udd59\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"}perating system) to allow the use or operation of (a program, language, or device): the new versions do not support the graphical user interface standard.
    noun
    1. a thing that bears the weight of something or keeps it upright: the best support for a camera is a tripod.
      • the action or state of bearing the weight of something or someone or of being so supported: she clutched the sideboard for support.
    2. material assistance: he urged that military support be sent to protect humanitarian convoys | [as modifier] : support staff.
      • approval, encouragement, or comfort: the paper printed many letters in support of the government | she's been through a bad time and needs our support.
      • a source of comfort or encouragement: he was a great support when her father died.
      • technical help given to the user of a computer or other product.
      • a second531x526S15a39469x503S1851c481x499S20e00506x487S26507518x474S38b00470x493 M536x528S15a39464x505S1851c476x501S20e00501x489S2b707511x473 S38b04470x493 S38a00464x490 M533x528S15a39468x505S1851c480x501S20e00505x489S26a07512x473verb to obtain in exchange for payment: [with two objects] : he bought me a new dress | we had to find some money to buy a house.
        • [often with negative] be a means of obtaining (something) through exchange or payment: money can't buy happiness.

        PHONOLOGICAL VARIANTS
        buy with arched movement

        INFLECTED FORMS
        buying [frequentative]Adam Frost{"video":"dominance: right;\\n\ud8cc\uddfd\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde8.mov"} #H 33[ !}frost2024/06/09 18:42:272026/05/03 22:15:18AS10000S2fe00S10008S2fe00S38006S24f09S24f11M551x529S10000508x499S10008478x499S24f09523x472S24f11450x472noumG 33A !-frost2024/06/09 18:37:292026/05/11 20:42:53AS14c01S33d00S14c09S2fe00S20500S22a04S22a14S1853dS18535M536x584S33b00482x483S14c01504x509S14c09470x521S22a04516x539S22a14470x551S1853d509x554S18535464x565Adam Frost{"video":"dominance: right;\\n\ud8c7\udc82\ud8f5\udee1\ud8c7\udc8a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc5\ud8db\udfd5\ud8cc\ude1e\ud8cc\ude16.mov"}mns        .
      • to give assistance to, especially financially; enable to function or act: the government gives $2.5 billion a year to support the activities of the voluntary sector.
        • to provide with a home and the necessities of life: my main concern was to support my family.
        • to produce enough food and water for; be capable of sustaining: the land had lost its capacity to support life.
        • to give approval, comfort, or encouragement to: the proposal was supported by many delegates | I like to visit her to support her.
        • to be actively interested in and concerned for the success of (a particular sports team): fans should always support their team fully, no matter what.
        • (of a pop or rock group or performer) function as a secondary act to (another) at a concert: the band supported him on a tour.
      • to suggest the truth of; corroborate: the studies support our findings.
      • (of a computer or o rr=4J 33g !frost2024/06/10 18:16:122026/05/11 20:43:47AS10e12S2fe00S15a48S2fe00S21406S20500S2c300S20500M533x520S15a48468x493S10e12480x501S2c300507x480S20600483x488Adam Frost{"video":"dominance: right;\\n\ud8c1\udd53\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ea\udd21\ud8d8\udde1.mov"}RI 33Y !Qfrost2024/06/09 18:56:252026/10/10 18:53:34AS10012S36110S10006S26a02S1e141S2fe00S10048S2fe00S37f00S26500S1ea41M529x598S36100482x483S10012499x520S26a02479x514S10048486x566S1e141492x570S26500515x563S1ea41490x552
        noun
        1. a paste used on a toothbrush for cleaning the teeth: a tube of toothpaste | [count noun] : fluoride toothpastes.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8f9\udc61\u00d8\ud8e1\udfc3\ud8d5\udca2\ud8fc\udc61\ud8c0\udc49\ud8fc\udc61\ud8fb\udfa1\ud8e1\udde1\ud8d6\udc02.mov"} WWNL 33 !)frost2024/06/10 19:44:312026/08/03 17:18:12AS10020S2fe00S10006S2e000M517x530S10020502x500S2e000483x471noun a monetary amount equivalent to exactly one unit of the currency of the United States: it’s just one dollar.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ed\udc01.mov"}SK 33 !-frost2024/06/10 18:40:372026/05/11 20:44:00AS10020S30004S20348S2fe00S20500S22a04S15a50S21400S20500M518x598S2ff00482x483S10020499x511S22a04500x545S20348493x583S15a50501x564Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8f0\udc05\ud8d8\udd69\ud8fc\udc61\ud8d8\udde1\ud8db\udfc5\ud8c8\ude11\ud8d9\udf81\ud8d8\udde1.mov"} LL[N 33 )!)frost2024/06/10 19:48:522026/03/29 19:49:05AS11e20S2fe00S10006S2e000M517x530S11e20494x500S2e000483x471noun a monetary amount equivalent to exactly three units of the currency of the United States: everything here is three dollars.Adam Frost{"video":"dominance: right;\\n\ud8c2\udf61\ud8fc\udc61\u00d8\ud8ed\udc01.mov"}QM 33 !)frost2024/06/10 19:46:492026/03/29 19:48:44AS10e20S2fe00S10006S2e000M517x530S10e20502x500S2e000483x471noun a monetary amount equivalent to exactly two units of the currency of the United States: that’ll be two dollars.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd61\ud8fc\udc61\u00d8\ud8ed\udc01.mov"} UURP 33 !)frost2024/06/10 20:02:472026/03/29 19:49:53AS14c20S2fe00S10006S2e000M519x529S14c20496x498S2e000482x471noun a monetary amount equivalent to exactly five units of the currency of the United States: that one is five dollars.Adam Frost{"video":"dominance: right;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8ed\udc01.mov"}QO 33 !)frost2024/06/10 19:50:352026/03/29 19:49:24AS14420S2fe00S10006S2e000M520x529S14420498x498S2e000481x471noun a monetary amount equivalent to exactly four units of the currency of the United States: the fee is four dollars.Adam Frost{"video":"dominance: right;\\n\ud8c6\udda1\ud8fc\udc61\u00d8\ud8ed\udc01.mov"} RRXR 33 #!)frost2024/06/10 20:05:002026/03/29 19:50:22AS1a520S2fe00S10006S2e000M520x529S1a520499x501S2e000481x472noun a monetary amount equivalent to exactly seven units of the currency of the United States: they charged me seven dollars.Adam Frost{"video":"dominance: right;\\n\ud8cf\ude01\ud8fc\udc61\u00d8\ud8ed\udc01.mov"}NQ 33 !)frost2024/06/10 20:03:532026/03/29 19:50:08AS18720S2fe00S10006S2e000M517x528S18720499x499S2e000483x472noun a monetary amount equivalent to exactly six units of the currency of the United States: six dollars is enough.Adam Frost{"video":"dominance: right;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8ed\udc01.mov"} PqU33[Sa!}frost2024/06/10 20:09:432026/06/05 17:29:57AS1851cS2fe00S15a39S2fe00S21400S20e00S26507MST 33 !)frost2024/06/10 20:07:092026/03/29 19:50:51AS1ce20S2fe00S10006S2e000M517x530S1ce20495x500S2e000484x471noun a monetary amount equivalent to exactly nine units of the currency of the United States: the book was nine dollars.Adam Frost{"video":"dominance: right;\\n\ud8d3\udd61\ud8fc\udc61\u00d8\ud8ed\udc01.mov"}US 33 !)frost2024/06/10 20:06:042026/03/29 19:50:35AS1bb20S2fe00S10006S2e000M520x529S1bb20499x501S2e000481x472noun a monetary amount equivalent to exactly eight units of the currency of the United States: it’s about eight dollars.Adam Frost{"video":"dominance: right;\\n\ud8d1\ude41\ud8fc\udc61\u00d8\ud8ed\udc01.mov"}ary act at a pop or rock concert: [as modifier] : a support band.
    adjective
    1. bearing all or part of the weight of something: supporting structures for the elevated roads will be brought to site by huge trailers.
    2. serving to corroborate something: he offered no supporting evidence for this opinion.
    3. (of an actor or role) important in a play or film but of lesser importance than the leading parts: his performance is excellent but he is more than matched by the supporting cast.
    4. providing encouragement or emotional help: the staff are extremely supportive of each other.
    INFLECTED FORMS
    support [in isolation]
    Adam Frost{"video":"dominance: right;\\n\ud8d8\udd22\ud8fc\udc61\ud8d8\udd2a\ud8fc\udc61\ud8d9\udf86\ud8db\udfc2\ud8d8\udde1.mov"} V 335 !efrost2024/06/10 20:11:162026/05/11 20:44:17AS15a12S2fe00S15a18S2fe00S21400S20600M522x520S15a12495x481S15a18504x493S20600478x494Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd3\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} g_W33M K!Efrost2024/06/10 20:14:252026/05/22 18:41:04AS12120S30007S12128S30001S20e00S20e00S21800S21800S2ea04S2ea1cM536x530S2ff00482x483S12120511x475S12128465x475S21800514x465S21800468x465S2ea04521x505S2ea1c463x505S38b00470x493 M536x585S2ff00482x483S12120511x475S12128469x530S21800514x465S21800472x520S2ea04521x505S2ea1c467x560 S38b04470x493adjective (of a person, animal, or their behavior) causing or showing a fondness for causing trouble in a playful way: two mischievous kittens had decorated the bed with shredded newspaper.

    PHONOLOGICAL VARIANTS
    mischievous with lowered left handAdam Frost{"video":"dominance: equal;\\n\ud8c3\udc81\ud8f0\udc08\ud8c3\udc89\ud8f0\udc02\ud8d9\udd41\ud8d9\udd41\ud8da\udd01\ud8da\udd01\ud8ed\udfc5\ud8ed\udfdd.mov"} AX 33 !frost2024/06/10 20:15:302026/05/11 20:44:28AS12120S30007S12128S30001S20500S20500S21800S21800M535x518S2ff00482x483S12120511x475S12128465x475S21800514x465S21800468x465Adam Frost{"video":"dominance: equal;\\n\ud8c3\udc81\ud8f0\udc08\ud8c3\udc89\ud8f0\udc02\ud8d8\udde1\ud8d8\udde1\ud8da\udd01\ud8da\udd01.mov"} ufY 335kG!frost2024/06/10 20:18:322026/10/09 17:15:03AS1dc52S2fe00S15a39S2fe00S21400S20600M523x516S15a39500x493S1dc52486x484S20600477x503M518x522S15a48483x481S1dc50494x478S20600487x511
    noun
    1. a thick, smooth liquid preparation designed to be applied to the skin for medicinal or cosmetic purposes: itching can be relieved with calamine lotion or antihistamine tablets | [count noun] : cleansing lotions were displayed in simple bottles.
    noun, adjective
    1. a phonological variant (with base hand palm facing up) of Lutheran.
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d4\uded3\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"}t's sleep    .
    adverb
    1. more excellently or effectively: Johnny could do better if he tried | instruments are generally better made these days.
      • to a greater degree; more: I liked it better when we lived in the country | you may find alternatives that suit you better.
      • more suitably, appropriately, or usefully: the money could be better spent on more urgent cases.
    noun
    1. the better one; that which is better: the Natural History Museum book is by far the better of the two | a change for the better.
    ORIGIN
    a compound of good and -er (a comparative suffix).
    Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8f0\udc05\u00d8\ud8d9\udd41\ud8e1\udde7\ud8d6\udfe3.mov"}ection id=noun2025> noun
    1. (the best) that which is the most excellent, outstanding, or desirable: buy the best you can afford | Sarah always had to be the best at everything | this year’s event will cover the best of both domestic and international manufacturing practices.
      • the most meritorious aspect of a thing or person: he brought out the best in people.
      • (one's best) the peak of condition; the highest standard or level that a person or thing can reach: this is jazz at its best | try to look your best.
    ORIGIN
    good and -est (superlative suffix).
    Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8f0\udc05\u00d8\ud8d9\udd41\ud8e4\udf08\ud8d6\udfe3.mov"}S2ff00482x483S15a02496x509S28807527x499S1f502533x471M531x535S2ff00482x483S15a01494x512S26500517x508
    adjective
    1. of the most excellent, effective, or desirable type or quality: the best pitcher in the league | how to obtain the best results from your machine | her best black suit.
      • most enjoyable: some of the best times of my life.
      • most appropriate, advantageous, or well advised: do whatever you think best | it's best if we both go.
    adverb
    1. to the highest degree; most: you knew him best | well-drained soil suits it best | the one we liked best.
      • most excellently or effectively: the best-dressed man in Hollywood | the things we do best.
      • most suitably, appropriately, or usefully: jokes are best avoided in essays | this is best done at home.
    noun     the part of the body containing the digestive organs: Blake hit him in the stomach.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8fc\ude11\u00d8\ud8d8\ude41.mov"}WZ 33Ak1!}frost2024/06/10 20:26:252026/10/09 20:10:44AS20301S2fe00S20309S2fe00S21405S22a01S20500M519x524S20301488x492S20309482x476S22a01506x510M523x519S20301484x498S20309478x482S20600501x491
    verb [with object]
    1. to bear all or part of the weight of; hold up: the dome was supported by a hundred white colu EE7\ 33) #!Afrost2024/06/10 20:34:162026/01/12 15:17:43AS15402S38510S10006S20500S2c500M520x528S15402486x499S20500493x517S2c500480x472verb to expel air forcefully from the lungs, especially due to irritation or blockage in the airway: he started coughing during the meeting.
      noun an act of coughing, especially due to irritation or blockage in the airway: his cough looks serious.
      • a condition of the respiratory organs causing coughing, especially due to irritation or blockage in the airway: he looked feverish and had a bad cough.
      Adam Frost{"video":"dominance: right;\\n\ud8c7\udf83\ud8fc\uddf1\u00d8\ud8d8\udde1\ud8ea\udde1.mov"} ..b^ 33 !Ufrost2024/06/10 20:57:482026/05/11 21:05:23AS14020S2fe00S10006S2e508M516x531S14020484x470S2e508493x504Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc21\ud8fc\udc61\u00d8\ud8ed\udde9.mov"}h] 33Ckk!cfrost2024/06/10 20:49:422026/10/09 19:15:50AS1ce02S33200S10006S20800S30124M520x532S30124482x477S33110499x499S1ce02477x510S20800510x519M528x528S30124482x477S33110499x499S10012498x513
      verb, noun
      1. a phonological variant (F-hand) of sneeze.
      Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d3\udd43\ud8f4\udec1\u00d8\ud8d8\udf01\ud8f0\udc85.mov"} A` 33 !frost2024/06/10 21:12:102026/05/11 21:08:36AS15a02S2fe00S15a0aS2fe00S21414S20e00S27100S27114M549x518S15a0a479x501S15a02494x506S20e00494x484S27100509x482S27114451x482Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8e2\ude61\ud8e2\ude75.mov"} _33!7frost2024/06/10 21:02:272026/05/23 20:21:27AS10001S30005S10009S30003S20500S20500S24e09S24e11M543x537S2ff00482x483S10001507x507S10009473x507S24e09521x485S24e11457x485M544x526S10000508x496S10008478x496S24e09522x474S24e11457x474adverb a phonological variant (chin contact) of finally.Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8c0\udc02\ud8f0\udc06\ud8c0\udc0a\ud8f0\udc04\ud8d8\udde1\ud8d8\udde1\ud8df\udd4a\ud8df\udd52.mov"} XXjYb 33 !)frost2024/06/10 21:17:232026/10/09 20:43:40AS10012S36110S10006S26a02M529x541S36100482x483S10012499x520S26a02479x514
      noun
      1. a small brush with a long handle, used for cleaning the teeth.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8f9\udc61\u00d8\ud8e1\udfc3.mov"}Ga 33[ U!}frost2024/06/10 21:15:482026/10/09 19:07:06AS1ce51S2fe00S15a5aS2fe00S21400S20800S27120M530x521S15a5a476x509S1ce51471x483S20800496x498S27120491x479
      noun
      1. the peel or outer layer of certain fruits or vegetables: potatoes roasted in their skins.
        • the thin outer covering of a sausage: if you are using link-sausages, prick the skins well with a fork.
      Adam Frost{"video":"dominance: right;\\n\ud8d3\udd92\ud8fc\udc61\ud8c8\ude1b\ud8fc\udc61\ud8d9\udf81\ud8d8\udf01\ud8e2\ude81.mov"} D1c 33) !Afrost2024/06/10 21:20:312026/10/09 20:41:12AS14401S33200S10006S20500S28139M539x529S33100482x483S14401486x500S28139517x494
      verb [with object]
      1. to refuse to take notice of or acknowledge; intentionally not paying attention to: he ignored her outraged question.
        • to fail to consider (something significant): direct satellite broadcasting ignores national boundaries.
        • Law (of a grand jury) to reject (an indictment) as groundless.
      noun
      1. the action or state of disregarding or ignoring something: blatant disregard for the law.
      Adam Frost{"video":"dominance: right;\\n\ud8c6\udd82\ud8f4\udec1\u00d8\ud8d8\udde1\ud8e4\udc9a.mov"} f 33A !}frost2024/06/10 21:30:162026/05/11 21:11:43AS10051S2fe00S10039S2fe00S21400S2b700S20500M531x520S10039470x482S10051488x480S2b700512x497Adam Frost{"video":"dominance: right;\\n\ud8c0\udc52\ud8fc\udc61\ud8c0\udc3a\ud8fc\udc61\ud8d9\udf81\ud8e9\udca1\ud8d8\udde1.mov"}"e 33[ !}frost2024/06/10 21:24:362026/05/11 21:10:56AS10050S2fe00S10058S2fe00S38006S2c600S2c611M522x530S10050507x500S10058478x500S2c600501x470S2c611480x470Adam Frost{"video":"dominance: equal;\\n\ud8c0\udc51\ud8fc\udc61\ud8c0\udc59\ud8fc\udc61\ud8fc\udc07\ud8ea\ude41\ud8ea\ude52.mov"}"d 33[ !}frost2024/06/10 21:22:162026/05/11 21:10:46AS10640S2fe00S10648S2fe00S21400S20e00S26a00M517x533S10648483x507S10640493x499S20e00498x484S26a00490x468Adam Frost{"video":"dominance: right;\\n\ud8c0\ude81\ud8fc\udc61\ud8c0\ude89\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc1.mov"}21x531S36d00479x469S14010465x476S22a05495x506S20500510x520noun
      1. the male ruler of an independent state, especially one who inherits the position by right of birth: we received a visit from the king and queen of Sweden | he had a private audience with the King | [as title] : King Henry VIII.
        • a man regarded as the finest or most important in its sphere or group: the king of rock.
      2. the most important chess piece, of which each player has one, which the opponent has to checkmate in order to win.
        • a piece in the game of checkers with extra capacity for moving, made by crowning an ordinary piece that has reached the opponent's baseline.
        • a playing card bearing a representation of a king, normally ranking next below an ace.
        Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc11\ud8fc\uddf2\u00d8\ud8d8\udde1\ud8db\udfc6\ud8fc\ude18\ud8d8\udde1.mov"} @@zh 33Ok !Yfrost2024/06/10 21:32:562026/10/10 20:57:07AS15a02S30004S10006S20e00S28807S1f502M548x521 Eg 33Ok#!Yfrost2024/06/10 21:32:122026/10/10 20:28:44AS15a02S30004S10006S20e00S26506S1f502M561x523S2ff00482x483S15a02496x509S26506527x508S1f502546x499M531x535S2ff00482x483S15a01494x512S26500517x508
        adjective
        1. of a more excellent or effective type or quality: hoping for better weather | the new facilities were far better | I'm better at algebra than Alice.
          • more appropriate, advantageous, or well advised: there couldn't be a better time to start this job | it might be better to borrow the money.
        2. [predicative or as complement] partly or fully recovered from illness, injury, or mental stress; less unwell: his leg was getting better | she's much better today | we'll feel a lot better after a decent nigh$a05493x499S20500508x513noun
          1. the female ruler of an independent state, especially one who inherits the position by right of birth: he insisted the princess could be crowned queen | the last queen of France | dignitaries will have an audience with the Queen at Buckingham Palace | [as title] : Queen Victoria.
            • a woman regarded as the finest or most outstanding in a particular sphere or group: the queen of romance novelists
          2. the most powerful chess piece that each player has.
            • a playing card bearing a representation of a queen, normally ranking next below a king and above a jack.
          3. Entomology a reproductive female in a colony of social ants, bees, wasps, etc..
          4. mainly derogatory a gay man with an ostentatiously affected, flamboyant, or feminine manner.
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d6\ude12\ud8fc\uddf2\u00d8\ud8d8\udde1\ud8db\udfc6\ud8fc\ude18\ud8d8\udde1.mov"} k 335 !efrost2024/06/11 01:11:412026/05/11 21:13:09AS1ce51S2fe00S17648S2fe00S21400S20710M526x524S17648474x498S1ce51474x476S20710492x509Adam Frost{"video":"dominance: right;\\n\ud8d3\udd92\ud8fc\udc61\ud8cb\udc89\ud8fc\udc61\ud8d9\udf81\ud8d8\udeb1.mov"}j 335 !efrost2024/06/11 01:10:322026/05/11 21:13:01AS1ce51S2fe00S17648S2fe00S21400S20700M518x524S17648482x498S1ce51482x476S20700500x509Adam Frost{"video":"dominance: right;\\n\ud8d3\udd92\ud8fc\udc61\ud8cb\udc89\ud8fc\udc61\ud8d9\udf81\ud8d8\udea1.mov"}i 33) !mfrost2024/06/11 01:01:452026/05/11 21:12:49AS14010S30007S10006S2ef00S20500M555x518S2ff00482x483S14010511x479S2ef00537x476Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc11\ud8f0\udc08\u00d8\ud8ee\udda1\ud8d8\udde1.mov"} "n 33[ !}frost2024/06/11 01:33:502026/05/11 21:21:26AS1f540S2fe00S1f548S2fe00S21406S20e00S26500M516x529S1f540501x505S1f548485x494S20e00503x489S26500502x471Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8d7\udc29\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8e1\udde1.mov"}m 335 !efrost2024/06/11 01:28:162026/05/11 21:21:12AS1dc40S2fe00S15a18S2fe00S21406S20b00M519x523S15a18482x483S1dc40495x477S20b00496x510Adam Frost{"video":"dominance: right;\\n\ud8d4\udec1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d9\udc21.mov"}xl 33C !Afrost2024/06/11 01:19:342026/05/11 21:17:23AS16d17S2ff00S10006S28802S20311M535x526S2ff00482x483S16d17515x503S28802489x494S20311465x505Adam Frost{"video":"dominance: right;\\n\ud8ca\udcf8\ud8ef\udfa1\u00d8\ud8e4\udf03\ud8d8\udd32.mov"} 0 "q 33[ !}frost2024/06/12 20:43:512026/05/11 21:27:18AS11010S2fe00S11018S2fe00S38006S2e006S2e01eM525x537S11010508x510S11018477x510S2e006505x463S2e01e475x463Adam Frost{"video":"dominance: equal;\\n\ud8c1\ude11\ud8fc\udc61\ud8c1\ude19\ud8fc\udc61\ud8fc\udc07\ud8ed\udc07\ud8ed\udc1f.mov"}"p 33[ !}frost2024/06/12 20:42:072026/05/11 21:27:04AS11010S2fe00S11018S2fe00S38006S2df06S2df1eM525x528S11010508x501S11018477x501S2df06505x473S2df1e475x473Adam Frost{"video":"dominance: equal;\\n\ud8c1\ude11\ud8fc\udc61\ud8c1\ude19\ud8fc\udc61\ud8fc\udc07\ud8ec\udfa7\ud8ec\udfbf.mov"}Lo 33 !)frost2024/06/11 01:37:362026/05/11 21:22:19AS20310S2fe00S10006S2df08M520x516S20310481x501S2df08499x485Adam Frost{"video":"dominance: right;\\n\ud8d8\udd31\ud8fc\udc61\u00d8\ud8ec\udfa9.mov"} 4s 33g !frost2024/06/12 20:56:572026/05/11 21:28:26AS18240S2fe00S15a38S2fe00S21400S20500S26504S20500M524x520S15a38477x480S18240483x491S26504510x491S20500512x509Adam Frost{"video":"dominance: right;\\n\ud8cc\udd01\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udde5\ud8d8\udde1.mov"}r 335 !efrost2024/06/12 20:49:542026/05/11 21:28:07AS10041S2fe00S15a39S2fe00S21400S20600M523x522S15a39478x479S10041487x492S20600501x490Adam Frost{"video":"dominance: right;\\n\ud8c0\udc42\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} zt 33i Q!Yfrost2024/06/12 21:00:412025/07/02 21:41:28AS10001S30006S10006S20e00S26a00S21800M542x529S2ff00482x483S10001510x499S20e00522x495S26a00515x479S21800520x468verb to form an idea of the existence, presence, or truth of (something) without certain proof: if you suspect a gas leak, do not turn on an electric light.
          • to believe or feel that (someone) is guilty of an illegal, dishonest, or unpleasant act, without certain proof: parents suspected of child abuse.
          adjective not easily convinced; having doubts or reservations: the public were deeply skeptical about some of the proposals.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc02\ud8f0\udc07\u00d8\ud8d9\udd41\ud8e1\udfc1\ud8da\udd01.mov"} "w 33[ !}frost2024/06/12 21:28:292026/05/11 21:29:24AS17131S2fe00S17139S2fe00S38006S22a04S22a14M531x517S17131507x483S17139473x483S22a04518x502S22a14469x502Adam Frost{"video":"dominance: equal;\\n\ud8ca\ude92\ud8fc\udc61\ud8ca\ude9a\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"}"v 33[ !}frost2024/06/12 21:14:332026/05/11 21:29:34AS17131S2fe00S17139S2fe00S38006S22f04S22f14M537x517S17131507x484S17139473x484S22f04512x503S22f14464x503Adam Frost{"video":"dominance: equal;\\n\ud8ca\ude92\ud8fc\udc61\ud8ca\ude9a\ud8fc\udc61\ud8fc\udc07\ud8dc\udda5\ud8dc\uddb5.mov"}u 33A !}frost2024/06/12 21:04:162026/05/11 21:28:52AS11541S2fe00S11549S2fe00S21400S20500S23004M523x524S11541496x476S11549477x483S23004498x506Adam Frost{"video":"dominance: right;\\n\ud8c2\udc22\ud8fc\udc61\ud8c2\udc2a\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8dc\ude05.mov"} xz 33C !Afrost2024/06/12 21:38:102026/05/11 21:30:09AS1f711S33d00S10006S21100S25034M524x573S33b00482x483S1f711482x510S21100506x519S25034502x537Adam Frost{"video":"dominance: right;\\n\ud8d7\udcb2\ud8f5\udee1\u00d8\ud8d9\ude61\ud8df\ude35.mov"}vy 33 !efrost2024/06/12 21:33:402026/05/11 21:29:58AS15a41S2fe00S15a06S2fe00S21404S20500M515x518S15a06486x482S15a41492x495Adam Frost{"video":"dominance: right;\\n\ud8c8\ude02\ud8fc\udc61\ud8c8\uddc7\ud8fc\udc61\ud8d9\udf85\ud8d8\udde1.mov"}4x 33g !frost2024/06/12 21:30:342026/05/11 21:29:47AS18210S2fe00S15a08S2fe00S21414S20500S22a04S20500M523x520S15a08477x480S18210483x491S22a04510x491S20500512x509Adam Frost{"video":"dominance: right;\\n\ud8cc\udcd1\ud8fc\udc61\ud8c8\uddc9\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1\ud8db\udfc5\ud8d8\udde1.mov"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx           ! "!#"$#%$&%'&(')(*)+*,+-,.-/.0/ oo[} 335 !frost2024/06/12 22:12:402026/05/11 21:31:02AS20311S30006S20319S30002S22a04S22a14S14c13S14c1bM545x557S2ff00482x483S20311522x492S20319457x492S22a04526x516S22a14461x516S14c13518x531S14c1b456x531Adam Frost{"video":"dominance: equal;\\n\ud8d8\udd32\ud8f0\udc07\ud8d8\udd3a\ud8f0\udc03\ud8db\udfc5\ud8db\udfd5\ud8c7\udc94\ud8c7\udc9c.mov"}| 33A !}frost2024/06/12 21:55:332026/05/11 21:30:28AS11551S2fe00S11559S2fe00S21400S20500S2880aM534x514S11559466x489S11551486x489S2880a512x487Adam Frost{"video":"dominance: right;\\n\ud8c2\udc32\ud8fc\udc61\ud8c2\udc3a\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e4\udf0b.mov"}{ 33A !}frost2024/06/12 21:51:472026/05/11 21:30:20AS11551S2fe00S11559S2fe00S21400S28802S20500M535x514S11559466x489S11551486x489S28802513x487Adam Frost{"video":"dominance: right;\\n\ud8c2\udc32\ud8fc\udc61\ud8c2\udc3a\ud8fc\udc61\ud8d9\udf81\ud8e4\udf03\ud8d8\udde1.mov"}ampled the wine and found it was sour.
          • (of food, especially milk) spoiled because of fermentation: the kitchen smelled of sour milk.
        3. (of a subject, state, or activity) demanding careful consideration or application: marriage is a serious matter.
          • (of a person) solemn or thoughtful in character or manner: her face grew serious.
          • (of thought or discussion) careful or profound: we give serious consideration to safety recommendations.
          • (of music, literature, or other art forms) requiring deep reflection and inviting a considered response: he bridges the gap between serious and popular music.
        4. acting or speaking sincerely and in earnest, rather than in a joking or half hearted manner: actors who are serious about their work | suddenly he wasn't teasing any more—he was deadly serious.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc11\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ec\udfa1.mov"} $ 33 !)frost2024/06/12 22:21:302026/05/31 02:19:17AS11550S2fe00S10006S2f900M508x519S11550493x481S2f900495x514affix
        1. used to represent the position of a pair of legs together, especially laying down: I can't sleep on my back.
        2. used to represent the location of a long horizontal object, especially one used for lounging on: the beach was littered with rows of lounge chairs and towels.
        Adam Frost{"video":"dominance: right;\\n\ud8c2\udc31\ud8fc\udc61\u00d8\ud8ef\udd61.mov"} 33[ 3!frost2024/06/12 22:18:102026/05/31 20:24:13AS1f011S38511S10006S20500S22a05S38537S20500M521x524S36d00479x477S1f011466x484S22(~ 33[ w!frost2024/06/12 22:15:412026/05/31 20:16:34AS14010S38511S10006S20500S22a05S38537S20500M5514x537S20348497x522S14c51487x497S20e00498x482S26500497x464M516x536S20348495x521S14c51485x496S20e00496x481S26a00489x465determiner as much or as many as required: there's too much work and not enough people to do it | he did just enough studying to pass his exams.
        pronoun as much or as many of something as required: they ordered more than enough for five people | he used to give us a small allowance, just enough to live on.
        adverb to the required degree or extent (used after an adjective, adverb, or verb): at the time, he wasn't old enough to vote | a house that's big enough for your family.

        INFLECTED FORMS
        enough [in isolation]Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd2\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde1.mov"} 66΅F 333 3!Efrost2024/06/12 22:34:432026/05/19 20:45:19AS18510S2fe00S18518S2fe00S21406S26502S26516S14c10S14c18S20500M565x516S18510540x496S18518435x496S26502524x497S26516461x497S14c10497x485S14c18480x485verb [no object] to meet and come into violent conflict: soccer hooligans clashed with rival fans before the game.
        • to have a forceful disagreement: Clarke has frequently clashed with his colleagues.
        • to be incompatible or at odds: his thriftiness clashed with Ross's largesse.
        Adam Frost{"video":"dominance: equal;\\n\ud8cc\uddf1\ud8fc\udc61\ud8cc\uddf9\ud8fc\udc61\ud8d9\udf87\ud8e1\udde3\ud8e1\uddf7\ud8c7\udc91\ud8c7\udc99\ud8d8\udde1.mov"} 8^8" 33[ !}frost2024/06/12 22:56:272026/05/11 21:32:22AS10651S2fe00S10639S2fe00S21400S21100S2a228M522x535S10639499x507S10651479x515S21100496x497S2a228492x465Adam Frost{"video":"dominance: right;\\n\ud8c0\ude92\ud8fc\udc61\ud8c0\ude7a\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e7\udce9.mov"} 33s !]frost2024/06/12 22:47:502026/05/11 21:32:15AS14c51S2fe00S14c39S2fe00S21400S20e00S26502S1f751S1f739S20e00S26506M523x540S14c39496x460S14c51477x461S20e00494x489S26502477x488S1f739496x505S1f751482x506S20e00494x527S26506508x526Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd2\ud8fc\udc61\ud8c7\udcba\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde3\ud8d7\udcf2\ud8d7\udcda\ud8d9\udd41\ud8e1\udde7.mov"} oo` 33' !-frost2024/06/13 17:16:312026/05/11 21:32:46AS18537S2fe00S1853fS2fe00S38006S14c50S14c58S2e706S2e712M530x543S18537507x458S1853f474x459S14c50505x493S14c58472x493S2e706505x528S2e712471x528Adam Frost{"video":"dominance: equal;\\n\ud8cc\ude18\ud8fc\udc61\ud8cc\ude20\ud8fc\udc61\ud8fc\udc07\ud8c7\udcd1\ud8c7\udcd9\ud8ed\udea7\ud8ed\udeb3.mov"}) 33u !qfrost2024/06/13 17:12:132026/05/11 21:32:30AS10011S30007S10006S20500S22a07S10611S21800M565x521S2ff00482x483S10011516x491S22a07530x488S10611542x468S21800539x459Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f0\udc08\u00d8\ud8d8\udde1\ud8db\udfc8\ud8c0\ude52\ud8da\udd01.mov"} ` 33' !-frost2024/06/13 17:36:562026/05/23 20:54:51AS14c50S2fe00S14c58S2fe00S38006S22510S22510S22a04S22a14M533x533S14c50509x483S14c58467x483S22510510x468S22510468x468S22a04515x518S22a14472x518Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcd1\ud8fc\udc61\ud8c7\udcd9\ud8fc\udc61\ud8fc\udc07\ud8db\uddf1\ud8db\uddf1\ud8db\udfc5\ud8db\udfd5.mov"}  33[ ]!}frost2024/06/13 17:32:342026/05/19 20:46:01AS14e50S2fe00S14e58S2fe00S38006S22f04S22f14M534x525S14e50507x476S14e58467x476S22f04509x511S22f14466x511noun moisture condensed from the atmosphere that falls visibly in separate drops: the rain had not stopped for days | it's pouring rain.
        verb [no object] rain falls: it was beginning to rain.Adam Frost{"video":"dominance: equal;\\n\ud8c7\udd91\ud8fc\udc61\ud8c7\udd99\ud8fc\udc61\ud8fc\udc07\ud8dc\udda5\ud8dc\uddb5.mov"} x33Wm!S frost2024/06/13 17:48:152026/05/23 20:54:18AS14c02S38510S10006S20500S26500S18501S14c50S2fe00S14c58S2fe00S38006S22510S22510S22a04S22a14M533x570S14c02484x467S20500502x486S26500498x450S18501490x431S14c50509x520S14c58467x520S22510510x505S22510468x505S22a04515x555S22a14472x555M529x550S18541499x450S20500496x470S14c50505x501S14c58471x501S22510506x485S22510473x485S22a04511x535S22a14476x535noun, verb a phonological variant (initial 5-hand) of snow.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udc83\ud8fc\uddf1\u00d8\ud8d8\udde1\ud8e1\udde1\ud8cc\udde2\ud8c7\udcd1\ud8fc\udc61\ud8c7\udcd9\ud8fc\udc61\ud8fc\udc07\ud8db\uddf1\ud8db\uddf1\ud8db\udfc5\ud8db\udfd5.mov"} ?? 335 ?!Y frost2024/06/13 17:54:002026/06/01 01:14:03AS18517S33200S10006S20500S2df00S20500M521x542S33100482x483S18517502x502S2df00488x521noun the seed-bearing part of a plant, consisting of reproductive organs (stamens and carpels) that are typically surrounded by a brightly colored corolla (petals) and a green calyx (sepals).
        • a brightly colored and conspicuous example of the flower of a plant together with its stalk, typically used with others as a decoration or gift: I stopped to buy Bridget some flowers.
        Adam Frost{"video":"dominance: right;\\n\ud8cc\uddf8\ud8f4\udec1\u00d8\ud8d8\udde1\ud8ec\udfa1\ud8d8\udde1.mov"}" 33[ !} frost2024/06/13 17:51:382026/05/11 21:33:22AS1f540S2fe00S1f50aS2fe00S21410S20e00S22f00M515x532S1f540496x501S1f50a485x508S20e00497x486S22f00490x469Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8d6\udfeb\ud8fc\udc61\ud8d9\udf91\ud8d9\udd41\ud8dc\udda1.mov"} $$X 33[ w!} frost2024/06/13 17:57:102026/05/03 22:16:56AS14c40S2fe00S14c48S2fe00S38006S2a40cS2a41cM535x534S14c40500x467S14c48465x467S2a40c510x498S2a41c475x498noun the perceptible natural movement of the air, especially in the form of a current of air blowing from a particular direction: the wind howled about the building | an easterly wind | gusts of wind.
        • wind as a source of energy from which power for domestic or industrial use may be generated: carbon-free energy sources like solar and wind.
        • the rush of air caused by a fast-moving body.
        Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcc1\ud8fc\udc61\ud8c7\udcc9\ud8fc\udc61\ud8fc\udc07\ud8e7\udd8d\ud8e7\udd9d.mov"}~  $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|NPRUVWXY [ \ ^ `bcfhknqstwz}!"#$%& ' )*+,-.01234!5$7%8&9':);*<,=->.?0@2A3B4C6D7E9F<G?HAJBKCLDMENFOHQJRKSLTNUPVRWTYVZX[Y\[]]^^__`aacbdcedfegfjglhnjqlrmtnupvrxs|u~vxyz{|}~      "$% hh` 33' !-frost2024/06/13 18:10:552026/05/11 21:35:16AS14c50S2fe00S14c58S2fe00S38006S26504S26514S14e50S14e58M533x541S14c50509x459S14c58467x459S26504514x492S26514472x492S14e50507x510S14e58467x510Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcd1\ud8fc\udc61\ud8c7\udcd9\ud8fc\udc61\ud8fc\udc07\ud8e1\udde5\ud8e1\uddf5\ud8c7\udd91\ud8c7\udd99.mov"} 33O !Yfrost2024/06/13 18:09:382026/05/11 21:34:41AS1f700S30004S10006S20500S2b701S14c00M558x527S2ff00482x483S1f700492x512S2b701517x497S14c00535x484Adam Frost{"video":"dominance: right;\\n\ud8d7\udca1\ud8f0\udc05\u00d8\ud8d8\udde1\ud8e9\udca2\ud8c7\udc81.mov"}" 33[ !} frost2024/06/13 18:02:342026/05/11 21:33:44AS10012S2fe00S10018S2fe00S21414S21100S23604M524x527S10018480x474S10012477x476S21100498x494S23604485x510Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf95\ud8d9\ude61\ud8dd\udc45.mov"}  335 !efrost2024/06/13 19:12:002026/05/11 21:35:31AS10020S2fe00S15a18S2fe00S21406S20600M520x522S15a18491x478S10020505x492S20600480x507Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"}s 335 k!efrost2024/06/13 18:59:452026/06/01 01:15:26AS10e02S2fe00S15a48S2fe00S21406S20600M522x520S15a48479x480S10e02492x493S20600482x509noun an implement with two or more prongs used for lifting food to the mouth or holding it when cutting.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd43\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"} y 33A S!}frost2024/06/13 19:20:432026/06/01 01:21:22AS11541S2fe00S11549S2fe00S21400S20e00S2a304M532x528S11541488x473S11549469x480S2a304509x488noun an instrument composed of a blade fixed into a handle, used for cutting or as a weapon.Adam Frost{"video":"dominance: right;\\n\ud8c2\udc22\ud8fc\udc61\ud8c2\udc2a\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e7\udd25.mov"} b 33g g!frost2024/06/13 19:26:282026/06/01 01:37:52AS17131S2fe00S17139S2fe00S21406S20500S28807S2881fM545x512S17131501x496S17139480x496S28807525x489S2881f456x489noun
        1. a round, deep dish or basin used for food or liquid: a mixing bowl | a sugar bowl.
          • the contents of a bowl: huge bowls of steaming spaghetti.
          • [usually in names] a decorative round dish awarded as a prize in a competition: the McGeorge Rose Bowl.
        2. [in names] a stadium for sporting or musical events: the Hollywood Bowl.
        Adam Frost{"video":"dominance: right;\\n\ud8ca\ude92\ud8fc\udc61\ud8ca\ude9a\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e4\udf08\ud8e4\udf20.mov"} ! 33O !frost2024/06/13 19:49:332026/05/11 21:36:22AS16d20S2fe00S10006S1f720S14020S14a20M515x546S16d20498x454S1f720494x478S14020485x497S14a20499x531Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8ca\udd01\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8c6\udc21\ud8c6\udfe1.mov"} 33A !}frost2024/06/13 19:32:412026/05/11 21:36:07AS15451S2fe00S15a39S2fe00S21400S20500S22a00M516x526S15a39493x503S15451485x493S22a00489x475Adam Frost{"video":"dominance: right;\\n\ud8c7\udfd2\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8db\udfc1.mov"} 33A !}frost2024/06/13 19:30:482026/05/11 21:36:00AS15a40S2fe00S15a39S2fe00S21400S20e00S26e0aM515x532S15a39492x477S15a40490x468S26e0a485x501Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e2\udd4b.mov"} R 33) Y!Afrost2024/06/14 01:05:322025/02/28 00:21:08AS10010S30004S10006S20500S2df00M518x567S2ff00482x483S10010486x512S2df00482x546adjective
        1. having an acid taste like lemon or vinegar: she s 33A !}frost2024/06/13 19:52:582026/05/11 21:36:49AS15451S2fe00S15a39S2fe00S21400S20600S22f00M516x525S15a39493x502S15451485x492S22f00484x475Adam Frost{"video":"dominance: right;\\n\ud8c7\udfd2\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41\ud8dc\udda1.mov"}+ 33A !)frost2024/06/13 19:52:092026/05/11 21:36:37AS16d50S2fe00S15a39S2fe00S21400S20e00S26e0aM518x533S15a39483x467S16d50490x478S26e0a491x502Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ca\udd31\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e2\udd4b.mov"} a small company with big plans.
        2. [attributive] informal doing a specified action very often or on a very large scale: a big eater | a big gambler.
        3. informal showing great enthusiasm: a big tennis fan | he tells me the Inuits of the Arctic are very big on Jim Reeves.
        4. of considerable importance or seriousness: it's a big decision | Mark's biggest problem is money | he made a big mistake.
          • informal popular or exciting interest among the public: Latino bands that are big in Los Angeles.
          • informal holding an important position or playing an influential role: as a senior in college, he was a big man on campus.

        PHONOLOGICAL VARIANTS
        big with upward movementAdam Frost{"video":"dominance: equal;\\n\ud8d5\udca1\ud8fc\udc61\ud8d5\udca9\ud8fc\udc61\ud8fc\udc07\ud8e4\udf06\ud8e4\udf1e.mov"} **R 33C ?!Afrost2024/06/14 01:08:592025/02/28 00:25:15AS14c53S33d00S10006S22513S27103M563x530S33b00482x483S14c53519x490S22513512x512S27103536x474adjective (of food) containing or consisting of pungent spices or peppers which produce a burning sensation when tasted: pasta in a spicy tomato sauce | I love spicy food | Sichuan cuisine is very spicy.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd4\ud8f5\udee1\u00d8\ud8db\uddf4\ud8e2\ude64.mov"}  33A !}frost2024/06/14 01:11:502026/05/11 21:37:40AS14c10S2fe00S10018S2fe00S21400S20500S22510M513x538S10018498x508S14c10487x478S22510488x462Adam Frost{"video":"dominance: right;\\n\ud8c7\udc91\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8db\uddf1.mov"}3 33) m!ofrost2024/06/14 01:10:092026/05/05 17:38:09AS14720S2fe00S10006S14720S1f051M515x538S14720497x463S14720497x489S1f051485x515noun a meal or gathering at which meat, fish, or other food is cooked out of doors on a rack over an open fire or on a portable grill: in the evening there was a barbecue | [as modifier] : a barbecue area.
        • food cooked on a barbecue: all the barbecue he could eat.
        Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udec1\ud8fc\udc61\u00d8\ud8c6\udec1\ud8d6\ude52.mov"} " 33[ !}frost2024/06/14 01:21:302026/05/11 21:38:37AS1f540S2fe00S1f50aS2fe00S21410S20e00S22a00M513x532S1f540498x501S1f50a487x508S20e00499x486S22a00498x468Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8d6\udfeb\ud8fc\udc61\ud8d9\udf91\ud8d9\udd41\ud8db\udfc1.mov"}k 33) !Afrost2024/06/14 01:16:362026/05/11 21:37:50AS12110S33200S10006S20500S21800M518x518S33100482x483S12110471x484S21800469x474Adam Frost{"video":"dominance: right;\\n\ud8c3\udc71\ud8f4\udec1\u00d8\ud8d8\udde1\ud8da\udd01.mov"} ,,P 33Ck]!Afrost2024/06/14 01:23:142026/06/21 19:44:38AS20310S38404S10006S20e00S26a00M538x540S2ff00482x483S20310492x519S20e00518x528S26a00511x512M524x517S1f759502x484S1f751500x496S20600477x494noun
        1. a rock.
          • a small rock: she skipped a pebble across the lake.
        2. a heavy, rough building material made from a mixture of broken stone or gravel, sand, cement, and water, that can be spread or poured into molds and that forms a mass resembling stone on hardening: slabs of concrete
          • a paved path for pedestrians at the side of a road.
        3. a formal dance held by a high school at the end of the academic year, typically for students in their junior or senior year: Ted has a date for the prom | [as modifier] : a prom dress.
        Adam Frost{"video":"dominance: right;\\n\ud8d8\udd31\ud8fc\udd85\u00d8\ud8d9\udd41\ud8e1\udfc1.mov"} ! 33A !}"frost2024/06/14 01:39:072025/02/20 23:47:04AS11551S2fe00S11559S2fe00S21400S20500S22511M524x519S11559477x494S11551497x494S22511485x481noun a white crystalline substance that gives seawater its characteristic taste and is used for seasoning or preserving food.Adam Frost{"video":"dominance: right;\\n\ud8c2\udc32\ud8fc\udc61\ud8c2\udc3a\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8db\uddf2.mov"}" 33[ !}!frost2024/06/14 01:33:382026/05/11 21:39:51AS1f540S2fe00S1f548S2fe00S38005S2e508S26520M516x545S1f548485x470S1f540497x491S2e508493x518S26520493x455Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8d7\udc29\ud8fc\udc61\ud8fc\udc06\ud8ed\udde9\ud8e1\ude01.mov"}" 33[ !} frost2024/06/14 01:25:122026/05/11 21:39:42AS10020S2fe00S14c1aS2fe00S21406S21000S26506M537x518S14c1a464x482S10020491x488S21000498x483S26506522x483Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\ud8c7\udc9b\ud8fc\udc61\ud8d9\udf87\ud8d9\ude01\ud8e1\udde7.mov"} 8$ 33A !}%frost2024/06/19 01:56:222026/05/11 21:40:15AS10013S2fe00S10018S2fe00S21407S28802S20500M527x532S10013477x478S10018474x502S28802505x469Adam Frost{"video":"dominance: right;\\n\ud8c0\udc14\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf88\ud8e4\udf03\ud8d8\udde1.mov"}u#33[7!}$frost2024/06/19 01:54:502026/06/18 16:03:50AS14c51S2fe00S20348S2fe00S21400S20e00S26500M U" 33]7!1#frost2024/06/19 01:53:102026/05/23 21:00:21AS10008S2fe00S10006M508x515S10008493x485M508x515S10000493x485counting number, pronoun a phonological variant (left handed) of one.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc09\ud8fc\udc61\u00d8.mov"}18551491x486M529x517S17648493x501S18551502x488S20710471x483preposition
        1. expressing the situation of something that is or appears to be enclosed or surrounded by something else: she saw it in the rearview mirror | living in Deep River | soak it in warm soapy water.
        2. (often followed by a noun) expressing a state or condition: to be in love.
        3. expressing inclusion or involvement: I read it in a book | acting in a film.
        4. indicating someone's occupation or profession: she works in publishing.
        5. indicating the language or medium used: say it in Polish | put it in writing.
          • indicating the key in which a piece of music is written: Mozart's Piano Concerto in E flat.

        DERIVATIVES
        inside [frequentative]Adam Frost{"video":"dominance: right;\\n\ud8cc\ude32\ud8fc\udc61\ud8cb\udc89\ud8fc\udc61\ud8d9\udf81\ud8d8\udea1.mov"} TK% 33k+!)&frost2024/06/19 01:58:052026/06/08 19:45:38AS10601S30005S10006S20500M536x534S2ff00482x483S10601513x506M541x534S2ff00482x483S10601513x506S21800523x498adverb at a time not long ago: I recently bought a CD player.
        adjective having happened, begun, or been done not long ago or not long before: his recent visit to Britain.

        INFLECTED FORMS
        recently [in isolation]Adam Frost{"video":"dominance: right;\\n\ud8c0\ude42\ud8f0\udc06\u00d8\ud8d8\udde1.mov"} NN.& 33k!e'frost2024/06/19 01:59:072026/08/25 17:15:19AS11541S2fe00S11549S2fe00S21400S20500M522x517S11541498x483S11549479x490M522x525S11541498x491S11549479x498S20600489x476
        verb
        1. to give a name to: hundreds of diseases had not yet been isolated or named | [with object and complement] : she named the child Edward.
        noun
        1. a phonological variant (single movement) of name.
        Adam Frost{"video":"dominance: right;\\n\ud8c2\udc22\ud8fc\udc61\ud8c2\udc2a\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1.mov"} 11K' 33) '!e(frost2024/06/19 02:00:072026/04/23 23:55:47AS10040S2fe00S10006S26500S30a00M518x572S10040493x542S26500493x526S30a00482x483combined form a combination of the pronoun you and the grammatical affix eyebrows up.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc41\ud8fc\udc61\u00d8\ud8e1\udde1\ud8f0\udfc1.mov"} 00 ) 33 a!M*frost2024/06/19 02:02:382026/04/23 23:56:15AS10000S2fe00S10006S30a00M518x551S10000503x521S30a00482x483combined form a combination of one and eyebrows up.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc01\ud8fc\udc61\u00d8\ud8f0\udfc1.mov"}?( 33M g!i)frost2024/06/19 02:01:412026/05/03 22:18:14AS14c30S2fe00S14c38S2fe00S38006S26504S26514S14e30S14e38S30a00M535x600S14c30509x518S14c38467x518S26504513x551S26514472x551S14e30509x569S14e38465x569S30a00482x483combined form a combination of want and eyebrows up.Adam Frost{"video":"dominance: equal;\\nvisible: false;\\n\ud8c7\udcb1\ud8fc\udc61\ud8c7\udcb9\ud8fc\udc61\ud8fc\udc07\ud8e1\udde5\ud8e1\uddf5\ud8c7\udd71\ud8c7\udd79\ud8f0\udfc1.mov"} FF6*33)k!c+frost2024/06/19 02:04:332026/05/26 03:12:08AS10000S30004S10006S20500S2b704M518x542S2ff00482x483S10000486x512S2b704504x518M525x542S2ff00482x483S10000486x512S2b701506x519 S38a00464x490 S38b00470x493 M518x542S2ff00482x483S10008498x512S2b715481x518 S38b04470x493verb [front to center loci] to tell: you told me she was coming | they like telling me jokes.

        PHONOLOGICAL VARIANTS
        tell me left-handedAdam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc01\ud8f0\udc05\u00d8\ud8d8\udde1\ud8e9\udca5.mov"} I?, 33)k5!a-frost2024/06/19 02:06:312026/05/26 03:11:54AS10008S30004S10006S20500S2b715M518x542S2ff00482x483S10008498x512S2b715481x518M518x542S2ff00482x483S10000486x512S2b704504x518verb [front to center loci] a phonological variant (left handed) of tell me.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc09\ud8f0\udc05\u00d8\ud8d8\udde1\ud8e9\udcb6.mov"}3+ 33)k!a,frost2024/06/19 02:05:482026/05/26 03:45:52AS10008S30004S10006S20500S2b710M518x542S2ff00482x483S10008498x512S2b710474x519M525x542S2ff00482x483S10000486x512S2b701506x519verb [to front locus] a phonological variant (left handed) of tell.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc09\ud8f0\udc05\u00d8\ud8d8\udde1\ud8e9\udcb1.mov"} g-33iw!y.frost2024/06/19 02:08:042026/05/18 05:41:58AS10008S30004S10006S20e00S22f14S21800M518x553S2ff00482x483S10008498x511S20e00474x514S22f14468x528S21800471x545M518x553S2ff00482x483S10008498x511S20e00474x514S22a14473x528S21600476x545adjective, noun [in isolation] the color red.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc09\ud8f0\udc05\u00d8\ud8d9\udd41\ud8dc\uddb5\ud8da\udd01.mov"} 77ͅE.33iO!y/frost2024/06/19 02:09:002026/06/05 17:30:25AS10008S30004S10006S20e00S22a14S21600M518x553S2ff00482x483S10008498x511S20e00474x514S22a14473x528S21600476x545M527x553S2ff00482x483S10000487x511S20e00514x514S22a04514x528S21600516x545 S38a00464x490 M518x553S2ff00482x483S10008498x511S20e00474x514S22f14468x528S21800471x545adjective, noun a phonological variant (left handed) of red.

        INFLECTED FORMS
        red [in isolation]Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc09\ud8f0\udc05\u00d8\ud8d9\udd41\ud8db\udfd5\ud8da\udc41.mov"}   0 33Q!!I1frost2024/06/19 02:14:092026/05/24 16:15:13AS10008S2fe00S10006S21d00M512x521S10008497x491S21d00489x480M512x521S10000489x491S21d00494x480number [in isolation] a phonological variant (left handed) of eleven.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc09\ud8fc\udc61\u00d8\ud8da\udee1.mov"}M/ 33 !)0frost2024/06/19 02:13:212026/05/26 03:46:21AS10051S2fe00S10006S26501M519x520S10051489x499S26501481x480verb [center to left front loci] to move to a place or position: at the fork, go left | at the stop sign, veer left.
        adverb [at left front locus] in, at, or to a place or position: put the box there.
        preposition [at left front locus] expressing location or arrival in a place or position: I work at the store.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc52\ud8fc\udc61\u00d8\ud8e1\udde2.mov"} s2 33Qu!I3frost2024/06/19 02:26:072026/05/24 16:29:34AS10008S2fe00S10006S2ea1eM513x524S10008493x494S2ea1e488x476M513x524S10000491x494S2ea06488x476adverb a phonological variant (left handed) of always.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc09\ud8fc\udc61\u00d8\ud8ed\udfdf.mov"}u1 33Qy!I2frost2024/06/19 02:22:422026/05/24 16:13:59AS10008S2fe00S10006S21b00M509x521S10008494x491S21b00491x480M509x521S10000491x491S21b00501x480number a phonological variant (left handed) of eleven.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc09\ud8fc\udc61\u00d8\ud8da\ude21.mov"} >>ƅ>333AA!4frost2024/06/19 02:27:512026/05/26 21:54:34AS10020S2fe00S10008S2fe00S21414S26500S20500M511x528S10008490x473S10020496x480S26500497x513M516x515S10010501x485S10018485x485 S38a00464x490 S38b00470x493 M511x528S10000496x473S10028490x480S26510490x513 S38b04470x493verb [center to front loci] to meet: a week later I met you on the street.

        PHONOLOGICAL VARIANTS
        meet left-handedAdam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc21\ud8fc\udc61\ud8c0\udc09\ud8fc\udc61\ud8d9\udf95\ud8e1\udde1\ud8d8\udde1.mov"} >>ƅ>433AA!5frost2024/06/19 02:30:232026/05/26 21:53:16AS10000S2fe00S10028S2fe00S21410S26504S20500M514x528S10000493x491S10028487x498S26504500x473M516x515S10010501x485S10018485x485 S38a00464x490 S38b00470x493 M514x528S10008493x491S10020499x498S26514487x473 S38b04470x493verb [front to center loci] to meet: a week later he met me on the street.

        PHONOLOGICAL VARIANTS
        meet left-handedAdam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc01\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8d9\udf91\ud8e1\udde5\ud8d8\udde1.mov"} t633go!77frost2024/06/19 02:36:142026/05/26 22:06:30AS14c01S2fe00S15a28S2fe00S21410S20500S26500S18501M517x536S14c01491x502S15a28484x509S26500495x484S18501489x465M541x514S15a18460x487S14c11467x486S26506497x499S18510516x499verb [center to front loci] to copy (verb).Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udc82\ud8fc\udc61\ud8c8\udde9\ud8fc\udc61\ud8d9\udf91\ud8d8\udde1\ud8e1\udde1\ud8cc\udde2.mov"}f5 33Ak/!6frost2024/06/19 02:31:332026/05/26 03:47:33AS10028S2fe00S10000S2fe00S21414S26510S20500M511x528S10000496x473S10028490x480S26510490x513M511x528S10008490x473S10020496x480S26500497x513verb [center to front loci] a phonological variant (left handed) of meet.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc29\ud8fc\udc61\ud8c0\udc01\ud8fc\udc61\ud8d9\udf95\ud8e1\uddf1\ud8d8\udde1.mov"} t733go!78frost2024/06/19 02:52:372026/05/26 22:07:39AS14c21S2fe00S15a08S2fe00S21414S20500S26504S18527M516x543S15a08484x458S14c21487x470S26504500x499S18527497x516M541x514S15a18460x487S14c11467x486S26506497x499S18510516x499verb [front to center loci] to copy (verb).Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udca2\ud8fc\udc61\ud8c8\uddc9\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1\ud8e1\udde5\ud8cc\ude08.mov"} O9 33]7!1:frost2024/06/19 02:56:552026/05/24 17:05:10AS17618S2fe00S10006M508x508S17618492x492M508x508S17610492x492counting number a phonological variant (left handed) of zero.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8cb\udc59\ud8fc\udc61\u00d8.mov"}$833gO!79frost2024/06/19 02:53:512026/05/27 15:23:04AS14c31S2fe00S15a1aS2fe00S21404S20500S22a04S1853dM517x539S15a1a483x462S14c31485x474S22a04498x504S1853d490x520M541x514S15a18460x487S14c11467x486S26506497x499S18510516x499verb [center to bottom loci] to copy (verb): she copied the reports for the meeting.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udcb2\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8d9\udf85\ud8d8\udde1\ud8db\udfc5\ud8cc\ude1e.mov"} eJ< 33]7{!3=frost2024/06/19 02:59:502026/05/24 17:27:10AS1f020S2fe00S10006M515x508S1f020486x493M515x508S1f000486x493noun a phonological variant (palm facing forward) of G.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d6\ude21\ud8fc\udc61\u00d8.mov"}J; 33]7{!3noun a phonological variant (knuckles facing upward) G.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d6\ude11\ud8fc\udc61\u00d8.mov"}I: 33]7{!1;frost2024/06/19 02:57:562026/05/24 17:09:59AS17628S2fe00S10006M508x508S17628492x492M508x508S17620492x492noun, number a phonological variant (left handed) of O.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8cb\udc69\ud8fc\udc61\u00d8.mov"} fJ? 33]7}!1@frost2024/06/19 03:02:262026/05/24 17:44:35AS1f028S2fe00S10006M515x508S1f028486x493M515x508S1f008486x493noun a phonological variant (palm facing forward) of G.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8d6\ude29\ud8fc\udc61\u00d8.mov"}M> 33]7!1?frost2024/06/19 03:01:102026/05/24 17:44:00AS1f018S2fe00S10006M515x508S1f018486x493M515x508S1f008486x493noun a phonological variant (knuckles facing upward) of G.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8d6\ude19\ud8fc\udc61\u00d8.mov"}E= 33]7q!3>frost2024/06/19 03:00:252026/05/24 17:34:47AS1dc02S2fe00S10006M515x512S1dc02485x488M515x508S1f000486x493noun a phonological variant (thumb extended) of G.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d4\ude83\ud8fc\udc61\u00d8.mov"} bbQA33[=7!}Bfrost2024/06/19 03:36:552026/05/19 20:58:15AS15a10S2fe00S15a18S2fe00S38006S26a02S26a16M544x515S15a10514x486S15a18474x486S26a02530x488S26a16456x488S38b00470x493 M545x514S15a10514x487S15a18474x487S26502530x495S26516455x495 S38b04470x493adjective [predicative] of a size that is less than normal or usual: the room was small and quiet.
        • not great in amount, number, strength, or power: the pay is small.
        Adam Frost{"video":"dominance: equal;\\n\ud8c8\uddd1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8fc\udc07\ud8e1\udfc3\ud8e1\udfd7.mov"}E@ 33]7s!1Afrost2024/06/19 03:05:552026/05/24 17:45:06AS1dc0aS2fe00S10006M515x512S1dc0a485x488M515x508S1f008486x493noun a phonological variant (thumb extended) of G.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8d4\ude8b\ud8fc\udc61\u00d8.mov"}a hedge is what you want.
        • to make a choice from a number of alternatives: she had decided on her plan of action | I've decided against having children.
        • to give a judgment concerning a matter or legal case: the courts decided in favor of the New York claimants | [with object] : the judge will decide the case.
        • [with object] to come to a decision about (something): we must decide the fates of the people who headed the coup.
        noun a plan or opinion formed after consideration: I'll make the decision on my own | the editor's decision is final.
        • the action or process of deciding something or of resolving a question: the information was used as the basis for decision.
        • a formal judgment: last year's Supreme Court decision.
        Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f0\udc08\u00d8\ud8d8\udde1\ud8d3\udd81\ud8fc\udc61\ud8d3\udd89\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5.mov"} "B33[=!}Cfrost2024/06/19 03:37:522026/05/20 21:05:43AS1e140S2fe00S1e148S2fe00S38006S28805S2881dM536x525S1e140512x475S1e148466x475S28805516x505S2881d465x505S38b00470x493 M559x513S1e140511x487S1e148465x487S2880a537x494S28812441x494 S38b04470x493adjective
        1. of considerable size, extent, or intensity: big hazel eyes | big buildings | big cuts in staff.
          • [attributive] of a large or the largest size: my big toe.
          • informal on an ambitiously large scale:/ 7.C33I!7Dfrost2024/06/19 03:38:372026/10/07 16:08:24AS1821dS2fe00S15a16S2fe00S21400S20e00S2880fS2880fM532x522S15a16505x510S1821d503x497S20e00491x500S2880f468x501S2880f468x479M532x517S15a16505x505S1821d503x492S20e00491x495S2880f468x484
            adjective
            1. [in isolation] new.
            Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8cc\udcde\ud8fc\udc61\ud8c8\uddd7\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e4\udf10\ud8e4\udf10.mov"} BB:D33)u!aEfrost2024/06/19 03:53:552026/05/21 01:14:39AS11508S30001S10006S20500S22114M518x518S2ff00482x483S11508474x462S22114467x454M532x518S2ff00482x483S11500510x461S11508474x462S22114506x454S22114467x454noun a phonological variant (left handed) of rabbit.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c1\udfe9\ud8f0\udc02\u00d8\ud8d8\udde1\ud8db\udc75.mov"} NFE 33[ S!}Ffrost2024/06/19 03:58:422026/05/19 21:01:10AS1ce50S2fe00S15a38S2fe00S21400S20e00S26500M516x532S15a38485x499S1ce50494x502S20e00497x487S26500496x469verb
            1. [with object] to determine the total number of (a collection of items): I counted the stars I could see.
            2. [no object] to recite numbers in ascending order, usually starting at the number one: hold the position as you count.
            Adam Frost{"video":"dominance: right;\\n\ud8d3\udd91\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde1.mov"} TT(F 33Q !Gfrost2024/06/19 04:01:232026/05/18 06:40:56AS18220S2fe00S15a1aS2fe00S21414S20500M516x514S15a1a489x502S18220485x486M513x516S2031a498x501S18220487x485noun, adverb a phonological variant (flat base hand) of night.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8cc\udce1\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8d9\udf95\ud8d8\udde1.mov"} 4qH 33k#!eIfrost2024/06/19 04:11:102026/06/15 19:26:09AS18551S2fe00S17648S2fe00S21400S20700M518x515S17648482x499S6HG 33 !)Hfrost2024/06/19 04:09:572026/05/26 03:48:30AS10041S2fe00S10006S26501M521x520S10041500x490S26501480x481pronoun [at left front locus] used to refer to a person or thing: my sister told me that she was not happy.
            determiner [at left front locus] used to indicate to a person or thing: do you see that man?.
            adverb [at left front locus] in, at, or to a place or position: the car is over there.
            preposition [at left front locus] expressing location or arrival in a place or position: I saw a woman at the house.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc42\ud8fc\udc61\u00d8\ud8e1\udde2.mov"}83S14721494x512S20b00515x510S38b00470x493 M528x535S2ff00482x483S15a21495x512S20b00515x510 S38b04470x493 S38a00464x490 M543x533S2ff00482x483S14721494x512S20c00515x510verb to cause (someone) to feel upset or annoyed, typically as a result of being unable to change or achieve something: it frustrated me that more couldn't be done for her.
            adjective feeling or expressing distress and annoyance, especially because of inability to change or achieve something: young people get frustrated with the system.

            PHONOLOGICAL VARIANTS
            frustrated with thumb extended

            DERIVATIVES
            frustration [frequentative]Adam Frost{"video":"dominance: right;\\n\ud8c6\udec2\ud8f0\udc05\u00d8\ud8d9\udc21.mov"} f)J33!KKfrost2024/06/19 04:44:192026/05/24 18:02:11AS18517S30005S10006S20600M548x536S2ff00482x483S18517512x509S20600526x506M553x536S2ff00482x483S18517512x509S20600531x504S26504535x518noun, adjective a phonological variant (no displacement) of home.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8cc\uddf8\ud8f0\udc06\u00d8\ud8d8\ude41.mov"}I 33Q;!IJfrost2024/06/19 04:40:182026/05/24 17:54:40AS10008S2fe00S10006S27112M517x522S10008502x479S27112484x482M517x522S10000484x479S27106502x482pronoun, determiner, adjective, adverb a phonological variant (left handed) of someone.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc09\ud8fc\udc61\u00d8\ud8e2\ude73.mov"} ``K33!KLfrost2024/06/19 04:45:012026/05/24 18:02:48AS18517S30005S10006S20500M531x536S2ff00482x483S18517512x509M553x536S2ff00482x483S18517512x509S20600531x504S26504535x518noun, adjective a phonological variant (single movement) of home.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8cc\uddf8\ud8f0\udc06\u00d8\ud8d8\udde1.mov"} H?L33Oa!yMfrost2024/06/19 04:46:002026/05/24 18:08:25AS1851fS30003S10006S20500S26514S20500M518x536S2ff00482x483S1851f467x509S20600445x504S26514449x518M553x536S2ff00482x483S18517512x509S20600531x504S26504535x518 S38a00464x490 S38b00470x493 M518x536S2ff00482x483S1851f467x509S20600450x506 M518x536S2ff00482x483S1851f467x509 S38b04470x493noun, adjective a phonological variant (left handed) of home.

            PHONOLOGICAL VARIANTS
            home with no displacement
            home with single movementAdam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8cc\ude00\ud8f0\udc04\u00d8\ud8d8\udde1\ud8e1\uddf5\ud8d8\udde1.mov"} SN33!IOfrost2024/06/19 04:49:032026/05/24 18:05:24AS1851fS30003S10006S20500M518x536S2ff00482x483S1851f467x509M518x536S2ff00482x483S1851f467x509S20600445x504S26514449x518noun, adjective a phonological variant (single movement) of home.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8cc\ude00\ud8f0\udc04\u00d8\ud8d8\udde1.mov"})M33!INfrost2024/06/19 04:48:072026/05/24 18:04:49AS1851fS30003S10006S20600M518x536S2ff00482x483S1851f467x509S20600450x506M518x536S2ff00482x483S1851f467x509S20600445x504S26514449x518noun, adjective a phonological variant (no displacement) of home.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8cc\ude00\ud8f0\udc04\u00d8\ud8d8\ude41.mov"} y~P 33Q !IQfrost2024/06/19 04:54:562026/05/24 20:44:06AS10628S2fe00S10006S22e14M511x524S10628490x477S22e14489x506M511x524S10620489x477S22e04494x506verb, modal verb a phonological variant (left handed) of need.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\ude69\ud8fc\udc61\u00d8\ud8dc\udd55.mov"}O 33Q!IPfrost2024/06/19 04:53:162026/05/24 20:46:00AS10628S2fe00S10006S23014M513x524S10628492x477S23014487x506M513x524S10620487x477S23004488x506noun, verb, modal verb a phonological variant (left handed) of need.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\ude69\ud8fc\udc61\u00d8\ud8dc\ude15.mov"} m R33s!ISfrost2024/06/19 04:59:592026/05/24 21:16:19AS11548S2fe00S10006S22f14M513x524S11548494x477S22f14488x510M533x524S11540512x477S11548473x477S22f04508x510S22f14467x510verb a phonological variant (left handed) of hurry.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c2\udc29\ud8fc\udc61\u00d8\ud8dc\uddb5.mov"}Q33u!KRfrost2024/06/19 04:59:242026/05/24 21:16:33AS11540S2fe00S10006S22f04M513x524S11540492x477S22f04488x510M533x524S11540512x477S11548473x477S22f04508x510S22f14467x510verb a phonological variant (right handed) of hurry.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c2\udc21\ud8fc\udc61\u00d8\ud8dc\udda5.mov"} d1dIT335}!Ufrost2024/06/19 05:02:282026/05/24 21:23:33AS20358S2fe00S20350S2fe00S38006S23010M529x518S20358475x503S20350514x503S23010471x482M532x518S20350512x503S20358473x503S23000507x482S23010469x482noun a phonological variant (left handed) of motorcycle.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8d8\udd79\ud8fc\udc61\ud8d8\udd71\ud8fc\udc61\ud8fc\udc07\ud8dc\ude11.mov"}KS335!Tfrost2024/06/19 05:01:102026/05/24 21:23:02AS20350S2fe00S20358S2fe00S38006S23000M530x518S20350510x503S20358471x503S23000505x482M532x518S20350512x503S20358473x503S23000507x482S23010469x482noun a phonological variant (right handed) of motorcycle.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d8\udd71\ud8fc\udc61\ud8d8\udd79\ud8fc\udc61\ud8fc\udc07\ud8dc\ude01.mov"} Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx2132435465768798:9;:<;=<>=?>@?A@BACBDCEDFEGFHGIHJIKJLKMLNMONPOQPRQSRTSUTVUWVXWYXZY[Z\[]\^]_^`_a`bacbdcedfegfhgihjikjlkmlnmonpoqprqsrtsutvuwvxwyxzy{z|{}|~}~  V33g !7Wfrost2024/06/19 05:08:502026/08/16 20:47:32AS15a50S2fe00S15a5aS2fe00S21400S20500S26504S1f720M514x536S15a5a487x464S15a50497x473S26504496x503S1f720490x521M510x536S2035a490x464S15a50497x473S26504496x503S1f720490x521verb a phonological variant (flat base hand) of summon/stroke.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c8\ude11\ud8fc\udc61\ud8c8\ude1b\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udde5\ud8d7\udcc1.mov"}\U 33Q)!iVfrost2024/06/19 05:07:522026/05/31 00:43:17AS15a28S2fe00S10006S26501M513x520S15a28501x493S26501488x481M513x520S15a28488x493S26507500x481possessive determiner [at left front locus] his/her/their/its.
            possessive pronoun [at left front locus] his/hers/theirs.Adam Frost{"video":"dominance: right;\\nvisible: sign;"} f3fIX 33Aku!Yfrost2024/06/19 05:13:132026/05/27 15:22:24AS10018S2fe00S10011S2fe00S21400S20500S2c311M519x543S10011498x513S10018486x483S2c311482x457M519x543S10019482x513S10010501x483S2c300493x457noun a phonological variant (left handed) of minute.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc19\ud8fc\udc61\ud8c0\udc12\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8ea\udd32.mov"}IW 33Aku!Xfrost2024/06/19 05:11:022026/05/24 21:36:35AS10018S2fe00S15a10S2fe00S21402S20500S2c311M515x538S15a10503x511S10018489x489S2c311485x463M515x538S15a18486x511S10010497x489S2c300489x463noun a phonological variant (left handed) of minute.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc19\ud8fc\udc61\ud8c8\uddd1\ud8fc\udc61\ud8d9\udf83\ud8d8\udde1\ud8ea\udd32.mov"} {Y33[SS!Zfrost2024/06/19 05:17:002026/06/15 17:41:09AS10020S2fe00S10028S2fe00S38007S2b700S2b711M522x532S10020507x495S10028479x502S2b700502x469S2b711480x476M522x528S10020507x498S10028479x498S2b700502x472S2b711480x472 S38a00464x490 S38b00470x493 M522x534S10028479x493S10020507x504S2b711480x467S2b700502x478 S38b04470x493verb [center to front loci] a phonological variant (right hand away from body) of go to.

            PHONOLOGICAL VARIANTS
            go to left-handedAdam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc21\ud8fc\udc61\ud8c0\udc29\ud8fc\udc61\ud8fc\udc08\ud8e9\udca1\ud8e9\udcb2.mov"} IOI[33[1!\frost2024/06/19 05:19:062026/06/15 17:42:14AS10028S2fe00S10020S2fe00S38001S2b711S2b700M522x534S10028479x493S10020507x504S2b711480x467S2b700502x478M522x532S10020507x495S10028479x502S2b700502x469S2b711480x476verb [center to front loci] a phonological variant (left handed) of go to.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc29\ud8fc\udc61\ud8c0\udc21\ud8fc\udc61\ud8fc\udc02\ud8e9\udcb2\ud8e9\udca1.mov"}-Z331!K[frost2024/06/19 05:18:132026/06/15 17:41:32AS10020S2fe00S10006S2b700M510x528S10020495x498S2b700490x472M522x528S10020507x498S10028479x498S2b700502x472S2b711480x472verb [center to front loci] a phonological variant (right handed) of go to.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8e9\udca1.mov"} ?Q?]33[I!^frost2024/06/19 05:34:042026/05/26 03:13:53AS10008S2fe00S10000S2fe00S38003S2b715S2b704M519x533S10008482x476S10000504x467S2b715485x509S2b704502x500M519x533S10000504x476S10008482x467S2b704502x509S2b715485x500verb [front to center loci] a phonological variant (left hand closer to body) of come.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc09\ud8fc\udc61\ud8c0\udc01\ud8fc\udc61\ud8fc\udc04\ud8e9\udcb6\ud8e9\udca5.mov"}+\33/!I]frost2024/06/19 05:20:492026/06/15 17:42:49AS10028S2fe00S10006S2b711M510x528S10028490x498S2b711491x472M522x528S10020507x498S10028479x498S2b700502x472S2b711480x472verb [center to front loci] a phonological variant (left handed) of go to.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc29\ud8fc\udc61\u00d8\ud8e9\udcb2.mov"} PP,^33/!K_frost2024/06/19 05:34:512026/05/26 03:14:11AS10000S2fe00S10006S2b704M509x529S10000494x472S2b704492x505M519x529S10000504x472S10008482x472S2b704502x505S2b715485x505verb [front to center loci] a phonological variant (right handed) of come.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc01\ud8fc\udc61\u00d8\ud8e9\udca5.mov"} _33[Si!`frost2024/06/19 05:35:272026/05/26 03:14:23AS10000S2fe00S10008S2fe00S38005S2b704S2b715M519x533S10000504x476S10008482x467S2b704502x509S2b715485x500M519x529S10000504x472S10008482x472S2b704502x505S2b715485x505 S38a00464x490 S38b00470x493 M519x533S10008482x476S10000504x467S2b715485x509S2b704502x500 S38b04470x493verb [front to center loci] a phonological variant (right hand closer to body) of come.

            PHONOLOGICAL VARIANTS
            come left hand closer to bodyAdam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc01\ud8fc\udc61\ud8c0\udc09\ud8fc\udc61\ud8fc\udc06\ud8e9\udca5\ud8e9\udcb6.mov"} RMa 333 A!Ebfrost2024/06/19 05:46:282026/05/03 22:22:10AS1e150S2fe00S1e158S2fe00S21406S20500S21800S21800S26500S26510M526x529S1e158474x503S1e150502x503S21800501x492S21800481x492S26500502x472S26510481x472verb dated to run.Adam Frost{"video":"dominance: equal;\\n\ud8d5\udcb1\ud8fc\udc61\ud8d5\udcb9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8da\udd01\ud8da\udd01\ud8e1\udde1\ud8e1\uddf1.mov"}*`33-!Iafrost2024/06/19 05:36:462026/05/26 03:14:32AS10008S2fe00S10006S2b715M509x529S10008492x472S2b715495x505M519x529S10000504x472S10008482x472S2b704502x505S2b715485x505verb [front to center loci] a phonological variant (left handed) of come.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc09\ud8fc\udc61\u00d8\ud8e9\udcb6.mov"} --ec 33m?!Gdfrost2024/07/01 15:18:382026/05/03 23:57:17AS20300S2fe00S10006S10000M508x525S20300493x476S10000493x495M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M509x521S10000491x491S21b00501x480 S38800464x496You might be looking for eleven.Adam Frost{"video":"dominance: right;"}fb 33Ak/!cfrost2024/06/21 00:50:142026/05/26 03:14:41AS10008S2fe00S10020S2fe00S21410S26514S20500M514x528S10008493x491S10020499x498S26514487x473M514x528S10000493x491S10028487x498S26504500x473verb [front to center loci] a phonological variant (left handed) of meet.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc09\ud8fc\udc61\ud8c0\udc21\ud8fc\udc61\ud8d9\udf91\ud8e1\uddf5\ud8d8\udde1.mov"}  d 33Om;!Gefrost2024/07/01 15:20:242026/05/03 23:57:26AS20300S2fe00S10006S10000S20300S10000M508x551S20300493x449S10000493x468S20300493x502S10000493x521M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M512x521S10000489x491S21d00494x480 S38800464x496You might be looking for eleven.Adam Frost{"video":"dominance: right;"} ge33[y!ffrost2024/07/01 16:06:322026/05/29 17:08:40AS1851cS2fe00S15a39S2fe00S21400S20e00S2b707M536x528S15a39464x505S1851c476x501S20e00501x489S2b707511x473M531x526S15a39469x503S1851c481x499S20e00506x487S26507518x474verb a phonological variant (arched movement) of buy.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8cc\uddfd\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e9\udca8.mov"} 7f33#![gfrost2024/07/03 18:52:542026/05/26 01:31:23AS10011S30007S10006S20500S10041S2fe00S10018S2fe00S38005S26501M537x521S2ff00482x483S10011516x491S26501512x474S10041493x446S10018478x438S38b00470x493 M524x523S10018476x478S10041491x481S26501511x510 S38b04470x493noun a phonological variant (contact on forehead) of goal.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc12\ud8f0\udc08\u00d8\ud8d8\udde1\ud8c0\udc42\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8fc\udc06\ud8e1\udde2.mov"} UMg33u3!}hfrost2024/07/03 19:51:112026/06/16 19:39:04AS1f702S38517S1f70aS38511S20e00S22f00S22f10M531x519S1f70a474x499S1f702511x499S20e00494x492S22f00506x482S22f10469x482M527x519S1f70a474x499S1f702512x499S21100494x491S22a00513x481S22a10475x481noun [frequentative] the particulars of the place where someone lives or an organization is situated: they exchanged addresses and agreed to keep in touch.
            • the place where someone lives or an organization is situated: our officers went to the address.
            • a string of characters that identifies a destination for email messages or the location of a website.
            Adam Frost{"video":"dominance: equal;\\n\ud8d7\udca3\ud8fc\uddf8\ud8d7\udcab\ud8fc\uddf2\ud8d9\udd41\ud8dc\udda1\ud8dc\uddb1.mov"} )O)"j 33[ !}kfrost2024/07/03 20:25:022026/05/11 21:55:04AS10020S2fe00S14c1aS2fe00S21406S20700S22a04M526x528S14c1a474x474S10020501x480S20700508x472S22a04502x513Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\ud8c7\udc9b\ud8fc\udc61\ud8d9\udf87\ud8d8\udea1\ud8db\udfc5.mov"}i 33[ U!}jfrost2024/07/03 20:21:452025/03/21 17:59:40AS10020S2fe00S14c1aS2fe00S21406S22a00S20700M526x528S14c1a474x474S10020501x480S22a00502x513S20700508x472verb to arrive at a place; to make a visit: by ten o'clock Bill still hadn't appeared.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\ud8c7\udc9b\ud8fc\udc61\ud8d9\udf87\ud8db\udfc1\ud8d8\udea1.mov"}"h 33[ !}ifrost2024/07/03 20:13:262026/05/11 21:54:37AS15a40S2fe00S15a48S2fe00S38006S2d200S2d211M530x527S15a40510x473S15a48479x473S2d200504x504S2d211471x504Adam Frost{"video":"dominance: equal;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc07\ud8eb\udec1\ud8eb\uded2.mov"} rl 333 !Emfrost2024/07/04 16:36:262026/05/03 22:22:38AS14c02S2fe00S14c0aS2fe00S21406S26502S26516S20302S2030aS20500M568x512S14c02537x489S14c0a432x489S26502519x493S26516466x493S20302501x492S2030a484x492verb (of a vehicle) to hit with force when moving, especially with another vehicle: two suburban trains collided.Adam Frost{"video":"dominance: equal;\\n\ud8c7\udc83\ud8fc\udc61\ud8c7\udc8b\ud8fc\udc61\ud8d9\udf87\ud8e1\udde3\ud8e1\uddf7\ud8d8\udd23\ud8d8\udd2b\ud8d8\udde1.mov"}k 33A !}lfrost2024/07/04 16:30:452026/05/11 21:55:12AS1f540S2fe00S1f548S2fe00S21414S2d50aS20500M525x517S1f548476x483S1f540487x493S2d50a506x499Adam Frost{"video":"dominance: right;\\n\ud8d7\udc21\ud8fc\udc61\ud8d7\udc29\ud8fc\udc61\ud8d9\udf95\ud8eb\udfeb\ud8d8\udde1.mov"} n 33g E!ofrost2024/07/04 17:14:572026/05/03 23:45:52AS14e11S2fe00S14e19S2fe00S21406S20700S22e04S22e14M530x524S14e11500x476S14e19472x476S22e04513x506S22e14471x506verb (of a structure) to fall in or give way: the roof collapsed on top of me.Adam Frost{"video":"dominance: left;\\n\ud8c7\udd52\ud8fc\udc61\ud8c7\udd5a\ud8fc\udc61\ud8d9\udf87\ud8d8\udea1\ud8dc\udd45\ud8dc\udd55.mov"}Sm 33 !-nfrost2024/07/04 16:42:052026/05/11 21:55:21AS14c40S2fe00S14c48S2fe00S21414S26500S21600S20340S20500M516x555S14c40492x524S14c48484x456S26500497x506S21600492x446S20340497x488Adam Frost{"video":"dominance: right;\\n\ud8c7\udcc1\ud8fc\udc61\ud8c7\udcc9\ud8fc\udc61\ud8d9\udf95\ud8e1\udde1\ud8da\udc41\ud8d8\udd61\ud8d8\udde1.mov"}g him a message?             | if I could trouble you for your names?.
          • expressing an opinion: that's an awfully long walk, if you don't mind my saying so | if you ask me, he's in love.
          • expressing surprise or regret: well, if it isn't Frank! | if I could just be left alone.
          • (with implied reservation) and perhaps not: the new leaders have little if any control.
            • used to admit something as being possible but regarded as relatively insignificant: if there was any weakness, it was naiveté | so what if he did?.
        noun
        1. a condition: there are so many ifs and buts in the policy.
        SIGN VARIATIONS
        if I-hand under eye
        Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cd\udee1\ud8fc\udc61\u00d8\ud8d3\udd61.mov"} fsfq 33k !Krfrost2024/07/04 17:29:382026/05/26 01:56:57AS15a21S30004S10006S20b00M528x535S2ff00482x483S15a21495x512S20b00515x510M528x533S2ff00482x483S14721494x512S20b00515x510adjective a phonological variant (thumb extended) of frustrate.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c8\udde2\ud8f0\udc05\u00d8\ud8d9\udc21.mov"}lp33!)qfrost2024/07/04 17:27:522026/06/05 17:54:14AS14721S30004S10006S20b00M528x533S2ff00482x4Po 33? !Qpfrost2024/07/04 17:21:202026/06/18 19:21:37AS10011S30007S10006S20500S1ce40S2fe00S1ce48S2fe00S38006S22a04S22a14M537x578S2ff00482x483S10011516x491S1ce40508x530S1ce48470x530S22a04510x563S22a14477x563verb to form a plan or opinion in the mind as a result of consideration: [with infinitive] : they decided to appoint someone else | [with clause] : you've decided that Iposed or imagined for consideration: if you have a complaint, write to the director | if you like I'll put in a word for you.
        • [with past tense] introducing a hypothetical situation: if you had stayed, this would never have happened.
        • whenever; every time: if I go out she gets nasty.
      3. despite the possibility that; no matter whether: if it takes me seven years, I shall do it.
      4. (often used in indirect questions) whether: he asked if we would like some coffee | see if you can track it down.
    SIGN VARIATIONS
    if fingerspelled
    INFLECTED FORMS
    if [in isolation]
    Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8cd\udec1\ud8f0\udc07\u00d8\ud8d8\udde1.mov"} ynr33!!)sfrost2024/07/04 17:31:162026/06/05 19:01:14AS14721S30004S10006S20c00M543x533S2ff00482x483S14721494x512S20c00515x510M528x533S2ff00482x483S14721494x512S20b00515x510 S38a00464x490 S38b00470x493 M543x535S2ff00482x483S15a21495x512S20c00515x510 S38b04470x493noun [frequentative] the feeling of being frustrated, especially because of inability to change or achieve something: you can understand my frustration.
    • an event or circumstance that causes one to have a feeling of frustration: the inherent frustrations of assembly line work.

    PHONOLOGICAL VARIANTS
    frustration with thumb extendedAdam Frost{"video":"dominance: right;\\n\ud8c6\udec2\ud8f0\udc05\u00d8\ud8d9\udc81.mov"} Z5t 335 o!eufrost2024/07/04 17:53:432026/06/17 23:15:30AS10e20S2fe00S10e28S2fe00S38005S2c820M517x538S10e20502x508S10e28484x492S2c820486x462noun the ceremonies honoring a dead person, typically involving burial or cremation: in the afternoon, he'd attended a funeral | [as modifier] : a funeral service.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd61\ud8fc\udc61\ud8c1\udd69\ud8fc\udc61\ud8fc\udc06\ud8ea\udf21.mov"}"s 33k!Ktfrost2024/07/04 17:32:472026/05/26 02:08:12AS15a21S30004S10006S20c00M543x535S2ff00482x483S15a21495x512S20c00515x510M543x533S2ff00482x483S14721494x512S20c00515x510noun, adjective a phonological variant (thumb extended) of frustration.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c8\udde2\ud8f0\udc05\u00d8\ud8d9\udc81.mov"} 4u 33g !vfrost2024/07/04 18:16:422026/05/11 21:56:31AS15a41S2fe00S15a49S2fe00S21406S20500S2d508S2d510M541x513S15a41501x490S15a49477x490S2d508519x487S2d510460x487Adam Frost{"video":"dominance: equal;\\n\ud8c8\ude02\ud8fc\udc61\ud8c8\ude0a\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8eb\udfe9\ud8eb\udff1.mov"}S15a40496x487S15a48473x487S26526513x495noun
    1. a detailed proposal for doing or achieving something: the UN peace plan.
      • [with modifier] a program that facilitates the regular payment of contributions toward a pension, savings account, or insurance policy: a personal pension plan.
    2. an intention or decision about what one is going to do: I have no plans to retire.
    verb
    1. to decide on and arrange in advance: they were planning a trip to Egypt | [with infinitive] : he plans to fly on Wednesday | [no object] : we plan on getting married in the near future | we have to plan for the future.
    2. to design or make a plan of (something to be made or built): they were planning a garden.
    Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc07\ud8e1\ude07.mov"} 3 v 33Q!Wwfrost2024/07/04 18:18:052026/09/24 23:05:54AS19220S2fe00S10006S1ce20M511x527S19220490x474S1ce20489x497M530x519S2ff00482x483S19200509x500
    conjunction
    1. introducing a condition on which something depends or follows: if you have a complaint, write to the director | if you like I'll put in a word for you.
      • whenever; every time: if I go out she gets nasty.
      • despite the possibility that; no matter whether: if it takes me seven years, I shall do it.
    2. (often used in indirect questions) whether: he asked if we would like some coffee | see if you can track it down.
    3. [with modal] expressing a polite request: if you wouldn't mind giviniS15a39471x479S11041476x496S20710496x484noun
      1. a piece of paper or card (or an electronic equivalent) that gives the holder a certain right, especially to enter a place, travel by public transport, or participate in an event: admission is by ticket only.
        • a piece of paper or card bought as a way of entering a lottery or raffle: the winning ticket was bought in Anaheim, California.
      2. an official notice of a traffic offense: the officer issued Rhodes a speeding ticket.
      3. a list of candidates put forward by a party in an election: his presence on the Republican ticket.
      4. a request logged on a work tracking system detailing an issue that needs to be addressed or task that must be performed: a help desk ticket | they closed the ticket without doing anything.
      Adam Frost{"video":"dominance: right;\\n\ud8c1\ude42\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf96\ud8d8\udeb1.mov"} Ex 33QQ!wyfrost2024/07/04 18:24:302026/09/24 23:07:45AS19200S30006S10006S20600M543x519S2ff00482x483S19200509x500S20600521x491M530x519S2ff00482x483S19200509x500
      conjunction
      1. [in isolation] if.
      Adam Frost{"video":"dominance: right;\\nletter: integrated;\\nvisible: sign;\\n\ud8cd\udec1\ud8f0\udc07\u00d8\ud8d8\ude41.mov"}w331Q!Uxfrost2024/07/04 18:23:192026/09/24 23:12:15AS19200S30006S10006S20500M530x519S2ff00482x483S19200509x500M511x527S19220490x474S1ce20489x497 M543x519S2ff00482x483S19200509x500S20600521x491
      conjunction
      1. introducing a situation supk ]d]| 335 !e}frost2024/07/04 18:41:022026/05/11 22:00:11AS15a40S2fe00S15a48S2fe00S38006S29226M535x520S15a40489x480S15a48466x480S29226504x506Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc07\ud8e5\udee7.mov"}{ 335 !e|frost2024/07/04 18:39:342026/05/19 21:20:02AS15a40S2fe00S15a48S2fe00S38006S26526M528x514o"z 33[ !}{frost2024/07/04 18:32:342026/05/11 21:59:42AS10050S2fe00S15a18S2fe00S21406S20e00S26500M515x530S15a18485x483S10050499x500S20e00502x488S26500501x470Adam Frost{"video":"dominance: right;\\n\ud8c0\udc51\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8e1\udde1.mov"}y 335 !ezfrost2024/07/04 18:28:562026/05/11 21:59:32AS19a51S2fe00S15a39S2fe00S21400S20c00M519x521S15a39493x483S19a51481x479S20c00491x508Adam Frost{"video":"dominance: right;\\n\ud8ce\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udc81.mov"}485x469S14c00488x500S22520484x486verb
        1. (with reference to a liquid) to reach or cause to reach the temperature at which it bubbles and turns to vapor: [with object] : we tried to get people to boil their drinking water | [no object] : he waited for the water to boil.
          • (with reference to a kettle, pan, or other container) to heat or be heated until the liquid inside starts to boil: [with object] : she boiled the kettle and took down a couple of mugs | [no object] : the kettle boiled and he filled the teapot.
        2. (with reference to food) to cook or be cooked by immersing in boiling water or stock: [with object] : boil the potatoes until well done | [no object] : you can put the salad together while the pasta is boiling.
        3. (of a person or strong emotion) to be stirred up or inflamed: he was boiling with rage.
        Adam Frost{"video":"dominance: right;\\n\ud8c7\udc81\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8fb\udfa5\ud8db\ude01.mov"} ddA~ 33 !frost2024/07/04 18:55:482026/05/11 22:00:45AS11002S2fe00S1100aS2fe00S21400S20e00S23604S23610M547x525S11002495x476S1100a477x492S20e00494x511S23604508x508S23610453x508Adam Frost{"video":"dominance: right;\\n\ud8c1\ude03\ud8fc\udc61\ud8c1\ude0b\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8dd\udc45\ud8dd\udc51.mov"}S} 33 !-~frost2024/07/04 18:50:532026/05/11 22:00:24AS11012S2fe00S1100aS2fe00S21406S20500S2c300S2c314S20500M559x517S11012502x498S1100a473x498S20600489x484S2c300533x491S2c314442x493Adam Frost{"video":"dominance: right;\\n\ud8c1\ude13\ud8fc\udc61\ud8c1\ude0b\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ea\udd21\ud8ea\udd35\ud8d8\udde1.mov"} Ts; 335 {!efrost2024/07/04 19:20:392026/06/17 22:58:19AS11041S2fe00S15a39S2fe00S21415S20710M530x522q(33iWU!efrost2024/07/04 19:09:282026/05/22 18:57:22AS14741S38630S20359S2fe00S20e00S2ea00M523x538S3780b478x478S20359502x463S14741495x483S20e00489x499S2ea00489x513S38b00470x493 M523x538S3780b478x477S20359502x462S15a41494x480S20e00489x498S2ea00488x513 S38b04470x493verb to restore (something old, especially a building) or improve to a good state: the old school has been renovated as a private house.

        PHONOLOGICAL VARIANTS
        renovate with extended thumbAdam Frost{"video":"dominance: right;\\n\ud8c6\udee2\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d9\udd41\ud8ed\udfc1.mov"}04S26520495x471M518x530S1e140483x490S1e148494x504S26a20489x471 M520x530S1e140481x490S1e148492x504S27120481x471 M518x535S1e140483x495S1e148494x509S2ea20497x466verb
        1. to move at a speed faster than a walk: she ran the last few yards, breathing heavily.
          • to run as a sport or for exercise: I run every morning.
          • (of an athlete or a racehorse) to compete in a race: she ran in the 200 meters | [with object] : Dave has run 42 marathons.
        2. [center to front loci] to run to a location: he ran to the door.

        INFLECTED FORMS
        run [frequentative]
        run [continuative]
        run [durative]Adam Frost{"video":"dominance: right;\\n\ud8d5\udca1\ud8fc\udc61\ud8d5\udca9\ud8fc\udc61\ud8d9\udf91\ud8d8\udf01\ud8e1\ude01.mov"} b 33[k !frost2024/07/26 01:22:022026/05/29 21:44:52AS11551S2fe00S11559S2fe00S21400S22f04S20900M524x528S11559477x503S11551497x503S20900489x490S22f04487x473M524x519S11559477x494S11551497x494S20800495x481verb [frequentative] to sit: he kept sitting down.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c2\udc32\ud8fc\udc61\ud8c2\udc3a\ud8fc\udc61\ud8d9\udf81\ud8dc\udda5\ud8d8\udf61.mov"} 33 [!9frost2024/07/25 20:47:542026/04/23 23:56:32AS10021S38630S20359S2fe00S20500S22a07S10020S2f900M528x537S10021484x516S20359477x493S20500472x509S22a07506x505S10020513x463S2f900515x496combined form a construction of time and one.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc22\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8c0\udc21\ud8ef\udd61.mov"}  33 o!9frost2024/07/31 20:17:332026/04/23 23:56:53AS10e21S38630S20359S2fe00S20500S22a07S10e20S2f900M528x537S10e21484x512S20359477x493S20500472x509S22a07506x505S10e20513x463S2f900515x496combined form a construction of time and the number two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c1\udd62\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8c1\udd61\ud8ef\udd61.mov"}   33 _!9frost2024/07/31 20:20:382026/04/23 23:57:01AS11e21S38630S20359S2fe00S20500S22a07S11e20S2f900M528x537S11e21484x512S20359477x493S20500472x509S22a07506x505S11e20505x463S2f900515x496combined form a construction of time and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf62\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8c2\udf61\ud8ef\udd61.mov"}   33 ]!9frost2024/07/31 20:27:532026/04/23 23:57:14AS14421S38630S20359S2fe00S20500S22a07S14420S2f900M534x536S14421481x508S20358466x497S20500469x514S22a07506x508S14420512x465S2f900515x499combined form a construction of time and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda2\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8c6\udda1\ud8ef\udd61.mov"}   33 ]!9frost2024/07/31 20:33:202026/04/23 23:57:23AS14c21S38630S20359S2fe00S20500S22a07S14c20S2f900M532x535S14c21482x509S20358468x498S20500470x515S22a07505x509S14c20509x466S2f900514x500combined form a construction of time and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca2\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8c7\udca1\ud8ef\udd61.mov"}  33 q!9frost2024/07/31 20:37:562026/04/23 23:57:32AS18721S38630S20359S2fe00S20500S22a07S18720S2f900M529x537S18721488x513S20358472x502S20500475x519S22a07505x505S18720511x464S2f900514x496combined form a construction of time and the number six.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udec2\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8cc\udec1\ud8ef\udd61.mov"}   33 _!9frost2024/07/31 20:43:122026/04/23 23:57:40AS1a521S38630S20359S2fe00S20500S22a07S1a520S2f900M532x534S1a521479x510S20359474x492S20500468x506S22a07504x506S1a520511x466S2f900513x497combined form a construction of time and seven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude02\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8cf\ude01\ud8ef\udd61.mov"}  33 _!9frost2024/07/31 20:48:192026/04/23 23:57:48AS1bb21S38630S20359S2fe00S20500S22a07S1bb20S2f900M532x534S1bb21479x510S20359474x493S20500468x507S22a07504x507S1bb20511x467S2f900513x498combined form a construction of time and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d1\ude42\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8d1\ude41\ud8ef\udd61.mov"}  33 s!9frost2024/07/31 20:58:352026/04/23 23:57:56AS1ce21S38630S20359S2fe00S20500S22a07S1ce20S2f900M534x541S1ce20486x511S20359471x503S20500467x521S22a07505x501S1ce20512x459S2f900514x492combined form a construction of time and the number nine.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d3\udd62\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8d3\udd61\ud8ef\udd61.mov"}  33 [!9frost2024/08/01 01:50:222026/04/23 23:58:21AS10021S38630S20359S2fe00S20500S22a07S1f540S2f900M528x534S10021484x513S20359477x490S20500472x506S22a07506x502S1f540513x466S2f900515x493combined form a construction of time and ten.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc22\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8d7\udc21\ud8ef\udd61.mov"} * 33A a!Qfrost2024/08/01 01:57:052026/04/23 23:58:31AS10021S38630S20359S2fe00S20500S22a07S10000S21b00S2f900M530x543S10021483x522S20359476x499S20500471x515S22a07505x511S10000512x469S21b00522x458S2f900514x502combined form a construction of time and eleven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc22\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8c0\udc01\ud8da\ude21\ud8ef\udd61.mov"} * 33A a!Qfrost2024/08/01 02:01:022026/04/23 23:58:39AS10021S38630S20359S2fe00S20500S22a07S10e00S21b00S2f900M528x542S10021484x521S20359477x498S20500472x514S22a07506x510S10e00513x468S21b00517x458S2f900515x501combined form a construction of time and twelve.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc22\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8c1\udd41\ud8da\ude21\ud8ef\udd61.mov"} s 33u o!!frost2024/08/01 16:29:502026/04/23 23:58:59AS10e20S38630S20359S2fe00S20500S22a07S2f900M518x532S10e20482x487S20359497x501S20500489x521S22a07496x477S2f900505x468combined form a construction of time and the number two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c1\udd61\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8ef\udd61.mov"}i 33u [!!frost2024/08/01 16:25:362026/04/23 23:58:47AS10020S38630S20359S2fe00S20500S22a07S2f900M518x530S10020482x487S20359497x501S20500490x519S22a07491x480S2f900500x471combined form a construction of time and one.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c0\udc21\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8ef\udd61.mov"} ##j 33u ]!!frost2024/08/01 16:55:502026/04/23 23:59:14AS14420S38630S20359S2fe00S20500S22a07S2f900M519x533S14420482x487S20359498x502S20500490x522S22a07500x477S2f900508x468combined form a construction of time and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda1\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8ef\udd61.mov"}k 33u _!!frost2024/08/01 16:53:332026/04/23 23:59:06AS11e20S38630S20359S2fe00S20500S22a07S2f900M522x532S11e20478x487S20359501x501S20500493x521S22a07500x477S2f900509x468combined form a construction of time and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf61\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8ef\udd61.mov"} t 33u q!!frost2024/08/01 17:23:462026/04/23 23:59:29AS18720S38630S20357S2fe00S20500S22a07S2f900M519x531S18720481x487S20357498x500S20500490x520S22a07500x478S2f900508x469combined form a construction of time and the number six.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udec1\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8ef\udd61.mov"}j 33u ]!!frost2024/08/01 17:20:212026/04/23 23:59:21AS14c20S38630S20359S2fe00S20500S22a07S2f900M519x533S14c20481x487S20359497x502S20500489x522S22a07500x476S2f900508x467combined form a construction of time and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca1\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8ef\udd61.mov"} ""k 33u _!!frost2024/08/01 17:29:272026/04/23 23:59:44AS1bb20S38630S20359S2fe00S20500S22a07S2f900M519x532S1bb20482x489S20359498x501S20500490x521S22a07497x477S2f900505x468combined form a construction of time and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d1\ude41\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8ef\udd61.mov"}k 33u _!!frost2024/08/01 17:26:542026/04/23 23:59:36AS1a520S38630S20359S2fe00S20500S22a07S2f900M519x532S1a520482x489S20359498x501S20500490x521S22a07497x478S2f900505x469combined form a construction of time and seven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude01\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8ef\udd61.mov"} u 33u s!!frost2024/08/01 17:33:112026/04/23 23:59:52AS1ce20S38630S20359S2fe00S20500S22a07S2f900M519x533S1ce20481x488S20359497x502S20500489x522S22a07500x477S2f900508x468combined form a construction of time and the number nine.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d3\udd61\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8ef\udd61.mov"}  33 [!9frost2024/08/01 17:36:372026/04/24 00:00:00AS1f520S38630S20359S2fe00S20500S22a07S1f540S2f900M524x541S1f520477x511S20359501x510S20500493x530S22a07502x496S1f540509x460S2f900510x488combined form a construction of time and ten.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d7\udc01\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8d7\udc21\ud8ef\udd61.mov"} * 33A a!Qfrost2024/08/01 17:42:042026/04/24 00:00:07AS20300S38630S20359S2fe00S20500S22a07S10000S21b00S2f900M521x549S20300480x519S20359495x518S20500487x538S22a07496x504S10000503x462S21b00513x451S2f900504x496combined form a construction of time and eleven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d8\udd21\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8c0\udc01\ud8da\ude21\ud8ef\udd61.mov"} ]]}i 335 W!efrost2024/08/03 03:26:242025/03/10 01:41:50AS14c00S2fe00S15a1aS2fe00S37f04S22520M516x531S15a1at* 33A a!Qfrost2024/08/01 18:06:162026/04/24 00:00:18AS20300S38630S20359S2fe00S20500S22a07S10e00S21b00S2f900M519x549S20300481x519S20359496x518S20500488x538S22a07497x504S10e00504x462S21b00508x452S2f900505x496combined form a construction of time and twelve.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d8\udd21\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8db\udfc8\ud8c1\udd41\ud8da\ude21\ud8ef\udd61.mov"}e songs.
      2. affectionate greetings conveyed to someone on one's behalf: give her my love.
      3. a formula for ending an affectionate letter: take care, lots of love, Judy.
      4. (Love) a personified figure of love, often represented as Cupid.
      5. a great interest and pleasure in something: his love for football | we share a love of music.
      6. a person or thing that one loves: she was the love of his life | their two great loves are tobacco and whiskey.
        • British English informal a friendly form of address: it's all right, love.
        • (a love) informal used to express affectionate approval for someone: don't fret, there's a love.
      7. (in tennis, squash, and some other sports) a score of zero; nil: love fifteen | he was down two sets to love.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d4\udea1\ud8fc\udc61\u00d8\ud8cb\udc61\ud8c1\udd61\ud8c6\udfe1.mov"} FFC; 335k!efrost2024/08/03 03:32:102026/06/05 18:10:35AS15a30S2fe00S15a1aS2fe00S37f04S26500M520x522S15a1a481x479S15a30488x495S26500506x500M525x523S15a1a476x478S15a30481x496S26a00498x504verb to cook (food) by dry heat without direct exposure to a flame, typically in an oven: they bake their own bread and cakes.

      DERIVATIVES
      oven [frequentative]Adam Frost{"video":"dominance: right;\\n\ud8c8\uddf1\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8fb\udfa5\ud8e1\udde1.mov"}w 335 s!efrost2024/08/03 03:27:392025/03/10 01:42:09AS20340S2fe00S15a39S2fe00S21400S20c00M524x517S15a39482x483S20340476x497S20c00496x504verb to reduce (food or other substance) to a uniform mass by crushing it: mash the beans to a paste.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd61\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udc81.mov"} </ 33g !frost2024/08/03 03:39:402025/02/27 18:36:15AS15a40S2fe00S15a3aS2fe00S21400S20500S26506S20500M519x522S15a3a484x479S15a40482x483S20600497x495S26506501x508verb to cut (something) into pieces with repeated sharp blows of a sharp implement: finely chop the parsley.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\uddfb\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e1\udde7\ud8d8\udde1.mov"}@ 335 !efrost2024/08/03 03:36:432026/05/19 21:20:34AS1ea13S2fe00S16d48S2fe00S37f07S2ea02M517x532S16d48483x512S1ea13495x486S2ea02492x468verb [with object] to move a spoon or other implement around in (a liquid or other substance) in order to mix it thoroughly: stir the batter until it is just combined.Adam Frost{"video":"dominance: right;\\n\ud8d5\udfd4\ud8fc\udc61\ud8ca\udd29\ud8fc\udc61\ud8fb\udfa8\ud8ed\udfc3.mov"} ^ 33A _!}frost2024/08/03 03:58:492025/02/27 18:50:11AS15a5fS2fe00S15a37S2fe00S21400S2a200S20500M527x520S15a37473x488S15a5f484x497S2a200504x481verb to turn (something) onto its opposite side, typically referring to small or handheld objects.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude20\ud8fc\udc61\ud8c8\uddf8\ud8fc\udc61\ud8d9\udf81\ud8e7\udcc1\ud8d8\udde1.mov"} 33g _!frost2024/08/03 03:48:392026/05/19 21:20:54AS15a42S2fe00S15a39S2fe00S21400S20500S27207S20600M527x532S15a39483x469S15a42474x484S20600504x484S27207494x498verb [with object] to cut (food or other matter) into small cubes: dice the peppers.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude03\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e2\udec8\ud8d8\ude41.mov"} <" 33 {!)frost2024/08/03 04:03:462026/05/19 21:21:57AS19a21S2fe00S10006S28802M521x516S19a21479x488S28802499x485verb [with object and adverbial of direction] to cause (a liquid) to flow from a container in a measured stream, especially a small amount: pour in a cup of milk.Adam Frost{"video":"dominance: right;\\n\ud8ce\udde2\ud8fc\udc61\u00d8\ud8e4\udf03.mov"}@! 33[ G!}frost2024/08/03 04:02:262026/05/19 21:21:13AS1f751S2fe00S15a39S2fe00S21400S20e00S26a07M526x519S15a39478x483S1f751475x498S20e00498x497S26a07505x481verb [with object] to reduce (something, especially food) to small shreds by rubbing it on a grater: peel and roughly grate the carrots.Adam Frost{"video":"dominance: right;\\n\ud8d7\udcf2\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc8.mov"} B$ 33[ K!}frost2024/08/03 04:07:542026/05/19 21:22:30AS11541S2fe00S15a39S2fe00S21400S20e00S2a405M522x534S15a39486x466S11541494x476S2a405489x506S20e00479x493verb [with object and adverbial] to apply (a substance) to an object or surface in an even layer: he sighed, spreading jam on a croissant.Adam Frost{"video":"dominance: right;\\n\ud8c2\udc22\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e7\udd86.mov"}i# 33) !Afrost2024/08/03 04:06:272025/02/27 19:32:14AS18511S2fe00S10006S22515S2ea02M520x518S18511492x499S22515481x493S2ea02495x482verb to scatter (small particles of a substance) over an object or surface: sprinkle sesame seeds over the top.Adam Frost{"video":"dominance: right;\\n\ud8cc\uddf2\ud8fc\udc61\u00d8\ud8db\uddf6\ud8ed\udfc3.mov"} u% 33[ 1!}frost2024/08/03 04:09:212026/05/19 21:23:25AS10002S2fe00S1000aS2fe00S37f07S2ea00S2ea44M545x513S10002495x492S1000a475x498S2ea00530x488S2ea44455x488verb [with object and adverbial] to turn (something flexible) over and over on itself to form a cylinder, tube, or ball: he rolled the handkerchief into a ball.
      • to make (something) by forming material into a cylinder or ball: [with two objects] : Harry rolled himself a joint.
      • [no object, with adverbial] (of a person or animal) to curl up tightly: the shock made the armadillo roll into a ball.
      Adam Frost{"video":"dominance: right;\\n\ud8c0\udc03\ud8fc\udc61\ud8c0\udc0b\ud8fc\udc61\ud8fb\udfa8\ud8ed\udfc1\ud8ee\udc05.mov"} ~' 33A ]!}frost2024/08/05 19:52:312026/03/30 00:13:59AS1ea42S2fe00S1ea48S2fe00S21400S20e00S26a00M519x533S1ea42492x486S1ea48481x512S26a00492x467noun a game played with playing cards: they were playing interminable cards.
      verb to distribute (cards) in an orderly rotation to players for a game or round: the cards were dealt for the last hand.Adam Frost{"video":"dominance: right;\\n\ud8d6\udc03\ud8fc\udc61\ud8d6\udc09\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc1.mov"}F& 33 !)frost2024/08/03 04:13:402025/02/27 19:48:00AS1ea40S2fe00S10006S2a200M523x521S1ea40500x500S2a200478x479verb to pick up and move (something) with a utensil like a spoon: Philip began to scoop grain into his bag.Adam Frost{"video":"dominance: right;\\n\ud8d6\udc01\ud8fc\udc61\u00d8\ud8e7\udcc1.mov"} {( 33[ =!}frost2024/08/05 19:59:142026/05/26 03:50:04AS1f720S2fe00S1f728S2fe00S37f07S2e500S2e51cM530x532S1f720507x468S1f728473x487S2e500507x486S2e51c470x505verb [at front locus] to clean (a vertical surface) with water and, typically, soap or detergent: she washed the window.
      noun an act of washing a vertical surface: a car wash.Adam Frost{"video":"dominance: right;\\n\ud8d7\udcc1\ud8fc\udc61\ud8d7\udcc9\ud8fc\udc61\ud8fb\udfa8\ud8ed\udde1\ud8ed\uddfd.mov"} Z) 33' !-frost2024/08/05 20:11:592026/03/30 01:00:49AS14c50S2fe00S14c58S2fe00S38006S28802S28812S2880aS2881aM531x531S14c50507x469S14c58469x469S28802507x504S28812470x504S2880a509x519S2881a471x519verb to spend time in a relaxed and casual way without doing anything in particular: we were just sitting there taking it easy.
      adjective involving little or no activity or effort; not intense: this club is low-key.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd1\ud8fc\udc61\ud8c7\udcd9\ud8fc\udc61\ud8fc\udc07\ud8e4\udf03\ud8e4\udf13\ud8e4\udf0b\ud8e4\udf1b.mov"} X`+ 33' !-frost2024/08/05 20:28:382026/05/11 22:01:20AS1f437S2fe00S1f43fS2fe00S38006S22113S22115S2ea06S2ea16M529x530S1f437506x481S1f43f474x481S22113510x470S22115471x470S2ea06504x515S2ea16472x515Adam Frost{"video":"dominance: right;\\n\ud8d6\udfb8\ud8fc\udc61\ud8d6\udfc0\ud8fc\udc61\ud8fc\udc07\ud8db\udc74\ud8db\udc76\ud8ed\udfc7\ud8ed\udfd7.mov"}$* 33[ !}frost2024/08/05 20:15:562026/03/30 01:49:36AS20301S2fe00S20309S2fe00S38006S2ea06S2ea16M536x520S20301511x498S20309466x499S2ea06511x480S2ea16465x480verb to drive around and return to the starting point: she spent the afternoon driving around town running errands.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd22\ud8fc\udc61\ud8d8\udd2a\ud8fc\udc61\ud8fc\udc07\ud8ed\udfc7\ud8ed\udfd7.mov"} {M{L- 33 !)frost2024/08/07 00:37:332026/05/11 22:01:28AS10004S2fe00S10006S22a04M508x525S10004493x476S22a04495x510Adam Frost{"video":"dominance: right;\\n\ud8c0\udc05\ud8fc\udc61\u00d8\ud8db\udfc5.mov"}/, 33O U!Yfrost2024/08/07 00:31:362026/05/07 16:24:17AS16d20S2fe00S10006S11520S14720S1f720M510x550S16d20493x451S11520495x475S14720496x509S1f720490x535noun a country in the western West Indies, the largest and furthest west of the islands, in the Caribbean Sea at the mouth of the Gulf of Mexico; capital, Havana.
      adjective relating to Cuba or its people: a box of Cuban cigars | the Cuban national team.
      noun a native or inhabitant of Cuba, or a person of Cuban descent: the language spoken by nearly all Cubans is Spanish.Adam Frost{"video":"dominance: right;\\n\ud8ca\udd01\ud8fc\udc61\u00d8\ud8c2\udc01\ud8c6\udec1\ud8d7\udcc1.mov"} X@@HPX`hpx (08@HPX`hpx (08@HPX`hpx z / 33[ a!}frost2024/08/07 00:55:102026/05/06 16:46:39AS10041S2fe00S10049S2fe00S21400S21100S27107M529x532S10049472x502S10041482x502S21100494x489S27107502x469proper noun, noun associated with England.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc42\ud8fc\udc61\ud8c0\udc4a\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e2\ude68.mov"}. 33 w!)frost2024/08/07 00:43:282026/05/06 16:32:53AS1ce20S2fe00S10006S26506M520x515S1ce20481x485S26506505x498proper noun, adjective, noun relating to or associated with France (proper noun, adjective, noun sense 1 & sense 2).Adam Frost{"video":"dominance: right;\\n\ud8d3\udd61\ud8fc\udc61\u00d8\ud8e1\udde7.mov"} 0 33M -!Efrost2024/08/07 01:06:392026/05/07 16:22:45AS10001S38507S10009S38501S20500S20500S26500S26510S10601S10609M544x537S36d00479x507S10001522x507S10009457x507S26500527x494S26510459x494S10601521x463S10609456x463proper noun, adjective, noun dated relating to or associated with Spain.Adam Frost{"video":"dominance: equal;\\n\ud8c0\udc02\ud8fc\udde8\ud8c0\udc0a\ud8fc\udde2\ud8d8\udde1\ud8d8\udde1\ud8e1\udde1\ud8e1\uddf1\ud8c0\ude42\ud8c0\ude4a.mov"} 1 335 +!efrost2024/08/07 01:09:472026/05/06 18:50:54AS10041S2fe00S10049S2fe00S21400S20600M516x522S10049485x492S10041495x492S20600489x478noun a point at which two or more things intersect, especially roads: red and green lights at the nearby intersection.
      proper noun, adjective, noun relating to or associated with Greece.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc42\ud8fc\udc61\ud8c0\udc4a\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} w2 33A }!Ofrost2024/08/07 01:12:222026/05/04 04:05:02AS1f720S2fe00S10006S11520S20320S1fb20S11a20S19220S1f720M513x584S1f720487x417S11520492x436S20320492x470S1fb20493x489S11a20492x512S19220492x546S1f720487x569noun, adjective relating to or associated with Austria.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8c2\udc01\ud8d8\udd41\ud8d7\ude41\ud8c2\udde1\ud8cd\udee1\ud8d7\udcc1.mov"} 11K3 33O a!frost2024/08/07 01:18:032026/05/09 00:41:33AS19a01S38511S10006S20500S22a05S20500M521x525S36d00479x476S19a01470x482S20500507x514S22a05494x499proper noun dated a former federal republic in southeastern Europe, in the Balkans.
      adjective dated relating to characteristic of the former federal republic of Yugoslavia or its people: the Yugoslavian government.
      noun dated a native or inhabitant of the former federal republic of Yugoslavia, or a person of Yugoslav descent: he was a Yugoslavian by birth.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8ce\uddc2\ud8fc\uddf2\u00d8\ud8d8\udde1\ud8db\udfc6\ud8d8\udde1.mov"} \$5 33O !frost2024/08/07 01:21:552026/05/07 04:27:57AS19220S2fe00S10006S11a20S1f720S11920M514x551S19220493x449S11a20493x472S1f720488x506S11920487x525proper noun, adjective, noun relating to or associated with Iran.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cd\udee1\ud8fc\udc61\u00d8\ud8c2\udde1\ud8d7\udcc1\ud8c2\udd81.mov"} 4 33O 7!Yfrost2024/08/07 01:18:372026/05/07 17:05:37AS1821dS38511S10006S20500S22a05S20500M521x523S36d00479x478S1821d473x485S20500507x512S22a05494x497proper noun, adjective, noun dated relating to or associated with Yugoslavia.Adam Frost{"video":"dominance: right;\\n\ud8cc\udcde\ud8fc\uddf2\u00d8\ud8d8\udde1\ud8db\udfc6\ud8d8\udde1.mov"} ##|7 33) -!Afrost2024/08/07 01:29:012026/05/06 17:02:52AS10011S31410S10006S21100S2c400M562x527S2ff00482x483S10011510x497S2c400522x486proper noun, adjective, noun dated relating to or associated with China.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f1\udf91\u00d8\ud8d9\ude61\ud8ea\udd81.mov"}Y6 33O {!frost2024/08/07 01:23:382026/05/07 16:27:30AS19220S2fe00S10006S11a20S1f720S1f051M516x550S19220495x451S11a20495x474S1f720490x508S1f051484x527noun a country in the Middle East, with an outlet on the Persian Gulf; capital, Baghdad.
      adjective relating to Iraq, its people, or their language.
      noun
      1. a native or inhabitant of Iraq, or a person of Iraqi descent.
      2. the form of Arabic spoken in Iraq.
      Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cd\udee1\ud8fc\udc61\u00d8\ud8c2\udde1\ud8d7\udcc1\ud8d6\ude52.mov"} `U`q9 33 !qfrost2024/08/07 02:01:092026/05/07 15:39:51AS1f401S33d00S10006S22101S21100S22a04S22105M532x536S33b00482x483S1f401497x486S22101491x498S22105495x487S21100518x505S22a04519x521noun a small, sometimes pointed, beard.
      proper noun, adjective, noun relating to or associated with Vietnam.Adam Frost{"video":"dominance: right;\\n\ud8d6\udf82\ud8f5\udee1\u00d8\ud8db\udc62\ud8d9\ude61\ud8db\udfc5\ud8db\udc66.mov"}'8 33[ !!qfrost2024/08/07 01:43:382026/05/07 15:38:30AS11501S33200S10006S20500S22a03S38511S20500M525x549S33100482x483S11501500x504S22a03490x524S20500478x538proper noun, adjective, adjective relating to or associated with Vietnam.Adam Frost{"video":"dominance: right;\\n\ud8c1\udfe2\ud8f4\udec1\u00d8\ud8d8\udde1\ud8db\udfc4\ud8fc\uddf2\ud8d8\udde1.mov"} r: 33 +!Ufrost2024/08/07 02:03:172026/05/09 00:41:49AS10e20S2fe00S10006S29904M514x531S10e20487x469S29904500x499proper noun a republic on the northern coast of South America, on the Caribbean Sea; capital, Caracas.
      adjective relating to Venezuela or its people.
      noun a native or inhabitant of Venezuela, or a person of Venezuelan descent.
      proper noun, adjective, noun relating to or associated with Vietnam.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c1\udd61\ud8fc\udc61\u00d8\ud8e6\udd65.mov"} . .W< 33Ak1!}frost2024/08/13 19:33:432026/05/29 22:10:32AS1e140S2fe00S1e148S2fe00S21410S20800S26a20M518x530S1e140483x490S1e148494x504S26a20489x471M518x530S1e140483x490S1e148494x504S26520495x471verb [frequentative] to run: she ran several times during practice.Adam Frost{"video":"dominance: right;\\n\ud8d5\udca1\ud8fc\udc61\ud8d5\udca9\ud8fc\udc61\ud8d9\udf91\ud8d8\udf01\ud8e1\udfe1.mov"}s; 33[k-!frost2024/08/13 18:54:522026/05/29 21:32:08AS14c50S2fe00S15a0aS2fe00S38004S22510S26a00M514x540S15a0a487x460S14c50487x491S22510488x475S26a00486x526M514x531S15a0a487x469S14c50487x500S22510488x484verb [frequentative] to study: she studied every night this week.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udcd1\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8fc\udc05\ud8db\uddf1\ud8e1\udfc1.mov"} Y> 33)kg!cfrost2024/08/13 19:52:542026/05/30 00:52:30AS10020S2fe00S10006S26a00S10620M514x538S10020493x508S26a00487x491S10620487x462M511x538S10020496x508S26500497x492S10620490x463verb [frequentative, front to center loci] to ask: he asked many questions during the meeting.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8e1\udfc1\ud8c0\ude61.mov"}=33[+!frost2024/08/13 19:42:182026/05/30 00:57:21AS19a40S2fe00S19a48S2fe00S38006S2a304S2a31cM532x533S19a48469x467S19a40504x467S2a304507x493S2a31c470x492M532x532S19a48469x468S19a40504x468S2a40c505x496S2a414470x495verb [frequentative] to play: they played several times that day.Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8ce\ude01\ud8fc\udc61\ud8ce\ude09\ud8fc\udc61\ud8fc\udc07\ud8e7\udd25\ud8e7\udd3d.mov"} 7 7P@ 33[kg!frost2024/08/13 20:02:482026/05/29 21:35:58AS14c50S2fe00S15a0aS2fe00S38004S22510S2ea20M514x545S15a0a487x455S14c50487x486S22510488x470S2ea20493x520M514x531S15a0a487x469S14c50487x500S22510488x484verb to study: she studied all night.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c7\udcd1\ud8fc\udc61\ud8c8\uddcb\ud8fc\udc61\ud8fc\udc05\ud8db\uddf1\ud8ed\udfe1.mov"}q? 33[k)!frost2024/08/13 19:55:062026/05/29 21:44:29AS11551S2fe00S11559S2fe00S21400S20800S2ea20M524x530S11559477x483S11551497x483S20800495x470S2ea20494x505M524x519S11559477x494S11551497x494S20800495x481verb [durative] to sit: I have been sitting here waiting for you.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c2\udc32\ud8fc\udc61\ud8c2\udc3a\ud8fc\udc61\ud8d9\udf81\ud8d8\udf01\ud8ed\udfe1.mov"}e of economic conditions or shortage of work: the company has laid off 30 percent of its staff.
    4. to order or allow to leave; send away: she dismissed the taxi at the corner of the road.
      • to discharge from employment or office: CBS Records dismissed another 120 people.
      • Law to refuse further hearing to (a case): the judge dismissed the case for lack of evidence.
    5. to refrain from insisting on or using (a right or claim): he will waive all rights to the money.
      • to refrain from applying or enforcing (a rule, restriction, or fee): her tuition fees would be waived.
    noun a discharge of a worker or workers because of economic conditions or shortage of work: the workforce is on strike over layoffs | the most recent layoff saw staff fall to 175 from 250.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde7.mov"} rYB 33Ak!frost2024/08/13 20:07:402026/05/29 22:18:01AS1e140S2fe00S1e148S2fe00S21410S20800S2ea20M518x535S1e140483x495S1e148494x509S2ea20497x466M518x530S1e140483x490S1e148494x504S26520495x471verb [durative] to run: he kept running for a while.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d5\udca1\ud8fc\udc61\ud8d5\udca9\ud8fc\udc61\ud8d9\udf91\ud8d8\udf01\ud8ed\udfe1.mov"}A33A+E!}frost2024/08/13 20:05:072026/06/05 18:17:57AS1e140S2fe00S1e148S2fe00S21410S20800S26520M518x530S1e140483x490S1e148494x5w~  $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|()+-/0123579:<>@BDFHJLNPRTVWXZ\^_acefgijlm‘oÑpđqőrƑsǑtȑuɑvʑxˑy̑z͑{Α|ϑ}БҒӒԒՒْ֒ؒ ڒ ے ܒ ݒޒ !"$&(+-/12469;<=?ABDEFGIJKMNOP R T V WXYZ[\]^_`bdeg D DBD 33)k9!cfrost2024/08/13 20:13:092026/05/30 00:52:11AS10020S2fe00S10006S2ea00S10620M529x515S10020514x485S2ea00496x488S10620472x489M511x538S10020496x508S26500497x492S10620490x463verb [durative, front to center loci] to ask: he kept asking questions.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc21\ud8fc\udc61\u00d8\ud8ed\udfc1\ud8c0\ude61.mov"}rC33[!frost2024/08/13 20:10:242026/05/30 00:59:04AS19a40S2fe00S19a48S2fe00S38006S2ea00S2ea18M532x526S19a48469x475S19a40504x475S2ea00512x501S2ea18474x500M532x532S19a48469x468S19a40504x468S2a40c505x496S2a414470x495verb [durative] to play: they kept playing all day.Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8ce\ude01\ud8fc\udc61\ud8ce\ude09\ud8fc\udc61\ud8fc\udc07\ud8ed\udfc1\ud8ed\udfd9.mov"} bZF33)#Q!Afrost2024/10/19 18:50:422026/05/27 15:09:03AS20310S2fe00S10006S26500S11540M508x535S20310493x520S26500494x501S11540493x466S38b00470x493 M508x534S20310493x519S26500494x500S10040493x466 S38b04470x493verb [center to front loci] to propel (something) with force through air to a particular location: I threw a brick through the window.

    PHONOLOGICAL VARIANTS
    throw with index handAdam Frost{"video":"dominance: right;\\n\ud8d8\udd31\ud8fc\udc61\u00d8\ud8e1\udde1\ud8c2\udc21.mov"}E 335 !efrost2024/10/01 18:26:192026/05/11 22:01:44AS15a50S2fe00S15a1aS2fe00S37f04S2e706M526x522S15a1a499x479S15a50505x495S2e706475x504Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\ud8c8\udddb\ud8fc\udc61\ud8fb\udfa5\ud8ed\udea7.mov"} hH 33A !!frost2024/10/28 05:43:012026/04/24 00:00:43AS10e10S2fe00S15a18S2fe00S21406S20500S2c300M515x538S15a18486x511S10e10497x489S2c300489x463combined form a construction of minute (sense 1 & 2) and the number two.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c1\udd51\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ea\udd21.mov"}SG 33 !-frost2024/10/27 22:56:102026/05/11 22:29:20AS10020S2fe00S15a38S2fe00S21400S18251S20500S26500S20500M521x538S10020493x463S15a38480x511S18251486x518S26500507x509S20500496x502Adam Frost{"video":"dominance: right;\\n\ud8c0\udc21\ud8fc\udc61\ud8c8\uddf9\ud8fc\udc61\ud8d9\udf81\ud8cc\udd12\ud8d8\udde1\ud8e1\udde1\ud8d8\udde1.mov"} 99_J 33A {!!frost2024/10/28 05:50:192026/04/24 00:00:59AS14410S2fe00S15a18S2fe00S21406S20500S2c300M516x538S15a18485x511S14410494x488S2c300488x463combined form a construction of minute (sense 1 & 2) and four.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udd91\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ea\udd21.mov"}`I 33A }!!frost2024/10/28 05:47:452026/04/24 00:00:51AS11e10S2fe00S15a18S2fe00S21406S20500S2c300M517x538S15a18483x511S11e10494x489S2c300486x463combined form a construction of minute (sense 1 & 2) and three.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf51\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ea\udd21.mov"} 00iL 33A !!frost2024/10/28 05:54:032026/04/24 00:01:15AS18710S2fe00S15a18S2fe00S21406S20500S2c300M515x538S15a18486x511S18710494x490S2c300489x463combined form a construction of minute (sense 1 & 2) and the number six.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cc\udeb1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ea\udd21.mov"}_K 33A {!!frost2024/10/28 05:52:262026/04/24 00:01:07AS14c10S2fe00S15a18S2fe00S21406S20500S2c300M515x538S15a18486x511S14c10490x488S2c300489x463combined form a construction of minute (sense 1 & 2) and five.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udc91\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ea\udd21.mov"} 88`N 33A }!!frost2024/10/28 05:57:152026/04/24 00:01:30AS1bb10S2fe00S15a18S2fe00S21406S20500S2c300M515x538S15a18486x511S1bb10490x491S2c300489x463combined form a construction of minute (sense 1 & 2) and eight.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d1\ude31\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ea\udd21.mov"}`M 33A }!!frost2024/10/28 05:55:472026/04/24 00:01:23AS1a510S2fe00S15a18S2fe00S21406S20500S2c300M515x538S15a18486x511S1a510490x491S2c300489x463combined form a construction of minute (sense 1 & 2) and seven.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\uddf1\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ea\udd21.mov"} hh&P 33 !Mfrost2024/10/31 18:11:212026/05/01 16:57:26AS10e20S2fe00S10006S16d20M509x527S10e20494x473S16d20492x507combined form a construction of the number two and the combining form -hundred.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c1\udd61\ud8fc\udc61\u00d8\ud8ca\udd01.mov"}jO 33A !!frost2024/10/28 05:58:432026/04/24 00:01:37AS1ce10S2fe00S15a18S2fe00S21406S20500S2c300M516x538S15a18485x511S1ce10494x489S2c300488x463combined form a construction of minute (sense 1 & 2) and the number nine.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d3\udd51\ud8fc\udc61\ud8c8\uddd9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ea\udd21.mov"} ^R 33 !Mfrost2024/10/31 18:14:152026/04/24 00:02:23AS14420S2fe00S10006S16d20M511x528S14420489x473S16d20489x508combined form a construction of four and the combining form -hundred.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda1\ud8fc\udc61\u00d8\ud8ca\udd01.mov"}Q 33 !Mfrost2024/10/31 18:13:022026/04/24 00:02:15AS11e20S2fe00S10006S16d20M512x527S11e20489x473S16d20495x507combined form a construction of three and the combining form -hundred.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf61\ud8fc\udc61\u00d8\ud8ca\udd01.mov"} O_O T 33 A!sfrost2024/10/31 18:25:352026/05/17 23:24:38AS18720S2fe00S10006S16d20M509x527S18720491x474S16d20491x507noun a flush toilet.
    • a room containing a flush toilet.
    combined form a construction of the number six and the combining form -hundred.Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated (noun);\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8ca\udd01.mov"}S 33 !Mfrost2024/10/31 18:15:322026/04/24 00:02:33AS14c20S2fe00S10006S16d20M512x528S14c20489x473S16d20491x508combined form a construction of five and the combining form -hundred.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8ca\udd01.mov"} ^V 33 !Mfrost2024/10/31 18:29:032026/04/24 00:03:01AS1bb20S2fe00S10006S16d20M511x526S1bb20490x474S16d20489x506combined form a construction of eight and the combining form -hundred.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d1\ude41\ud8fc\udc61\u00d8\ud8ca\udd01.mov"}U 33 !Mfrost2024/10/31 18:27:162026/04/24 00:02:53AS1a520S2fe00S10006S16d20M511x526S1a520490x474S16d20489x506combined form a construction of seven and the combining form -hundred.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8cf\ude01\ud8fc\udc61\u00d8\ud8ca\udd01.mov"} TT(W 33 !Mfrost2024/10/31 18:31:062026/05/01 17:14:41AS1ce20S2fe00S10006S16d20M511x527S1ce20489x473S16d20489x507combined form a construction of the number nine and the combining form -hundred.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8d3\udd61\ud8fc\udc61\u00d8\ud8ca\udd01.mov"} wjX 33O ?!efrost2024/10/31 18:37:502026/05/19 21:29:43AS10000S2fe00S15a1aS38615S20500S28803M522x537S15a1a495x525S10000503x464S28803479x483S37800510x494noun
    1. a period of twenty-four hours as a unit of time, reckoned from one midnight to the next, corresponding to a rotation of the earth on its axis: they only met a few days ago.
      • the part of a day when it is light: the animals hunt by day.
      • Astronomy a single rotation of a planet in relation to its primary.
      • Astronomy the period on a planet when its primary star is above the horizon.
    2. [with adjective] a day associated with a particular event or purpose: graduation day | Christmas Day.
    Adam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8fc\udc61\ud8c8\udddb\ud8fc\ude56\ud8d8\udde1\ud8e4\udf04.mov"} fZ 33 k!Mfrost2024/10/31 18:47:282026/04/24 00:28:08AS11e20S2fe00S10006S12120M512x531S11e20489x470S12120488x504combined form a construction of three and one hundred.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c2\udf61\ud8fc\udc61\u00d8\ud8c3\udc81.mov"}Y 33 {!Mfrost2024/10/31 18:45:212026/04/24 00:27:58AS10e20S2fe00S10006S11020M510x531S10e20495x470S11020491x504combined form a construction of the number two and one hundred.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c1\udd61\ud8fc\udc61\u00d8\ud8c1\ude21.mov"} o \ 33 i!Mfrost2024/10/31 18:52:342026/04/24 00:28:22AS14c20S2fe00S10006S14e20M513x533S14c20490x467S14e20488x502combined form a construction of five and one hundred.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c7\udca1\ud8fc\udc61\u00d8\ud8c7\udd61.mov"} [ 33 i!Mfrost2024/10/31 18:50:042026/04/24 00:28:15AS14420S2fe00S10006S14520M513x533S14420491x467S14520488x502combined form a construction of four and one hundred.Adam Frost{"video":"dominance: right;\\nvisible: false;\\n\ud8c6\udda1\ud8fc\udc61\u00d8\ud8c6\ude01.mov"}uired in small quantities in the diet because they cannot be synthesized by the body: most people can get all the vitamins they need from a healthy diet | [as modifier] : vitamin deficiency.
    • a pill containing a specified amount of a particular vitamin or vitamins, taken as a dietary supplement: I woke up this morning and took a vitamin.
  • an instance of vibrating: powerful vibrations from an earthquake | the big-capacity engine generated less vibration.
  • a device used for massage or sexual stimulation.
    • verb to move or cause to move continuously and rapidly to and fro: [no object] : the cabin started to vibrate | [with object] : the bumblebee vibrated its wings for a few seconds.
    proper noun, adjective, noun relating to or associated with Venezuela.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c1\udd61\ud8fc\udc61\u00d8\ud8e2\ude67.mov"} n^ 33 O!)frost2024/11/12 18:07:242026/05/26 03:54:23AS1f720S2fe00S10006S29904M510x526S1f720490x475S29904495x494verb [with object, at front locus] to clean (something) by rubbing its surface with a cloth or similar item: he wiped down the kitchen wall.Adam Frost{"video":"dominance: right;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8e6\udd65.mov"}c] 33O !frost2024/11/03 20:26:412026/05/19 21:31:03AS1dc20S2fe00S10006S17620S10e20S14a20M512x552S1dc20488x449S17620496x483S10e20497x503S14a20497x537noun
    1. an intense feeling of deep affection: babies fill parents with feelings of love | their love for their country.
      • a feeling of deep romantic or sexual attachment to someone: they were both in love with her | we were slowly falling in love | it was love at first sight | [as modifier] : lov **R_ 33[ k!}frost2024/11/12 18:15:162026/03/31 17:58:21AS15a51S2fe00S15a39S2fe00S21400S20e00S26a07M520x525S15a39495x502S15a51480x502S20e00492x492S26a07499x476verb
        1. to make free of dirt, marks, or mess, especially by washing, wiping, or brushing: chair covers should be easy to clean.
        2. to repeatedly wipe a surface with the intention of removing dirt, dust, or impurities to make it clean: he kept cleaning the table until he was satisfied.
        noun the action of making something clean: the housekeeper will help with the cleaning.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc8.mov"} >>a 33 A!frost2024/11/12 18:29:032026/05/03 22:24:53AS14c30S2fe00S14c38S2fe00S38006S2a204S2a21cS30a00M531x583S14c30506x521S14c38470x521S2a204508x555S2a21c470x555S30a00482x483interrogative verb to ask if something is finished or done: are you finish?.Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcb1\ud8fc\udc61\ud8c7\udcb9\ud8fc\udc61\ud8fc\udc07\ud8e7\udcc5\ud8e7\udcdd\ud8f0\udfc1.mov"}` 335 A!efrost2024/11/12 18:22:472026/05/23 20:29:07AS19a21S2fe00S16d48S2fe00S37f00S28802M528x527S16d48473x507S19a21485x477S28802506x474verb [with object and adverbial of direction] to cause (a liquid) to flow into a container in a measured stream, especially a small amount: pour half the solution in the beaker | pour two cups of water into the batter | water the plants with no more than a cup.Adam Frost{"video":"dominance: right;\\n\ud8ce\udde2\ud8fc\udc61\ud8ca\udd29\ud8fc\udc61\ud8fb\udfa1\ud8e4\udf03.mov"} BBfc 33[ !}frost2024/11/12 18:38:392026/04/03 16:54:22AS11551S2fe00S11559S2fe00S21400S21100S26507M528x525S11559472x500S11551492x500S21100501x489S26507515x476verb to travel by train: we took the train to Boston.Adam Frost{"video":"dominance: right;\\n\ud8c2\udc32\ud8fc\udc61\ud8c2\udc3a\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e1\udde8.mov"}Pb 33? w! frost2024/11/12 18:34:182026/05/09 00:42:02AS18720S2fe00S18728S2fe00S21406S20500S2df06S2df1eS20300S20308S20500M521x536S18720501x507S18728481x507S2df06501x481S2df1e479x481S20300501x464S20308484x464noun a meeting at which a group of people engage in intensive discussion and activity on a particular subject or project: a writers' workshop was held on July 25–27.Adam Frost{"video":"dominance: equal;\\nletter: integrated;\\n\ud8cc\udec1\ud8fc\udc61\ud8cc\udec9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8ec\udfa7\ud8ec\udfbf\ud8d8\udd21\ud8d8\udd29\ud8d8\udde1.mov"} l܃Te 33u 3!frost2024/11/12 18:43:172026/05/04 04:06:43AS18d20S2fe00S10006S17620S1fb20S14a20S1dc20M512x561S18d20491x440S17620496x469S1fb20497x489S14a20497x512S1dc20488x531noun a roadside hotel designed primarily for motorists, typically having the rooms arranged in a low building with parking directly outside.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cd\udd01\ud8fc\udc61\u00d8\ud8cb\udc61\ud8d7\ude41\ud8c6\udfe1\ud8d4\udea1.mov"}d 33 !)frost2024/11/12 18:40:202026/05/20 01:48:45AS19c50S2fe00S10006S26500M514x524S19c50486x495S26500494x477verb
        1. to travel through the air on an airplane: I fly back to New York this evening.
        2. [with object] to control the flight of an airplane; to pilot.
        Adam Frost{"video":"dominance: right;\\n\ud8ce\uded1\ud8fc\udc61\u00d8\ud8e1\udde1.mov"} zf 33 A!7frost2024/11/12 18:46:032026/05/04 04:07:23AS1f720S2fe00S10006S19220S11a20S14720S11920S14720M514x577S1f720488x423S19220493x442S11a20493x465S14720494x499S11920487x525S14720494x555proper noun an American company operating an online marketplace for short-and-long-term homestays and experiences in various countries and regions.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d7\udcc1\ud8fc\udc61\u00d8\ud8cd\udee1\ud8c2\udde1\ud8c6\udec1\ud8c2\udd81\ud8c6\udec1.mov"} FF6g 33u w!frost2024/11/12 18:49:112026/05/04 04:07:55AS16d20S2fe00S10006S1f720S14720S19220S11920M514x559S16d20492x441S1f720488x465S14720494x484S19220493x510S11920487x533noun
        1. a small shelter or house, made of wood and situated in a wild or remote area: the cabin lay three miles into the reserve.
        2. a private room or compartment on a ship: she lay in her cabin on a steamer.
          • the area for passengers in an aircraft: animals are not allowed in the cabin of the aircraft.
        Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8ca\udd01\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8c6\udec1\ud8cd\udee1\ud8c2\udd81.mov"} ,i 33 K!)frost2024/11/12 19:08:502026/04/03 16:57:37AS10e04S2fe00S10006S2f900M508x519S10e04493x481S2f900493x514affix used to represent the position or movement of a pair of legs, particularly how the are positioned or move as a unit: the man is standing next to the car | the kids are jumping on the trampoline together.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd45\ud8fc\udc61\u00d8\ud8ef\udd61.mov"}.h 33[ #!}frost2024/11/12 19:02:402026/05/20 01:50:48AS10004S2fe00S15a37S2fe00S21400S20e00S26b00M523x525S15a37492x502S10004508x479S20e00486x496S26b00478x475verb [with object] to regularly or repeatedly give (someone) money that is due for work done, goods received, or a debt incurred: [with object and infinitive] : he paid the locals to pick his coffee beans | [no object] : I'll pay for your ticket.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc05\ud8fc\udc61\ud8c8\uddf8\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e2\udc21.mov"} j 33[ {!}frost2024/11/12 19:10:382026/05/03 22:26:21AS10040S2fe00S10048S2fe00S38006S2f900S2f900M525x520S10040510x481S10048475x481S2f900512x515S2f900476x515affix used to represent the position or movement of each leg, particularly how each are positioned or move independently from the another: Dennis propped his legs on the ottoman | Denise glides down the catwalk with effortless poise.Adam Frost{"video":"dominance: equal;\\n\ud8c0\udc41\ud8fc\udc61\ud8c0\udc49\ud8fc\udc61\ud8fc\udc07\ud8ef\udd61\ud8ef\udd61.mov"} yl 33 e!)frost2024/11/12 19:15:062026/04/03 17:09:27AS20320S2fe00S10006S2f900M508x512S20320493x488S2f900495x507affix used to represent the position or movement of a head: I couldn't see over the heads of the people in front of me | she got whiplashed from the accident.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8ef\udd61.mov"}zk 33[ ;!}frost2024/11/12 19:13:052026/05/03 22:26:32AS15a50S2fe00S15a58S2fe00S38006S2f900S2f900M522x518S15a50510x482S15a58478x482S2f900511x513S2f900479x513affix used to represent the position or movement of each foot, particularly how they are positioned or move independently of one another: she soaked her feet in the pool | he nervously tapped his foot.Adam Frost{"video":"dominance: equal;\\n\ud8c8\ude11\ud8fc\udc61\ud8c8\ude19\ud8fc\udc61\ud8fc\udc07\ud8ef\udd61\ud8ef\udd61.mov"} WW%m 33 =!)frost2024/11/12 19:19:552025/03/18 23:34:15AS15a50S2fe00S10006S2c100M512x531S15a50500x504S2c100488x470verb (after an object or noun) to move (in a vehicle), typically as fast speeds, along a dynamic course
        noun an amusement park attraction that consists of a light railroad track with many tight turns and steep slopes, on which people ride in small fast open cars.
        • a thing that contains or goes through wild and unpredictable changes: a terrific roller coaster of a book | the emotional roller coaster that was my adolescence.
        Adam Frost{"video":"dominance: right;\\n\ud8c8\ude11\ud8fc\udc61\u00d8\ud8ea\udc61.mov"} Zo 33i !efrost2024/11/12 19:28:392026/04/03 17:16:42AS14c02S38517S14c0aS38511S22a04S22a14M536x526S36d00479x474S14c02505x486S14c0a464x486S22a04519x511S22a14468x511adverb completely or entirely covering the body: after playing outside for hours, the kids were muddy all over.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc83\ud8fc\uddf8\ud8c7\udc8b\ud8fc\uddf2\ud8db\udfc5\ud8db\udfd5.mov"}"n 33 M!frost2024/11/12 19:25:112025/02/18 22:53:40AS18540S2fe00S18548S2fe00S21406S2880eS28816S20a00M547x525S18540497x496S18548478x493S2880e525x513S28816454x510S20a00493x475noun a marriage ceremony, especially considered as including the associated celebrations.Adam Frost{"video":"dominance: right;\\n\ud8cc\ude29\ud8fc\udc61\ud8cc\ude21\ud8fc\udc61\ud8d9\udf87\ud8e4\udf0f\ud8e4\udf17\ud8d8\udfc1.mov"} WW%p 33) Q!ofrost2024/11/12 19:38:302026/05/04 04:08:35AS1ce20S2fe00S10006S17620S1f000M518x535S1ce20496x466S17620497x500S1f000483x520noun
        1. a thick cloud of tiny water droplets suspended in the atmosphere at or near the earth's surface which obscures or restricts visibility (to a greater extent than mist; strictly, reducing visibility to below 1 km): the collision occurred in thick fog.
          • an opaque mass of something in the atmosphere: a whirling fog of dust.
          • Photography cloudiness which obscures the image on a developed negative or print.
        2. something that obscures and confuses a situation or someone's thought processes: it is all too easy to get so tangled in minutiae that the end goal becomes lost in a fog of detail.
        Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d3\udd61\ud8fc\udc61\u00d8\ud8cb\udc61\ud8d6\ude01.mov"} ,q 33g {!frost2024/11/12 19:39:392026/05/19 05:58:48AS12d22S2fe00S12d0aS2fe00S21400S20500S22116S22112M527x526S12d0a486x501S12d22484x477S22112520x500S22116474x474noun a storm with a violent wind, in particular a tropical cyclone in the Caribbean: a powerful hurricane hit the Florida coast.
        • a wind of force 12 on the Beaufort scale (equal to or exceeding 64 knots or 74 mph).
        Adam Frost{"video":"dominance: right;\\n\ud8c4\udd03\ud8fc\udc61\ud8c4\udceb\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8db\udc77\ud8db\udc73.mov"} + r33[ ]!)frost2024/11/12 19:41:112026/05/26 02:12:31AS14a20S2fe00S14a28S2fe00S38006S27106S27112M544x520S14a20510x492S14a28476x492S27106529x480S27112457x480S38b00470x493 M517x520S14a20483x492S27106502x480 S38b04470x493noun a serious, unexpected, and often dangerous situation requiring immediate action: your quick response in an emergency could be a lifesaver | times of emergency.
        • [as modifier] arising from or needed or used in an emergency: an emergency exit.

        PHONOLOGICAL VARIANTS
        emergency right-handedAdam Frost{"video":"dominance: equal;\\nletter: integrated;\\n\ud8c6\udfe1\ud8fc\udc61\ud8c6\udfe9\ud8fc\udc61\ud8fc\udc07\ud8e2\ude67\ud8e2\ude73.mov"} <<@s 33' K!-frost2024/11/12 19:45:112026/05/03 22:27:34AS14c00S2fe00S14c08S2fe00S38006S22510S22510S22a00S22a10M533x532S14c00510x483S14c08467x483S22510511x468S22510467x468S22a00515x517S22a10471x517verb (of a fire) to rise upward with visible flames: the house went up in flames.Adam Frost{"video":"dominance: equal;\\n\ud8c7\udc81\ud8fc\udc61\ud8c7\udc89\ud8fc\udc61\ud8fc\udc07\ud8db\uddf1\ud8db\uddf1\ud8db\udfc1\ud8db\udfd1.mov"} JJ2t 335 9!frost2024/11/12 19:47:152026/05/20 02:02:32AS18551S30007S18559S30001S22105S22103S26506S26516M564x518S2ff00482x483S18551537x472S18559451x472S22105531x473S22103474x473S26506515x476S26516433x476noun [often with modifier] a failure of electrical power supply: due to a power blackout, their hotel was in total darkness.
        • a period when all lights must be turned out or covered to prevent them being seen by the enemy during an air raid: people found it difficult to travel in the blackout.
        verb to stop the operation of several things that emits lights: turn off all the lights in the classroom before you leave.
        • to stop the operation of all such devices in a general vicinity: five minutes til lights out.
        Adam Frost{"video":"dominance: right;\\n\ud8cc\ude32\ud8f0\udc08\ud8cc\ude3a\ud8f0\udc02\ud8db\udc66\ud8db\udc64\ud8e1\udde7\ud8e1\uddf7.mov"} &u 33A -!}frost2024/11/12 19:49:302025/03/20 23:45:16AS15a10S2fe00S15a09S2fe00S21414S20e00S2480cM514x531S15a09491x479S15a10489x470S2480c487x503adjective damaged and showing lines on the surface from having split without coming apart: the old pipes were cracked and leaking.
        verb to break or cause to break without a complete separation of the parts: [no object] : the ice all over the lake had cracked | [with object] : a stone cracked the headlight glass on his car.
        noun a line on the surface of something along which it has split without breaking into separate parts: a hairline crack down the middle of the glass.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd1\ud8fc\udc61\ud8c8\uddca\ud8fc\udc61\ud8d9\udf95\ud8d9\udd41\ud8de\udf0d.mov"} v 33A g!}frost2024/11/12 19:51:112025/03/21 02:56:38AS18520S2fe00S15a59S2fe00S21400S20500S22104M518x519S15a59482x496S18520493x491S22104496x482adjective having lost its optimism, confidence, or enthusiasm.
        • (of something kept inflated, especially a tire) having lost some or all of its air, typically because of a puncture: you've got a flat tire.
        Adam Frost{"video":"dominance: right;\\n\ud8cc\ude01\ud8fc\udc61\ud8c8\ude1a\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8db\udc65.mov"} 00\x 33 +!)frost2024/11/12 19:55:032026/04/03 17:34:13AS15451S2fe00S10006S25300M513x535S15451488x512S25300488x466verb (of a gaseous substance, such as smoke or vapor) to rise in a spiraling or twisting motion: the smoke rose up from the fire.Adam Frost{"video":"dominance: right;\\n\ud8c7\udfd2\ud8fc\udc61\u00d8\ud8df\udf21.mov"}lw 33g )!gfrost2024/11/12 19:52:432026/05/04 04:10:21AS11a20S2fe00S10006S1f720S10120S19220S1f720S1fb20S17620S11a20M513x601S11a20492x399S1f720487x433S10120492x452S19220492x486S1f720487x509S1fb20492x528S17620492x551S11a20492x571noun an engine-cooling device in a motor vehicle or aircraft consisting of a bank of thin tubes in which circulating fluid is cooled by the surrounding air: the water in my car radiator froze.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c2\udde1\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8c0\udc81\ud8cd\udee1\ud8d7\udcc1\ud8d7\ude41\ud8cb\udc61\ud8c2\udde1.mov"} DD8y 33O g!Yfrost2024/11/12 19:57:072026/01/14 21:53:14AS20330S2fe00S10006S2f900S22f00S14c30M513x538S20330493x515S2f900495x533S22f00488x497S14c30488x463affix used to represent the position and repeated forceful movement of something distributed upward from a source: William watched the murky liquid gushing up.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd51\ud8fc\udc61\u00d8\ud8ef\udd61\ud8dc\udda1\ud8c7\udcb1.mov"} Pz 33g C!frost2024/11/12 23:56:432025/03/21 04:00:35AS15a40S2fe00S15a48S2fe00S21406S20500S26b07S26b11M536x522S15a40500x495S15a48485x495S26b07508x480S26b11464x478noun a pocket-sized flat folding case for holding money and plastic cards.
        • an app or online service used to make payments electronically or to store electronic tickets, documents, etc.: a person will be able to store cryptocurrency in these wallets.
        Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e2\udc28\ud8e2\udc32.mov"} *{ 33# e!kfrost2024/11/14 18:32:272026/05/03 22:28:13AS20350S2fe00S20358S2fe00S21406S20500S2a208S2a210S11520S2fe00S11528S2fe00S38006S14051S14059M563x531S20350501x488S20358484x488S2a208517x469S2a210460x469S11520545x473S11528440x473S14051532x507S14059438x507combining form a construction of break, U, and P; compare breakup.Adam Frost{"video":"dominance: equal;\\nfingerspelled: full;\\n\ud8d8\udd71\ud8fc\udc61\ud8d8\udd79\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e7\udcc9\ud8e7\udcd1\ud8c2\udc01\ud8fc\udc61\ud8c2\udc09\ud8fc\udc61\ud8fc\udc07\ud8c6\udc52\ud8c6\udc5a.mov"} ^| 333 c!Efrost2024/11/14 18:34:522026/05/03 22:28:29AS20320S2fe00S20328S2fe00S21406S20500S22a07S22a11S10e20S10e28M545x529S20320501x514S20328484x514S22a07516x502S22a11471x502S10e20530x471S10e28455x471verb (with reference to a couple) to end a romantic or sexual relationship: I was heartbroken when we broke up | I recently broke up with my fiancé.
        noun the end of a relationship: a marriage breakup.Adam Frost{"video":"dominance: equal;\\n\ud8d8\udd41\ud8fc\udc61\ud8d8\udd49\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8db\udfc8\ud8db\udfd2\ud8c1\udd61\ud8c1\udd69.mov"} |p}33'#!-frost2024/11/14 18:37:192026/05/26 03:15:02AS20350S2fe00S20358S2fe00S38006S22a04S22a14S14c50S14c58M530x534S20350511x466S20358475x466S22a04512x484S22a14476x484S14c50506x503S14c58471x503S38b00470x493 M512x534S20350493x466S22a04494x485S14c50488x503 S38b04470x493verb
        1. [at center loci] to let or make (something) fall vertically: the bodybuilder dropped the barbell after finishing the lift.
        2. to abandon or discontinue (a course of action or study): the charges against him were dropped last year | drop everything and get over here!.

        PHONOLOGICAL VARIANTS
        drop right-handedAdam Frost{"video":"dominance: equal;\\n\ud8d8\udd71\ud8fc\udc61\ud8d8\udd79\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8db\udfd5\ud8c7\udcd1\ud8c7\udcd9.mov"} N 33[ c!} frost2024/11/14 18:48:062026/05/20 02:03:44AS15a50S2fe00S15a39S2fe00S21400S20e00S26506M529x516S15a39472x485S15a50484x489S20e00499x489S26506514x488verb
        1. to discharge a worker becausg~ 33 !efrost2024/11/14 18:38:582026/05/05 17:40:29AS17620S2fe00S10006S1fb20M508x520S17620492x481S1fb20493x501noun time in addition to what is normal, such as time worked beyond one's scheduled working hours: fewer opportunities for overtime | [as modifier] : an overtime ban.
          • payment for time worked beyond one's scheduled hours.
          • extra time played at the end of a game that is tied at the end of the regulation time: they lost in overtime.
          Adam Frost{"video":"dominance: right;\\nfingerspelled: abbreviated;\\n\ud8cb\udc61\ud8fc\udc61\u00d8\ud8d7\ude41.mov"}pan class="entry" onclick="entry=1370; Query();">your turn (pronoun) [to front locus]
          my turn (pronoun) [to center locus]
          verb [center to right front loci] to transfer the next position in a sequence from one person or thing to another: when I am finished, it will be his turn to speak.
          INFLECTED FORMS
          their turn (verb) [center to right loci]
          your turn (verb) [center to front loci]
          my turn (verb) [front to center loci]
          combining form denoting a relationship resulting from a remarriage, especially one considered to take the place of the previous marriage: stepmother.Adam Frost{"video":"dominance: right;\\n\ud8d4\udec2\ud8fc\udc61\u00d8\ud8ea\udd28.mov"} %%W 33[ u!} frost2024/11/14 18:56:342025/03/21 21:50:51AS15a31S2fe00S20348S2fe00S21400S20e00S26503M519x523S20348482x491S15a31487x477S20e00507x498S26503493x510verb
          1. to dismiss (an employee) from a job: having to fire men who've been with me for years | you're fired!.
            • to abruptly or punitively remove someone from a role, often due to poor performance or conflict: The school fired the coach after the loss.
          2. to grab (someone) by the neck and cut off their head, especially as a form of execution: the king was beheaded.
          Adam Frost{"video":"dominance: right;\\n\ud8c8\uddf2\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde4.mov"} [[t 33 [!) frost2024/11/14 19:04:562026/01/14 19:44:01AS14402S2fe00S10006S22f04M516x520S14402485x481S22f04491x506affix used to represent the position or movement of a substance flowing or leaking from a source: the faucet is running | air was escaping from the tire.Adam Frost{"video":"dominance: right;\\n\ud8c6\udd83\ud8fc\udc61\u00d8\ud8dc\udda5.mov"}) 33' !- frost2024/11/14 18:59:512026/05/03 22:31:01AS14c50S2fe00S14c58S2fe00S38006S2f900S2f900S22510S22510M532x527S14c50508x488S14c58469x488S22510509x473S22510470x473S2f900514x522S2f900475x522affix used to represent the position and movement of a mass of entities or substances: the crowd moved toward the exit | fog rolled through the valley | rain flooded through the streets.Adam Frost{"video":"dominance: equal;\\n\ud8c7\udcd1\ud8fc\udc61\ud8c7\udcd9\ud8fc\udc61\ud8fc\udc07\ud8ef\udd61\ud8ef\udd61\ud8db\uddf1\ud8db\uddf1.mov"} Z9Z[ 33 )!) frost2024/11/14 19:28:152026/05/26 03:51:18AS15720S2fe00S10006S2f900M509x518S15720491x482S2f900498x513affix [to front locus] used to represent the position and sustained flow of something distributed from a source: the fireman sprayed water on the fire to put it out | the headlights illuminated the road ahead | the fan blew cool air across the room.Adam Frost{"video":"dominance: right;\\n\ud8c8\udcc1\ud8fc\udc61\u00d8\ud8ef\udd61.mov"}C 33O }!Y frost2024/11/14 19:14:402026/05/26 03:51:02AS20320S2fe00S10006S2f900S26500S14c20M512x539S20320493x516S2f900495x534S26500493x497S14c20489x461affix [to front locus] used to represent the position and distinct release of something distributed from a source: the water turned on and sprayed out of the hose.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8ef\udd61\ud8e1\udde1\ud8c7\udca1.mov"} xN33)9!c frost2024/11/22 19:21:302026/06/17 17:03:53AS1bb10S2fe00S10006S26500S14c40M513x541S1bb10488x513S14c40489x460S26500494x496M533x541S1bb10508x513S1bb18471x513S26500514x496S26510472x496S14c40509x460S14c48467x460adjective a phonological variant (right handed) of awful.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8d1\ude31\ud8fc\udc61\u00d8\ud8e1\udde1\ud8c7\udcc1.mov"} 33) =!A frost2024/11/14 19:31:332026/01/14 21:52:39AS20350S2fe00S10006S22a04S10004M508x533S20350493x467S22a04494x485S10004493x503affix used to the position and movement of a drop of a substance falling: a raindrop fell on my head | paint dripped from the paint brush.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd71\ud8fc\udc61\u00d8\ud8db\udfc5\ud8c0\udc05.mov"} ||33O=9!e frost2024/11/22 19:23:502026/06/16 19:50:53AS15a32S38622S15a3aS38624S20500S27122M537x520S37806485x506S15a3a510x501S15a32482x489S27122464x481S38b00470x493 M539x512S37806487x505S15a3a512x500S15a32484x488S20600462x497 S38b04470x493noun a very young child, especially one newly or recently born: his wife's just had a baby | [as modifier] : a baby girl.

          PHONOLOGICAL VARIANTS
          baby with touching movementsAdam Frost{"video":"dominance: right;\\n\ud8c8\uddf3\ud8fc\ude63\ud8c8\uddfb\ud8fc\ude65\ud8d8\udde1\ud8e2\ude83.mov"} L (08@HPX`hpx (08@HPX`hpx                                                            !  " ! # " $ # % $ & % ' & ( ' ) ( * ) + * , + - , . - / . 0 / 2 33[ !) frost2024/11/22 19:31:302026/05/09 00:42:34AS14a10S2fe00S14a18S2fe00S38006S2e10eS2e116M554x520S14a10514x491S14a18471x491S2e10e533x480S2e116446x480noun the most important and oldest festival of the Christian Church, celebrating the resurrection of Jesus Christ and held (in the Western Church) between March 21 and April 25, on the first Sunday after the first full moon following the northern spring equinox: Christians around the world are celebrating Easter.
          • the period in which Easter occurs, especially the weekend from Good Friday to Easter Monday: I was going to go home for Easter to be with my parents.
          Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udfd1\ud8fc\udc61\ud8c6\udfd9\ud8fc\udc61\ud8fc\udc07\ud8ed\udc6f\ud8ed\udc77.mov"} 1 33 U!) frost2024/11/22 19:33:522026/05/26 03:51:40AS10050S2fe00S10006S26500M508x524S10050493x494S26500493x477verb [center to front loci] to move to a place or position: at the stop sign, keep going straight.
          adverb [at front locus] in, at, or to a place or position: put the box there.
          preposition [at front locus] expressing location or arrival in a place or position: I work at the store.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc51\ud8fc\udc61\u00d8\ud8e1\udde1.mov"}   r 333WW!- frost2024/11/22 19:40:072026/06/17 17:00:00AS14c27S30004S10006S20500S2b901S14c20S30007S10006S20500S2b901M548x562S2ff00482x438S14c27504x463S2b901522x436S2ff00482x527S14c20515x514S2b901521x488S38b00470x493 M547x535S2ff00482x483S14c20515x472S14c2f470x508S2b901521x445S2b910452x481 S38b04470x493noun a parent of one's father or mother; a grandmother or grandfather: it must be a great blessing to have Chloe's grandparents living nearby.

          PHONOLOGICAL VARIANTS
          grandparent two-handedAdam Frost{"video":"dominance: right;\\n\ud8c7\udca8\ud8f0\udc05\u00d8\ud8d8\udde1\ud8e9\udd62\ud8c7\udca1\ud8f0\udc08\u00d8\ud8d8\udde1\ud8e9\udd62.mov"} zr 33O -! frost2024/11/22 22:01:272026/05/04 04:10:43AS18d20S2fe00S10006S1f720S19a20S17620M514x544S18d20488x456S1f720488x485S19a20486x504S17620493x528noun a thick creamy dressing consisting of egg yolks beaten with oil and vinegar and seasoned: spread each slice thinly with mayonnaise | she can have lean turkey with mustard and skip the mayo.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cd\udd01\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8ce\udde1\ud8cb\udc61.mov"} 33[ W!q frost2024/11/22 21:58:432026/04/14 04:46:59AS15410S30004S10006S20e00S22f04S20310S30c00M518x572S30c00482x483S15410494x510S22f04489x539S20310494x557interrogative adverb used to inquire the age of someone or something: how old are you?.Adam Frost{"video":"dominance: right;\\n\ud8c7\udf91\ud8f0\udc05\u00d8\ud8d9\udd41\ud8dc\udda5\ud8d8\udd31\ud8f1\udc81.mov"} R 33A 3!O frost2024/11/22 22:02:542026/05/04 04:11:15AS18d20S2fe00S10006S11520S20320S1fb20S1f720S11a20S10120M511x594S18d20490x406S11520495x435S20320495x469S1fb20495x488S1f720490x511S11a20495x530S10120495x564noun a pungent-tasting yellow or brown paste made from the crushed seeds of certain plants, typically eaten with meat or used as a cooking ingredient: Dijon mustard | [as modifier] : mustard sauce.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cd\udd01\ud8fc\udc61\u00d8\ud8c2\udc01\ud8d8\udd41\ud8d7\ude41\ud8d7\udcc1\ud8c2\udde1\ud8c0\udc81.mov"} ?` 33 3!) frost2024/11/22 22:09:202026/04/14 18:36:30AS18240S2fe00S10006S26500M512x517S18240488x502S26500493x483conjunction at a later point; after this: I did my homework, and then I played outside | when we finished dinner, we went for a walk.Adam Frost{"video":"dominance: right;\\n\ud8cc\udd01\ud8fc\udc61\u00d8\ud8e1\udde1.mov"}= 33O C! frost2024/11/22 22:04:072026/05/04 04:11:30AS14051S2fe00S10006S14a20S1f720S11a20M516x548S14051485x452S14a20498x480S1f720493x499S11a20498x518noun a yellowish- or brownish-green edible fruit that is typically narrow at the stalk and wider toward the base, with sweet, slightly gritty flesh.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udc52\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8d7\udcc1\ud8c2\udde1.mov"} |q|i 33 !U frost2024/11/22 22:33:292026/05/09 00:42:50AS10e20S2fe00S10006S27106M517x521S10e20484x479S27106502x481noun
          1. any of a group of organic compounds which are essential for normal growth and nutrition and are req 33O G! frost2024/11/22 22:19:262026/05/09 01:49:19AS13311S38517S13319S38511S20600S20600M538x518S13311504x491S13319471x491S20600516x482S20600463x482noun a retirement (sense 2).Adam Frost{"video":"dominance: equal;\\nletter: integrated;\\n\ud8c4\udf32\ud8fc\uddf8\ud8c4\udf3a\ud8fc\uddf2\ud8d8\ude41\ud8d8\ude41.mov"} 335 !e frost2024/11/22 22:16:082026/05/11 22:02:19AS10012S2fe00S10018S2fe00S21414S20600M518x522S10018492x492S10012488x498S20600482x479Adam Frost{"video":"dominance: right;\\n\ud8c0\udc13\ud8fc\udc61\ud8c0\udc19\ud8fc\udc61\ud8d9\udf95\ud8d8\ude41.mov"}ith infinitive] : he said to come early.
            • (of a text or a symbolic representation) to convey specified information or instructions: [with clause] : the law says such behavior is an offense.
            • [with object] to enable a listener or reader to learn or understand something by conveying or revealing (information or ideas): I don't want to say too much | the movie's title says it all · figurative.
            • (say something for) [with object] to present a consideration in favor of or excusing (someone or something): all I can say for him is that he's a better writer than some.
            • [with object] to utter the whole of (a speech or other set of words, typically one learned in advance): we say the Pledge of Allegiance each morning.

            INFLECTED FORMS
            say [in isolation]Adam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8f0\udc05\u00d8\ud8d8\udde1.mov"} A433 ]!) frost2024/11/22 22:37:362026/06/22 18:05:08AS1c507S33d00S10006S20500M524x537S33b00482x483S1c507499x512S38b00470x493 M524x543S2ff00482x483S1c507499x518 S38b04470x493verb [with object] to perceive or experience the flavor of: she had never tasted ice cream before.
            • [no object] to have a specified flavor: [with complement] : the spinach tastes delicious.
            • sample or test the flavor of (food or drink) by taking it into the mouth: the waiter poured some wine for him to taste.
            • eat or drink a small portion of.

            PHONOLOGICAL VARIANTS
            taste (sense 2) on chinAdam Frost{"video":"dominance: right;\\n\ud8d2\udde8\ud8f5\udee1\u00d8\ud8d8\udde1.mov"} a@ 33 ! frost2024/11/22 22:52:062025/03/06 00:21:21AS15a40S2fe00S15a48S2fe00S21406S20e00S27100S27114M542x534S15a40501x507S15a48487x498S20e00494x483S27100502x466S27114458x466noun an outing or occasion that involves taking a packed meal to be eaten outdoors: we swam and went on picnics.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8d9\udf87\ud8d9\udd41\ud8e2\ude61\ud8e2\ude75.mov"} 33[ }!} frost2024/11/22 22:47:522025/03/06 01:35:09AS11020S2fe00S11028S2fe00S38006S23600S23614M536x536S11020506x487S11028477x488S23600497x465S23614465x519noun (in a sport or game) a series of contests between a number of competitors, who compete for an overall prize.Adam Frost{"video":"dominance: right;\\n\ud8c1\ude21\ud8fc\udc61\ud8c1\ude29\ud8fc\udc61\ud8fc\udc07\ud8dd\udc41\ud8dd\udc55.mov"} w 335 %!e frost2024/11/22 22:59:152025/02/20 23:41:42AS14c51S2fe00S20348S2fe00S21400S20600M528x519S20348485x504S14c51472x481S20600506x498noun a smooth sauce made chiefly from tomatoes and vinegar, used as a condiment: I think they would be good dipped in ketchup.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcd2\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d8\ude41.mov"} 33 }!) frost2024/11/22 22:57:242025/02/20 23:52:57AS1ce50S2fe00S10006S23604M520x526S1ce50493x475S23604481x509noun a pungent, hot-tasting powder prepared from dried and ground peppercorns, commonly used as a spice or condiment to flavor food: season to taste with salt and pepper.Adam Frost{"video":"dominance: right;\\n\ud8d3\udd91\ud8fc\udc61\u00d8\ud8dd\udc45.mov"}  / 33u !} frost2024/11/22 23:14:182026/05/11 22:02:34AS15a41S38630S20359S2fe00S20500S2b703S20500M524x523S3780b478x493S20359503x478S15a41495x496S2b703478x482S20500476x503Adam Frost{"video":"dominance: right;\\n\ud8c8\ude02\ud8fc\ude71\ud8d8\udd7a\ud8fc\udc61\ud8d8\udde1\ud8e9\udca4\ud8d8\udde1.mov"}q 33A !- frost2024/11/22 23:01:402026/03/27 22:26:46AS10000S2fe00S10008S2fe00S38006S22a04S10e00S22a14S10e08M529x545S10000514x455S22a04515x489S10e00514x506S10008471x465S22a14472x499S10e08471x515S2fd04489x503adjective having equal parts between two different things: my dad is French and my mom is Italian. I'm half and half.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8fc\udc61\ud8c0\udc09\ud8fc\udc61\ud8fc\udc07\ud8db\udfc5\ud8c1\udd41\ud8db\udfd5\ud8c1\udd49.mov"} ww 33[ Q!} frost2024/11/22 23:21:402026/04/15 04:36:19AS20340S2fe00S20348S2fe00S38006S22a03S22a13M532x515S20340517x486S20348481x486S22a03504x501S22a13468x501adverb to a greater or predominant degree: he's mostly Italian with a little French.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8fc\udc07\ud8db\udfc4\ud8db\udfd4.mov"} xx 33{ ?!m frost2024/11/22 23:35:312026/04/16 18:46:13AS10011S30006S10006S20500S22a03S30005S20500S15a11S30007S10006S20600S10050S2fe00S15a36S2fe00S21400S20e00S26506M539x594S2ff00482x450S10011518x466S20500502x485S2ff00482x516S15a11510x520S20600508x507S15a36472x582S10050477x557S20e00497x573S26506513x572noun a week-long celebration of Deaf people and culture that takes place annually.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f0\udc07\u00d8\ud8d8\udde1\ud8db\udfc4\ud8f0\udc06\ud8d8\udde1\ud8c8\uddd2\ud8f0\udc08\u00d8\ud8d8\ude41\ud8c0\udc51\ud8fc\udc61\ud8c8\uddf7\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde7.mov"} \ 33% 5!} frost2024/11/22 23:43:182026/05/09 00:43:12AS14710S2fe00S10006S2df08S17610S2fe00S19209S2fe00S21406S20a00S2c400M541x539S14710492x485S2df08490x462S17610482x521S19209460x519S2c400501x516noun
            1. the small sweet blue-black edible berry of the blueberry plant.
            2. a hardy dwarf shrub of the heath family, with small, whitish drooping flowers and dark blue edible berries.
            Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udeb1\ud8fc\udc61\u00d8\ud8ec\udfa9\ud8cb\udc51\ud8fc\udc61\ud8cd\udeca\ud8fc\udc61\ud8d9\udf87\ud8d8\udfc1\ud8ea\udd81.mov"}  33' U!! frost2024/11/22 23:51:322025/07/28 18:04:27AS15a40S38622S15a3aS2fe00S2a404S16d17S33010S10006S20500M537x518S37806475x466S15a3a507x461S15a40497x427S2a404467x425S2ff00482x483S16d17517x495verb to actively engage with and pay attention to sound or melodies produced by instruments or voices, typically for enjoyment, entertainment, or relaxation.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude01\ud8fc\ude63\ud8c8\uddfb\ud8fc\udc61\ud8e7\udd85\ud8ca\udcf8\ud8f4\ude11\u00d8\ud8d8\udde1.mov"} ""Z 33} 1!% frost2024/11/22 23:57:042025/03/05 21:50:08AS1821dS2fe00S15a16S2fe00S21400S20e00S2880fS20340S2fe00S20348S2fe00S21400S2e734S20500M532x540S15a16505x482S1821d503x469S20e00491x472S2880f468x461S20340487x509S20348480x525S2e734505x504noun the calendar year just begun or about to begin: Happy New Year! | we're looking ahead to a profitable start to the new year.
            • the first day of the year; in the modern Western calendar, January 1.
            • the first few days or weeks of a year: interest rates may climb in the new year.
            • the period immediately before and after December 31: the facilities are closed over Christmas and New Year.
            • New Year's Eve or New Year's Day: I spent New Year's alone.
            Adam Frost{"video":"dominance: right;\\n\ud8cc\udcde\ud8fc\udc61\ud8c8\uddd7\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e4\udf10\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8ed\uded5\ud8d8\udde1.mov"} *  33q E! frost2024/11/23 19:07:282025/02/20 19:21:01AS10010S30004S10006S20500S2df00S16d40S2fe00S15a39S2fe00S21400S21100S26503S20340M521x622S2ff00482x483S10010486x512S2df00482x546S15a39494x599S16d40503x579S26503488x588S20340484x605noun cream which has been deliberately fermented by the addition of certain bacteria.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc11\ud8f0\udc05\u00d8\ud8d8\udde1\ud8ec\udfa1\ud8ca\udd21\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e1\udde4\ud8d8\udd61.mov"}R 33 !! !frost2024/11/23 19:12:242026/05/07 16:56:18AS10004S2fe00S10006S22a04S14c20S2fe00S10006S2880bS18526M522x561S10004493x439S22a04495x473S14c20479x495S2880b502x513S18526507x536proper noun, adjective, noun relating to or associated with South Africa.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc05\ud8fc\udc61\u00d8\ud8db\udfc5\ud8c7\udca1\ud8fc\udc61\u00d8\ud8e4\udf0c\ud8cc\ude07.mov"} w! 33 ?!A "frost2024/11/23 19:16:472026/05/09 00:43:26AS20301S2fe00S10006S22a04S14c20S2fe00S10006S2880bS18526M522x556S20301491x444S22a04495x468S14c20479x490S2880b502x508S18526507x531proper noun a country that occupies the most southern part of Africa; administrative capital, Pretoria; legislative capital, Cape Town; judicial capital, Bloemfontein.
            adjective relating to South Africa.
            noun a native or inhabitant of South Africa.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d8\udd22\ud8fc\udc61\u00d8\ud8db\udfc5\ud8c7\udca1\ud8fc\udc61\u00d8\ud8e4\udf0c\ud8cc\ude07.mov"} u" 33 ;!A #frost2024/11/23 19:22:182026/05/09 00:43:36AS20301S2fe00S10006S22a04S1f710S33200S10006S2e300S20500M518x542S20301490x431S22a04494x455S33100482x483S1f710477x498S2e300474x515proper noun, adjective, noun dated relating to or associated with South Africa.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d8\udd22\ud8fc\udc61\u00d8\ud8db\udfc5\ud8d7\udcb1\ud8f4\udec1\u00d8\ud8ed\udd21\ud8d8\udde1.mov"}1x496S15a28477x496S26500510x478S26510476x478S38b00470x493 M524x532S15a20511x469S15a28477x469S26500510x517S26510476x517S22b20492x501S26500510x500S26510476x500 M524x532S15a20511x469S15a28477x469S26500510x500S26510476x500S22b24492x501S26500510x517S26510476x517 S38b04470x493 S38a00464x490 M531x522S15a20510x495S15a28476x495S26a00504x479S26a10470x479adjective inspiring delight, pleasure, or admiration; extremely good: they all think she's wonderful | the climate was wonderful all the year round.

            PHONOLOGICAL VARIANTS
            wonderful with upward movement
            wonderful with downward movement

            INFLECTED FORMS
            wonderful [in isolation]Adam Frost{"video":"dominance: equal;\\n\ud8c8\udde1\ud8fc\udc61\ud8c8\udde9\ud8fc\udc61\ud8fc\udc07\ud8e1\udde1\ud8e1\uddf1.mov"} ss~$ 33A !O %frost2024/11/23 19:38:352026/05/11 22:02:54AS14720S2fe00S10006S11520S11a20S11a20S19220S1fb20S17620M511x595S14720491x405S11520490x431S11a20490x465S11a20490x499S19220490x533S1fb20490x556S17620490x579Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udec1\ud8fc\udc61\u00d8\ud8c2\udc01\ud8c2\udde1\ud8c2\udde1\ud8cd\udee1\ud8d7\ude41\ud8cb\udc61.mov"}#33w!) $frost2024/11/23 19:32:582026/08/15 18:51:29AS1dc41S2fe00S10006S2c307M524x519S1dc41477x489S2c307499x481M525x515S1dc40475x485S2a208502x487 M517x525S1dc02483x501S2c300491x475 M526x520S1dc02475x496S2c305499x480S20500508x506pronoun [to right front locus] denoting the person or thing that is next in sequence: it was her turn to speak.
            INFLECTED FORMS
            their turn (pronoun) [to right locus]
            adjective, verb upset.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\nvisible: sign;\\n\ud8c2\udc01\ud8fc\udc61\u00d8\ud8c6\udc52\ud8d8\udd41\ud8c6\udfe1\ud8d7\ude41.mov"}@, 33u ! -frost2024/11/23 19:52:372026/05/11 22:04:32AS1fb20S2fe00S10006S18720S14a20S14a20S1fb20M509x556S1fb20493x444S18720491x467S14a20493x499S14a20493x518S1fb20493x537Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d7\ude41\ud8fc\udc61\u00d8\ud8cc\udec1\ud8c6\udfe1\ud8c6\udfe1\ud8d7\ude41.mov"} M_/ 33 !7 0frost2024/11/23 19:56:202026/05/11 22:04:48AS18720S2fe00S10006S19220S1dc20S1dc20S17620S18720M515x586S18720492x414S19220494x446S1dc20485x469S1dc20485x503S17620494x537S18720492x557Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8cd\udee1\ud8d4\udea1\ud8d4\udea1\ud8cb\udc61\ud8cc\udec1.mov"}/. 33 +!7 /frost2024/11/23 19:55:072026/05/04 04:12:13AS18720S2fe00S10006S1f720S1dc20S1dc20S14a20S1fb20M513x579S18720495x422S1f720492x454S1dc20488x473S1dc20488x507S14a20497x541S1fb20497x560noun a wallet.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cc\udec1\ud8fc\udc61\u00d8\ud8d7\udcc1\ud8d4\udea1\ud8d4\udea1\ud8c6\udfe1\ud8d7\ude41.mov"} UUn1 33E M!m 2frost2024/11/23 20:17:022026/05/31 01:56:48AS36300M518x518S36300482x483affix used to mark something as with a lack of effort, control, or evenness: he staggered home | the child left their toys all over the place | the wind left her hair in a mess | the deck boards are all warped.Adam Frost{"video":"dominance: equal;\\n\ud8f9\udd21.mov"}50 33E [!m 1frost2024/11/23 20:15:522026/05/31 01:53:51AS35904M518x518S35904482x483affix used to mark something as with a lack of energy or alertness: he staggered across the finish line | he college student walked to class half asleep.Adam Frost{"video":"dominance: equal;\\n\ud8f8\udd65.mov"} #2335O!Y 3frost2024/11/23 20:27:282026/06/17 18:16:19AS15a02S38530S10006S20500S2c300S20500M543x521S36d00479x480S15a02487x505S2c300517x498M516x560S11520498x441S14051485x475S20320498x503S14a20498x522S1fb20498x541 M543x527S36d00479x473S14012484x498S2c300517x491adjective [predicative] unhappy or disappointed: she looked pale and upset.
            verb to make (someone) unhappy, disappointed, or worried: the accusation upset her.

            SIGN VARIATIONS
            upset fingerspelled
            upset with K-handAdam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8fc\ude11\u00d8\ud8d8\udde1\ud8ea\udd21\ud8d8\udde1.mov"} gL4 33 !) 5frost2024/11/23 20:38:412025/03/26 20:22:11AS15a20S2fe00S10006S22e04M509x525S15a20495x476S22e04492x507exclamation used to express a contemptuous or dismissive attitude: pfft, I don't know what all the fuss is about.Adam Frost{"video":"dominance: right;\\n\ud8c8\udde1\ud8fc\udc61\u00d8\ud8dc\udd45.mov"}3 335k;!{ 4frost2024/11/23 20:29:152026/06/17 18:15:13AS14012S38530S10006S20500S2c300S20500M543x527S36d00479x473S14012484x498S2c300517x491M543x521S36d00479x480S15a02487x505S2c300517x498adjective, verb upset.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c6\udc13\ud8fc\ude11\u00d8\ud8d8\udde1\ud8ea\udd21\ud8d8\udde1.mov"} yb6 33 !U 7frost2024/11/23 20:50:592026/05/11 22:05:20AS14000S33200S10006S20500M526x519S33100482x483S14000497x489Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c6\udc01\ud8f4\udec1\u00d8\ud8d8\udde1.mov"}5 33 y!) 6frost2024/11/23 20:45:102026/05/26 03:15:21AS15a30S2fe00S10006S26904M508x525S15a30494x476S26904492x507verb [front to center loci] to direct someone to approach or move closer: come look at this | come in and sit next to me | do you want to come fishing tomorrow?.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddf1\ud8fc\udc61\u00d8\ud8e1\udf65.mov"} w 9 33E !m :frost2024/11/23 21:18:102026/05/11 22:23:41AS33c00M518x518S33c00482x483Adam Frost{"video":"dominance: equal;\\n\ud8f5\ude81.mov"}U8 33A !} 9frost2024/11/23 21:15:332026/05/03 22:31:53AS1f740S2fe00S1f748S2fe00S21406S20500S26520M521x517S1f748479x502S1f740501x502S26520493x484verb to accompany or travel with to a specific location.Adam Frost{"video":"dominance: equal;\\n\ud8d7\udce1\ud8fc\udc61\ud8d7\udce9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8e1\ude01.mov"}7 33 [!C 8frost2024/11/23 20:54:592026/05/04 04:12:35AS14000S33200S10006S20500S17620S2fe00S10006S1ce20S1ce20M526x618S33100482x483S14000497x490S17620490x534S1ce20489x554S1ce20489x588adjective very annoyed or angry.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c6\udc01\ud8f4\udec1\u00d8\ud8d8\udde1\ud8cb\udc61\ud8fc\udc61\u00d8\ud8d3\udd61\ud8d3\udd61.mov"} "; 33[ !} noun a phonological variant (right handed) of emergency.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\nvisible: sign;\\n\ud8c6\udfe1\ud8fc\udc61\u00d8\ud8e2\ude67.mov"} NN.= 33[ s!- >frost2024/11/24 06:02:042025/03/12 19:18:28AS10e10S30007S10e18S30001S22702S22706S26a04S26a14S2fd04M551x544S2ff00482x483S10e10522x480S10e18463x496S22702541x482S22706449x499S26a04516x514S26a14457x530S2fd04490x533noun the style in which a person's hair is cut: he's always very particular about his haircut.
            • an act of cutting a person's hair: hair salons offering discounted haircuts.
            verb to cut a person's hair: I need to cut my hair before the wedding next week.Adam Frost{"video":"dominance: right;\\n\ud8c1\udd51\ud8f0\udc08\ud8c1\udd59\ud8f0\udc02\ud8db\udea3\ud8db\udea7\ud8e1\udfc5\ud8e1\udfd5\ud8ef\udee5.mov"} !!f? 33O C!Y @frost2024/11/24 06:11:282025/03/26 20:25:28AS14040S2fe00S10006S20e00S22904S2880eM519x531S14040490x489S20e00488x483S22904489x470S2880e482x519exclamation used to express feeling of frustration or disappointment about an event.Adam Frost{"video":"dominance: right;\\n\ud8c6\udc41\ud8fc\udc61\u00d8\ud8d9\udd41\ud8db\udf65\ud8e4\udf0f.mov"}q> 33A C!} ?frost2024/11/24 06:07:282025/03/26 20:24:13AS20341S2fe00S15a16S2fe00S21400S20e00S2880eM515x522S15a16488x510S20341487x493S2880e485x478exclamation used to express feelings of regret, empathy, or resigned disappointment.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd62\ud8fc\udc61\ud8c8\uddd7\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e4\udf0f.mov"} ||"A 33[ !} Bfrost2024/11/24 06:19:442026/05/11 22:09:09AS15a1fS2fe00S15a39S2fe00S21400S20e00S26507M526x524S15a39474x496S15a1f492x501S20e00501x489S26507513x476Adam Frost{"video":"dominance: right;\\n\ud8c8\udde0\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udde8.mov"}Z@ 33C O!A Afrost2024/11/24 06:15:262025/03/26 17:49:40AS18507S33200S10006S26500S14c30M538x531S33100482x483S18507501x504S26500518x505S14c30514x471adjective feeling or expressing indifference, lack of preference, or emotional detachment.Adam Frost{"video":"dominance: right;\\n\ud8cc\udde8\ud8f4\udec1\u00d8\ud8e1\udde1\ud8c7\udcb1.mov"} *B 33[!=!G Cfrost2024/12/16 00:55:102026/05/03 22:32:17AS14e50S2fe00S14e58S2fe00S38006S23004S23014M534x527S14e50507x474S14e58467x474S23004509x509S23014466x509M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M534x525S14e50507x476S14e58467x476S22f04509x511S22f14466x511 S38800464x496You might be looking for rain.Adam Frost{"video":"dominance: equal;"} eD 33 U! Efrost2025/01/17 19:13:522026/05/04 04:12:58AS1f702S38517S1f70aS38511S21100S23600S23610S1fb20S2fe00S10006S11520S14720M550x567S1f702511x456S1f70a475x456S21100494x433S23600511x433S23610451x433S1fb20492x488S11520492x511S14720493x545noun a tub in which to bathe.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d7\udca3\ud8fc\uddf8\ud8d7\udcab\ud8fc\uddf2\ud8d9\ude61\ud8dd\udc41\ud8dd\udc51\ud8d7\ude41\ud8fc\udc61\u00d8\ud8c2\udc01\ud8c6\udec1.mov"}C 33 #!e Dfrost2025/01/17 19:03:402026/05/09 00:44:05AS1fb20S2fe00S10006S27106S11551S2fe00S11559S2fe00S21400S20900M524x545S1fb20483x465S27106502x456S11559477x520S11551497x520S20900489x507noun a fixed receptacle into which a person may urinate or defecate: the bathroom is clean, but the toilet needs to be fixed.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d7\ude41\ud8fc\udc61\u00d8\ud8e2\ude67\ud8c2\udc32\ud8fc\udc61\ud8c2\udc3a\ud8fc\udc61\ud8d9\udf81\ud8d8\udf61.mov"} E 33? !Q Ffrost2025/01/17 19:19:422026/04/18 17:42:49AS15a10S30006S10006S20500S15a40S2fe00S15a48S2fe00S38005S26902S26916M529x576S2ff00482x483S15a10517x487S15a40512x549S15a48476x524S26902491x557S26916491x532noun a room for sleeping in: he shares his bedroom with a younger brother | [in combination] : a three-bedroom house.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddd1\ud8f0\udc07\u00d8\ud8d8\udde1\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc06\ud8e1\udf63\ud8e1\udf77.mov"} F 33# w!= Gfrost2025/01/17 19:47:162026/04/18 17:50:50AS15a51S2fe00S15a39S2fe00S21400S20500S2a208S20500S15a40S2fe00S15a48S2fe00S38005S26902S26916M527x552S15a39474x462S15a51485x472S20600482x448S2a208504x457S15a40512x525S15a48476x500S26902491x533S26916491x508noun a room where food is prepared and cooked.Adam Frost{"video":"dominance: right;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d8\udde1\ud8e7\udcc9\ud8d8\udde1\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc06\ud8e1\udf63\ud8e1\udf77.mov"} >G 33 3!Q Hfrost2025/01/17 20:10:032026/05/09 00:44:21AS1ce20S2fe00S1ce28S2fe00S38006S2df06S2df1eS15a40S2fe00S15a48S2fe00S38005S26902S26916M524x560S1ce20502x469S1ce28477x469S2df06502x441S2df1e479x441S15a40512x533S15a48476x508S26902491x541S26916491x517noun a living room used by all family members for recreation and relaxation.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d3\udd61\ud8fc\udc61\ud8d3\udd69\ud8fc\udc61\ud8fc\udc07\ud8ec\udfa7\ud8ec\udfbf\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc06\ud8e1\udf63\ud8e1\udf77.mov"} ee3I 33? w!Q Jfrost2025/01/17 20:45:112026/04/18 18:10:01AS15a02S2ff00S10006S22a04S14720S2fe00S14728S2fe00S21406S20600S2e004M528x566S2ff00482x483S15a02485x497S22a04494x512S14720489x535S14728473x535S2e004507x538noun the main entrance to a house or building.Adam Frost{"video":"dominance: right;\\n\ud8c8\uddc3\ud8ef\udfa1\u00d8\ud8db\udfc5\ud8c6\udec1\ud8fc\udc61\ud8c6\udec9\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41\ud8ed\udc05.mov"}`H 33e !i Ifrost2025/01/17 20:19:492026/04/18 18:09:09AS14c10S38510S10006S20e00S22f00S15a40S2fe00S15a48S2fe00S38005S26902S26916M524x549S14c10478x457S22f00498x451S20e00504x469S15a40512x522S15a48476x497S26902491x530S26916491x506noun a room in a house for hosting and entertaining guests.Adam Frost{"video":"dominance: right;\\n\ud8c7\udc91\ud8fc\uddf1\u00d8\ud8d9\udd41\ud8dc\udda1\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc06\ud8e1\udf63\ud8e1\udf77.mov"} }J 331 C!% Kfrost2025/01/17 21:05:262026/04/18 18:11:07AS1f702S38517S1f70aS38511S21100S22a00S22a10S15a40S2fe00S15a48S2fe00S38005S26902S26916M527x551S1f70a474x467S1f702512x467S21100494x459S22a00513x449S22a10475x449S15a40512x524S15a48476x497S26902491x531S26916491x506noun a room in a house for general and informal everyday use: the apartment has a comfy living room with sofas, chairs, TV, and dining table.Adam Frost{"video":"dominance: right;\\n\ud8d7\udca3\ud8fc\uddf8\ud8d7\udcab\ud8fc\uddf2\ud8d9\ude61\ud8db\udfc1\ud8db\udfd1\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc06\ud8e1\udf63\ud8e1\udf77.mov"} @K 33W k!_ Lfrost2025/01/17 21:12:482026/05/04 04:13:15AS15a51S2fe00S15a57S2fe00S38006S2d508S2d510S2d508S2d510S14051S2fe00S10006S17620S17620S1dc20M542x575S15a51503x445S15a57475x445S2d508520x426S2d510459x426S2d508520x437S2d510459x437S14051485x478S17620498x506S17620498x526S1dc20490x545noun an artificial pool for swimming in.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8c8\ude12\ud8fc\udc61\ud8c8\ude18\ud8fc\udc61\ud8fc\udc07\ud8eb\udfe9\ud8eb\udff1\ud8eb\udfe9\ud8eb\udff1\ud8c6\udc52\ud8fc\udc61\u00d8\ud8cb\udc61\ud8cb\udc61\ud8d4\udea1.mov"} aM 33e !u Nfrost2025/01/17 22:05:432026/07/19 20:15:54AS20340S2fe00S20348S2fe00S21400S21100S2ea3eS15a12S38620S15a1aS38626S20600M539x535S20340501x466S20348492x483S21100484x466S15a1a512x523S15a12482x509S37806487x523S20600462x518noun a low table, typically placed in front of a sofa.Adam Frost{"video":"dominance: right;\\n\ud8d8\udd61\ud8fc\udc61\ud8d8\udd69\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8ed\udfff\ud8c8\uddd3\ud8fc\ude61\ud8c8\udddb\ud8fc\ude67\ud8d8\ude41.mov"}L 33 e!% Mfrost2025/01/17 21:23:082026/04/19 15:25:54AS15411S2fe00S1541fS2fe00S37f00S2e10eS2e112S15a40S2fe00S15a48S2fe00S38005S26902S26916M542x558S15411492x446S1541f483x465S2e10e521x443S2e112459x456S15a40512x531S15a48476x506S26902491x539S26916491x514noun a room where clothes are washed.Adam Frost{"video":"dominance: right;\\n\ud8c7\udf92\ud8fc\udc61\ud8c7\udfa0\ud8fc\udc61\ud8fb\udfa1\ud8ed\udc6f\ud8ed\udc73\ud8c8\ude01\ud8fc\udc61\ud8c8\ude09\ud8fc\udc61\ud8fc\udc06\ud8e1\udf63\ud8e1\udf77.mov"} tN 33o +!m Ofrost2025/01/17 22:17:382026/04/19 15:31:22AS14c00S2fe00S14c08S2fe00S38006S22510S22510S23600S23614S14750S2fe00S14758S2fe00S21406S20500S23b04S23b1cM542x554S14c00511x462S14c08468x462S22510512x447S22510468x447S23600503x495S23614459x495S14750501x522S14758485x522S23b04518x533S23b1c464x533noun a place for a domestic fire, especially a grate or hearth at the base of a chimney: Tess cleared the ashes from the fireplace | a big open fireplace with a brick surround | a cast-iron stove was installed in the old fireplace.
            • a structure surrounding a fireplace: a chipped tile fireplace.
            Adam Frost{"video":"dominance: right;\\n\ud8c7\udc81\ud8fc\udc61\ud8c7\udc89\ud8fc\udc61\ud8fc\udc07\ud8db\uddf1\ud8db\uddf1\ud8dd\udc41\ud8dd\udc55\ud8c6\udef1\ud8fc\udc61\ud8c6\udef9\ud8fc\udc61\ud8d9\udf87\ud8d8\udde1\ud8dd\ude25\ud8dd\ude3d.mov"} O 33 !% Pfrost2025/01/17 22:32:082026/04/19 15:31:58AS1ed40S2fe00S1ed48S2fe00S38006S2f900S2f900S15411S2fe00S1541fS2fe00S37f00S2e10eS2e112M542x546S1ed40504x454S1ed48471x454S2f900517x476S2f900472x476S15411492x491S1541f483x510S2e10e521x488S2e112459x501noun an appliance for washing dishes automatically.Adam Frost{"video":"dominance: right;\\n\ud8d6\udd21\ud8fc\udc61\ud8d6\udd29\ud8fc\udc61\ud8fc\udc07\ud8ef\udd61\ud8ef\udd61\ud8c7\udf92\ud8fc\udc61\ud8c7\udfa0\ud8fc\udc61\ud8fb\udfa1\ud8ed\udc6f\ud8ed\udc73.mov"} dP 33 !i Qfrost2025/01/17 22:52:262026/04/19 15:33:27AS1e101S33200S10006S20e00S22f04S15a51S2fe00S15a39S2fe00S21400S20e00S26a03M542x586S33100482x483S1e101486x500S20e00523x500S22f04517x515S15a39506x542S15a51492x542S20e00488x558S26a03472x565noun a disposable piece of absorbent paper used as a handkerchief or for cleaning the skin: a box of tissues | [mass noun] : Rosheen wiped her fingers on a sheet of tissue.Adam Frost{"video":"dominance: right;\\n\ud8d5\udc62\ud8f4\udec1\u00d8\ud8d9\udd41\ud8dc\udda5\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc4.mov"} cR 33 !W Sfrost2025/01/18 01:05:282026/05/11 22:09:26AS17620S2fe00S10006S1ce20M511x525S17620490x475S1ce20489x495Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cb\udc61\ud8fc\udc61\u00d8\ud8d3\udd61.mov"}9Q 33g }!- Rfrost2025/01/18 00:53:022025/04/16 02:53:25AS10000S30004S10006S20e00S22a04S21600S14c02S38530S10006S2e300M527x652S2ff00482x483S10000487x511S20e00514x514S22a04514x528S21600516x545S36d00479x568S14c02483x599S2e300490x625noun an area of skin on the abdomen marked by redness, often accompanied by irritation or inflammation: she developed a stomach rash after trying a new laundry detergent.Adam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8f0\udc05\u00d8\ud8d9\udd41\ud8db\udfc5\ud8da\udc41\ud8c7\udc83\ud8fc\ude11\u00d8\ud8ed\udd21.mov"} T 33) !o Ufrost2025/01/18 01:09:532026/05/11 22:10:00AS20320S2fe00S10006S14a20S1f720M510x527S20320495x474S14a20495x493S1f720490x512Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8d8\udd41\ud8fc\udc61\u00d8\ud8c6\udfe1\ud8d7\udcc1.mov"}cS 33 !W Tfrost2025/01/18 01:08:402026/05/11 22:09:53AS17620S2fe00S10006S11920M511x523S17620495x477S11920489x497Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cb\udc61\ud8fc\udc61\u00d8\ud8c2\udd81.mov"} mkVIP3 ]H7mGMM start, starts, starting, startedstart, starts, starting, started  andand additionaddition  addadd plusplus7== deaf person, deaf peopledeaf person, deaf people deafdeaf sweetssweets#)) candy, candiescandy, candies?EEsign, signs, signing, signedsign, signs, signing, signed%%all the timeall the timealwaysalways belowbelow% ++this exact spotthis exact spot !!right hereright here? EEtornado, tornadoes, tornadostornado, tornadoes, tornados= CCspin, spins, spinning, spunspin, spins, spinning, spunw}}turn around, turns around, turning around, turned aroundturn around, turns around, turning around, turned around 1111elevenelevenred, redsred, reds;AAtell, tells, telling, toldtell, tells, telling, told!''singlesingle 11 oneone ff~pV 33QS!K Wfrost2025/01/18 01:14:512026/05/18 05:42:15AS10000S30004S10006S20600M528x541S2ff00482x483S10000487x511S20600506x519M518x541S2ff00482x483S10000487x511verb [in isolation] to say.Adam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc01\ud8f0\udc05\u00d8\ud8d8\ude41.mov"}U 33kI!) Vfrost2025/01/18 01:12:412026/06/05 19:27:17AS10000S30004S10006S20500M518x541S2ff00482x483S10000487x511M528x541S2ff00482x483S10000487x511S20600506x519verb [reporting verb] to utter words so as to convey information, an opinion, a feeling or intention, or an instruction: [with direct speech] : “Thank you,” he said | [with clause] : he said the fund stood at $100,000 | [with object] : our parents wouldn't believe a word we said | [w CC9W 335 w!e Xfrost2025/01/18 01:26:402026/05/20 02:18:41AS1f521S2fe00S16d48S2fe00S37f00S28802M528x527S16d48473x507S1f521486x483S28802506x474verb [with object and adverbial of direction] to cause (a liquid) to flow into a container in a steady stream: pour some whiskey into my cup | water the plants.Adam Frost{"video":"dominance: right;\\n\ud8d7\udc02\ud8fc\udc61\ud8ca\udd29\ud8fc\udc61\ud8fb\udfa1\ud8e4\udf03.mov"} zzX 33I !U Yfrost2025/01/18 01:37:062026/04/19 15:42:07AS11551S2fe00S11559S2fe00S21400S20800S16d50S2fe00S16d58S2fe00S21406S2f900S2f900S20500S26506S26512M539x539S11559477x474S11551497x474S20800495x461S16d50502x511S16d58481x511S2f900506x534S2f900484x534S26506524x514S26512462x514noun an upholstered seating, typically for two or more people: I sat in an armchair and they sat on the couch.Adam Frost{"video":"dominance: right;\\n\ud8c2\udc32\ud8fc\udc61\ud8c2\udc3a\ud8fc\udc61\ud8d9\udf81\ud8d8\udf01\ud8ca\udd31\ud8fc\udc61\ud8ca\udd39\ud8fc\udc61\ud8d9\udf87\ud8ef\udd61\ud8ef\udd61\ud8d8\udde1\ud8e1\udde7\ud8e1\uddf3.mov"} MEY 33i g!Y Zfrost2025/01/18 01:44:042025/07/02 21:53:37AS10011S30007S10006S20e00S26a06S21800M571x521S2ff00482x483S10011516x491S20e00523x484S26a06537x477S21800553x486verb to have an idea or impression of the existence, presence, or truth of (something) without certain proof: she suspected that he might be bluffing.
            • to believe or feel that (someone) is guilty of an illegal, dishonest, or unpleasant act, without certain proof: parents suspected of child abuse.
            • form a theory or conjecture about a subject without firm evidence: my colleagues speculate about my private life | [with clause] : observers speculated that the authorities wished to improve their image.
            Adam Frost{"video":"dominance: right;\\n\ud8c0\udc12\ud8f0\udc08\u00d8\ud8d9\udd41\ud8e1\udfc7\ud8da\udd01.mov"}  Z 33AmK!G [frost2025/02/01 18:56:052026/05/03 23:57:42AS10041S2fe00S1000aS2fe00S21400S22a04S20500M517x526S1000a487x511S10041483x483S22a04491x474M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M517x522S1000a487x507S10041483x479 S38800464x496You might be looking for right/correct.Adam Frost{"video":"dominance: right;"} [ 33[=!G \frost2025/02/01 19:00:102026/05/03 23:57:56AS10020S2fe00S15a18S2fe00S21406S26a02S20600M529x525S15a18482x475S10020496x489S20600471x504S26a02515x498M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M520x522S15a18491x478S10020505x492S20600480x507 S38800464x496You might be looking for bell.Adam Frost{"video":"dominance: right;"} "\ 33[G!G ]frost2025/02/01 19:08:072026/05/03 23:58:04AS10013S2fe00S14c58S2fe00S21410S26a04S20710M529x534S14c58485x503S10013499x489S20710472x483S26a04476x466M541x524S15a30516x477S15a38473x477S23600502x507S23614459x507 M508x523S10040493x493S26500493x477 M538x531S2ff00482x483S16d10507x484S2e500515x504 M537x521S2ff00482x483S10011516x491S28108516x463 M529x526S14c58485x495S10013499x481S20710472x475 S38800464x496You might be looking for flip flops.Adam Frost{"video":"dominance: right;"} N] 33K !i ^frost2025/02/14 20:30:122026/04/19 15:43:39AS14e00S30005S10006S20500S28108S16d20S2fe00S2031aS2fe00S21400S21100S2ea32M542x580S2ff00482x483S14e00502x505S28108522x485S2031a490x565S16d20489x543S21100508x548noun a hot drink made with milk or water and chocolate or powdered chocolate: we sat in front of the fire and sipped hot chocolate | she had a latte and I had a hot chocolate.Adam Frost{"video":"dominance: right;\\n\ud8c7\udd41\ud8f0\udc06\u00d8\ud8d8\udde1\ud8e4\udc69\ud8ca\udd01\ud8fc\udc61\ud8d8\udd3b\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8ed\udff3.mov"} ^ 33W !9 _frost2025/02/14 20:54:142026/05/09 18:00:26AS11921S2fe00S15a5aS2fe00S21400S2e736S20500S15a11S2fe00S15a19S2fe00S21406S20600M524x544S15a5a478x485S11921492x472S2e736481x456S15a11501x521S15a19476x521S20600489x508proper noun a city in southwestern California, south of San Diego.Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8c2\udd82\ud8fc\udc61\ud8c8\ude1b\ud8fc\udc61\ud8d9\udf81\ud8ed\uded7\ud8d8\udde1\ud8c8\uddd2\ud8fc\udc61\ud8c8\uddda\ud8fc\udc61\ud8d9\udf87\ud8d8\ude41.mov"} E_ 33 ! `frost2025/02/14 21:07:542026/05/04 04:13:41AS1851cS2fe00S15a39S2fe00S21400S20e00S26a07S18d20S10006S1f720S1dc20S1dc20M533x586S15a39468x447S1851c480x443S20e00505x431S26a07512x415S18d20492x476S1f720492x505S1dc20488x523S1dc20488x556noun a large building or series of connected buildings containing a variety of retail stores and typically also restaurants.Adam Frost{"video":"dominance: right;\\nfingerspelled: full;\\n\ud8cc\uddfd\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc8\ud8cd\udd01\u00d8\ud8d7\udcc1\ud8d4\udea1\ud8d4\udea1.mov"} }` 33] !1 afrost2025/02/16 03:16:592026/05/24 17:42:05AS1f008S2fe00S10006M515x508S1f008486x493M515x508S1f000486x493 S38a00464x490 S38b00470x493 M515x508S1f018486x493 M515x508S1f028486x493 M515x512S1dc0a485x488 S38b04470x493noun a phonological variant (left handed) of G.

            PHONOLOGICAL VARIANTS
            G with knuckles facing upward
            G with palm facing forward
            G with thumb extendedAdam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8d6\ude09\ud8fc\udc61\u00d8.mov"} Bb 33? !} cfrost2025/02/16 04:38:012026/05/11 22:10:26AS1fb20S2fe00S10006S27106S15a51S2fe00S15a39S2fe00S21400S20e00S26a03M529x547S1fb20483x462S27106502x454S15a39506x502S15a51492x502S20e00488x519S26a03472x526Adam Frost{"video":"dominance: right;\\nletter: integrated;\\n\ud8d7\ude41\ud8fc\udc61\u00d8\ud8e2\ude67\ud8c8\ude12\ud8fc\udc61\ud8c8\uddfa\ud8fc\udc61\ud8d9\udf81\ud8d9\udd41\ud8e1\udfc4.mov"}:a33)u!a bfrost2025/02/16 03:55:012026/05/21 01:21:54AS12d08S30001S10006S20500S22114M518x518S2ff00482x483S12d08467x462S22114467x454M533x518S2ff00482x483S12d00510x462S12d08467x462S22114506x454S22114467x454noun a phonological variant (left handed) of rabbit.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c4\udce9\ud8f0\udc02\u00d8\ud8d8\udde1\ud8db\udc75.mov"} 8@px (08@HPX`hpxh`XPH@ i i h g g f f e e d d c 2 1 3 2 4 3 5 4 6 5 7 6 8 7 9 8 : 9 ; : < ; = < > = ? > @ ? A @ B A C B D C E D F E G F H G I H J I K J L K M L N M O N P O Q P R Q S R T S U T V U W V X W Y X Z Y [ Z \ [ ] \ ^ ] _ ^ ` _ a ` b a c b jjrd33[iM!} efrost2025/02/20 03:18:302026/06/05 18:18:41AS15a20S2fe00S15a28S2fe00S38006S26500S26510M524x523S15a2051c33M!g dfrost2025/02/20 03:07:442026/05/26 02:17:40AS15a20S2fe00S15a28S2fe00S38006S26500S26510S22b20S26500S26510M524x532S15a20511x469S15a28477x469S26500510x517S26510476x517S22b20492x501S26500510x500S26510476x500M531x522S15a20510x495S15a28476x495S26a00504x479S26a10470x479 M532x530S15a20513x471S15a28475x471S2e508509x503S2e510469x502adjective a phonological variant (upward movement) of wonderful.
            noun, adverb a phonological variant (upward movement) of Sunday.Adam Frost{"video":"dominance: equal;\\nvisible: sign;\\n\ud8c8\udde1\ud8fc\udc61\ud8c8\udde9\ud8fc\udc61\ud8fc\udc07\ud8e1\udde1\ud8e1\uddf1\ud8dc\udc41\ud8e1\udde1\ud8e1\uddf1.mov"} .odSFq`Q>3##time, timestime, timesC2IIknit, knits, knitting, knittedknit, knits, knitting, knitted1correctcorrect!0''right, rightsright, rights/therethere .thethe-thatthat,thisthis +itit *youyou )butbut(differentdifferent'have nohave noe&kknot have, don't have, doesn't have, didn't havenot have, don't have, doesn't have, didn't have %nono$nonenone #Zz9"??meet, meets, meeting, metmeet, meets, meeting, met!publicpublicC IIhearing person, hearing peoplehearing person, hearing peoplehearinghearingblackblack]cc subtract, subtacts, subtracting, subtractedsubtract, subtacts, subtracting, subtracted negativenegative minusminusEKK begin, beings, beginning, begunbegin, beings, beginning, begun TT(e333k%!7 ffrost2025/02/20 05:11:502026/05/26 21:54:57AS10020S2fe00S10008S2fe00S21414S26500S26514S20500M511x519S10008490x482S10020496x489M516x515S10010501x485S10018485x485 S38a00464x490 S38b00470x493 M511x519S10000496x482S10028490x489 S38b04470x493verb [from center and front loci] to meet: we met for lunch.

            PHONOLOGICAL VARIANTS
            meet left-handedAdam Frost{"video":"dominance: right;\\nvisible: sign;\\n\ud8c0\udc21\ud8fc\udc61\ud8c0\udc09\ud8fc\udc61\ud8d9\udf95\ud8e1\udde1\ud8e1\uddf5\ud8d8\udde1.mov"} XXaffix used to represent the position and movement of air through a space or area: the wind blew in my face | smoke passed through the room.Adam Frost{"video":"dominance: right;\\n\ud8c7\udcc1\ud8fc\udc61\ud8c7\udcc9\ud8fc\udc61\ud8fc\udc08\ud8ef\udd61\ud8ef\udd61.mov"}df 333Q;!5 gfrost2025/02/20 05:19:072026/05/26 03:52:44AS10028S2fe00S10000S2fe00S21414S26510S26504S20500M511x519S10000496x482S10028490x489M511x519S10008490x482S10020496x489verb [from center and front loci] a phonological variant (left handed) of meet.Adam Frost{"video":"dominance: left;\\nvisible: sign;\\n\ud8c0\udc29\ud8fc\udc61\ud8c0\udc01\ud8fc\udc61\ud8d9\udf95\ud8e1\uddf1\ud8e1\udde5\ud8d8\udde1.mov"} 9a9"i 33[ !} ifrost2026/08/27 18:16:252026/08/27 18:18:58AS14740S2fe00S14748S2fe00S21400S21100S26500M510x537S14748491x515S14740496x497S21100496x481S26500495x464Adam Frost{"video":"dominance: right;\\n\ud8c6\udee1\ud8fc\udc61\ud8c6\udee9\ud8fc\udc61\ud8d9\udf81\ud8d9\ude61\ud8e1\udde1.mov"}h 33' !-pfrost2026/02/13 18:38:372026/05/07 16:58:06AS1bb50S2fe00S1bb58S2fe00S38006S2b700S2b711S14c50S14c58M533x544S1bb50512x516S1bb58468x516S2b700506x490S2b711475x490S14c50503x456S14c58472x456proper noun an island country and continent in the southern hemisphere, in the southwestern Pacific Ocean, a member state of the Commonwealth of Nations; capital, Canberra.
            adjective relating to Australia.
            nouna native or inhabitant of Australia, or a person of Australian descent.Adam Frost{"video":"dominance: equal;\\n\ud8d1\ude71\ud8fc\udc61\ud8d1\ude79\ud8fc\udc61\ud8fc\udc07\ud8e9\udca1\ud8e9\udcb2\ud8c7\udcd1\ud8c7\udcd9.mov"}S38a00464x490 M535x531S18510497x496S18514473x488S20600485x478S2c300509x469S2c314465x507 M528x520S15a0a490x508S15a41505x497S20e00490x494S27102472x480 L508x508S17610492x492 R508x515S10e00493x485 S38a04464x490 M512x519S10020488x489S2ed09493x481 M514x537S20348497x522S14c51487x497S20e00498x482S26500497x464 M537x521S2ff00482x483S10011516x491S28108516x463 M508x515S10000493x485 M523x523S15a40510x478S15a48478x478S22a04510x508S22a14477x508 S38800464x496 S38a00464x490 M516x596S14051485x404S11a20498x432S17620498x466S11920492x486S17620498x516S11520498x536S11920492x570 S38a00464x490 M527x532S10013477x478S10018474x502S28802505x469 M523x523S15a40510x478S15a48478x478S22a04510x508S22a14477x508 M508x525S17620492x475S11a20492x495 M532x516S15a39468x484S15a31483x493S2920a501x485 M536x534S2ff00482x483S10601513x506 M522x517S11541498x483S11549479x490 M508x525S17620492x475S11a20492x495 M522x522S15a02495x479S15a0a479x483S20e00501x494S26a04494x508 M527x561S2ff00482x483S10601504x496S22a03505x525S15a39478x524S10650486x535 S38a04464x490 M521x516S10043491x485S20500479x505 M539x515S18241514x485S18249461x485S20500507x504S20500484x504 M545x537S2ff00482x483S11010510x510S22f00520x495 S38800464x496 M518x572S10040493x542S26500493x526S30a00482x483 M535x600S14c30509x518S14c38467x518S26504513x551S26514472x551S14e30509x569S14e38465x569S30a00482x483 M518x551S10000503x521S30a00482x483 S38900464x493 S38a00464x490 S38b00470x493 M508x515S10008493x485 S38b04470x493
            counting number [as independent number]
            1. the number between zero and two: there's only room for one person.
            pronoun
            1. referring to a person or thing previously mentioned or easily identified: I have some gum. Do you want one?.
            PHONOLOGICAL VARIANTS
            one left-handed
            Adam Frost{"video":"dominance: right;\\n\ud8c0\udc01\ud8fc\udc61\u00d8.mov"}for another two            .
    2. (usually one's life) the period between the birth and death of a living thing, especially a human being: she has lived all her life in the country | I want to be with you for the rest of my life.
    3. vitality, vigor, or energy: she was beautiful and full of life.
    adjective [predicative]
    1. (of a person, animal, or plant) living, not dead: hopes of finding anyone still alive were fading | he was kept alive by a feeding-tube.
      • continuing in existence or use: keeping hope alive | militarism was kept alive by pure superstition
    DERIVATIVES
    address [frequentative]
    Adam Frost{"video":"dominance: equal;\\n\ud8d7\udca3\ud8fc\uddf8\ud8d7\udcab\ud8fc\uddf2\ud8d9\ude61\ud8db\udfc1\ud8db\udfd1.mov"}munications could be established with central control     | mission control.
  • Computing short for control key: note that Control plus various keys on the numeric keypad will move you around the text.
  • the period during which a sovereign rules: the original chapel was built in the reign of Charles I.
    • the period during which someone or something is predominant or preeminent: these historic seconds inaugurated the reign of negative political advertising.
    • a group or individual used as a standard of comparison for checking the results of a survey or experiment: they saw no difference between the cancer patients and the controls.
      • DERIVATIVES
      manager noun
      Adam Frost{"video":"dominance: right;\\n\ud8c0\ude81\ud8fc\udc61\ud8c0\ude89\ud8fc\udc61\ud8fc\udc08\ud8e2\ude61\ud8e2\ude75.mov"} jJ:WjWZ]])look at, looks at, looking at, looked atlook at, looks at, looking at, looked at9Y??(lose, loses, losing, lostlose, loses, losing, lostWX]]'look at, looks at, looking at, looked atlook at, looks at, looking at, looked at/W55&read, reads, readingread, reads, reading V%2222U!!%twenty-twotwenty-twoT $stare forward, stares forward, staring forward, stared forwardstare forward, stares forward, staring forward, stared forwardS$look forward, looks forward, looking forward, looked forwardlook forward, looks forward, looking forward, looked forward?REE$view, views, viewing, viewedview, views, viewing, viewedIQOO$watch, watches, watching, watchedwatch, watches, watching, watched[Paa$stare at, stares at, staring at, stared atstare at, stares at, staring at, stared atWO]]$look at, looks at, looking at, looked atlook at, looks at, looking at, looked at IeT9j_8kLA,qTI w8Rrv!!7nationallynationallyu7of courseof courset7naturallynaturallys7normallynormally%r++7nation, nationsnation, nationsq7naturenaturep7nationalnationalo7naturalnaturaln7normalnormal m6Nnl##5seat, seatsseat, seats!k''5chair, chairschair, chairs5j;;4sit, sits, sitting, satsit, sits, sitting, sat7i==3university, universitiesuniversity, universitiesh##2name, namesname, namesg1HHhh%f++1hard of hearinghard of hearing e0UuGdMM/paint, paints, painting, paintedpaint, paints, painting, painted9c??.high school, high schoolshigh school, high schools b-Hh#a)),very difficultvery difficult`,very hardvery hard_+difficultdifficult^+hardhard)]//*journey, journeysjourney, journeys\##*trip, tripstrip, tripsO[UU*travel, travels, traveling, traveledtravel, travels, traveling, traveled PeX?2$l`<tv\P MEeLBerkeleyberkeleyLBrooklynbrooklynLBostonboston KBb##Jblue, bluesblue, blues!''Ibrown, brownsbrown, browns H1414HfourteenfourteenSYYGspeak, speaks, speaking, spoke, spokenspeak, speaks, speaking, spoke, spoken? EEGtalk, talks, talking, talkedtalk, talks, talking, talked F44 Ffourfour% ++Epurple, purplespurple, purples DPBpb!''DPacific Beachpacific beach!''Dpeanut butterpeanut butter CPpGMMBwear, wears, wearing, wore, wornwear, wears, wearing, wore, worn#))Bdress, dressesdress, dressesAdog, dogsdog, dogs @Kk##?pink, pinkspink, pinks >nono =1313~=thirteenthirteen }<2323|%%<twenty-threetwenty-three;{AA;hike, hikes, hiking, hikedhike, hikes, hiking, hiked z:33y:threethreex##9tree, treestree, trees 6xb'J* lZ6!)''Xmovie, moviesmovie, movies(Wfinefine!'''Vskirt, skirtsskirt, skirts&Uclothesclothes;%AATlike, likes, liking, likedlike, likes, liking, liked!$''Swhite, whiteswhite, whites###Rgrey, greysgrey, greys"##Rgray, graysgray, grays9!??Qduplication, duplicationsduplication, duplications !!Qreproduce, reproduces, reproducing, reproducedreproduce, reproduces, reproducing, reproduced Qimitate, imitates, imitating, imitatedimitate, imitates, imitating, imitatedciiQduplicate, duplicates, duplicating, duplicatedduplicate, duplicates, duplicating, duplicatedAGGQcopy, copies, copying, copiedcopy, copies, copying, copiedPasleepasleepCIIPsleep, sleeps, sleeping, sleptsleep, sleeps, sleeping, slept!''Ocolor, colorscolor, colors N55Nfivefive Pt4&v,PO<UU_detest, detests, detesting, detesteddetest, detests, detesting, detested+;11^victory, victoriesvictory, victories5:;;^win, wins, winning, wonwin, wins, winning, won!9'']brand, brandsbrand, brandsG8MM]label, labels, labeling, labeledlabel, labels, labeling, labeled;7AA\lady, ladieslady, ladies%6++\female, femalesfemale, females5%%\woman, womenwoman, women4oodbyegoodbye 3[byebye 2[hihiK1QQZgentleman, gentlemengentleman, gentlemen0##Zmale, malesmale, males/Zman, menman, men[.aaYdescribe, describes, describing, describeddescribe, describes, describing, describedW-]]Yexplain, explains, explaining, explainedexplain, explains, explaining, explainedE,KKXmotion picture, motion picturesmotion picture, motion pictures!+''Xvideo, videosvideo, videos*##Xfilm, filmsfilm, films :tH (N:Icso soso soHbspell out, spells out, spelling out, spelled out, spelt outspell out, spells out, spelling out, spelled out, spelt outUG[[bspell, spells, spelling, spelled, speltspell, spells, spelling, spelled, speltwF}}bfingerspell, fingerspells, fingerspelling, fingerspelledfingerspell, fingerspells, fingerspelling, fingerspelled5E;;atypewriter, typewriterstypewriter, typewriters-D33akeyboard, keyboardskeyboard, keyboards;CAAatype, types, typing, typedtype, types, typing, typed?BEE`talk, talks, talking, talkedtalk, talks, talking, talkedCAII`chat, chats, chatting, chattedchat, chats, chatting, chattedK@QQ_abhor, abhors, abhorring, abhorredabhor, abhors, abhorring, abhorredS?YY_despise, despises, despising, despiseddespise, despises, despising, despisedK>QQ_loathe, loathes, loathing, loathedloathe, loathes, loathing, loathed;=AA_hate, hates, hating, hatedhate, hates, hating, hated C\0 pX4x2C [kclose downward, closes downward, closing downward, closed downwardclose downward, closes downward, closing downward, closed downwardCZIIkclose, closes, closing, closedclose, closes, closing, closedYjuprightuprightCXIIjraise, raises, raising, raisedraise, raises, raising, raisedwW}}jopen upward, opens upward, opening upward, opened upwardopen upward, opens upward, opening upward, opened upward?VEEjopen, opens, opening, openedopen, opens, opening, opened!U''ibeard, beardsbeard, beardsThbowlingbowling!S''gscore, scoresscore, scoresR!!gaccountingaccountingGQMMgcount, counts, counting, countedcount, counts, counting, counted Pfhothot!O''epupil, pupilspupil, pupils)N//elearner, learnerslearner, learners)M//estudent, studentsstudent, studentsGLMMdlearn, learns, learning, learnedlearn, learns, learning, learnedKcso-soso-soJcsomewhatsomewhat 7P75y]I7mrzerozerolr00krohoh jrOoiqzerozerohq00gpEnglishenglishf!!oClairemontclairemonte##ocholesterolcholesterol1d77nchocolate, chocolateschocolate, chocolatesOcUUmlisten, listens, listening, listenedlisten, listens, listening, listenedabggmfocus on, focuses on, focusing on, focused onfocus on, focuses on, focusing on, focused onIaOOmfocus, focuses, focusing, focusedfocus, focuses, focusing, focused` mpay attention, pays attention, paying attention, paid attentionpay attention, pays attention, paying attention, paid attention%_++lwindow, windowswindow, windowsc^iikshut out, shuts out, shutting out, shutted outshut out, shuts out, shutting out, shutted outc]iikclose off, closes off, closing off, closed outclose off, closes off, closing off, closed outG\MMklower, lowers, lowering, loweredlower, lowers, lowering, lowered |@6lR2|[aazthere is, there are, there was, there werethere is, there are, there was, there were399zhave, has, having, hadhave, has, having, had%%ycloseclose##ynearnearyclose byclose byynearbynearby~xshortsshorts}##whead, headshead, heads9|??vdraw, drawsdraw, draws{vtie, tiestie, ties#z))vjusticejusticeKyQQvequality, equalitiesequality, equalitiesx##vjustjustw##vfairfairv##vevenevenuvtiedtiedGtMMvequal, equals, equaling, equaledequal, equals, equaling, equaledSsYYutrousers, trousers, a pair of trouserstrousers, trousers, a pair of trousersruslacksslacksq##upants, pantpants, pantpttiredtiredosokayokay nsokok C{gQ1wc'lxC277shut, shuts, shuttingshut, shuts, shuttingDIIclose, closes, closing, closedclose, closes, closing, closed##door, doorsdoor, doors##door, doorsdoor, doorshmmpull open, pulls open, pulling open, pulled openpull open, pulls open, pulling open, pulled open@EEopen, opens, opening, openedopen, opens, opening, opened?EEtrousers, a pair of trouserstrousers, a pair of trousersslacksslacks##pants, pantpants, pant9??~hellos, helloing, helloedhellos, helloing, helloed~hellohelloI OO}downtown, downtownsdowntown, downtowns %%}city, citiescity, cities ##}town, townstown, towns |eatingeating |diningdining##|food, foodsfood, foods{repeatrepeat{againagainzexist, exists, existing, existedexist, exists, existing, existed wU4qH7w+##song, songssong, songs*musicmusicD)IIclose, closes, closing, closedclose, closes, closing, closed@(EEfold, folds, folding, foldedfold, folds, folding, folded'-er-er&&++person, personsperson, persons%##text, textstext, texts,$11textbook, textbooktextbook, textbook###book, booksbook, books"##text, textstext, texts.!33textbook, textbookstextbook, textbooks ##book, booksbook, books@EEopen, opens, opening, openedopen, opens, opening, openedPUUunfold, unfolds, unfolding, unfoldedunfold, unfolds, unfolding, unfoldedhereherebyebye hihijoopush shut, pushes shut, pushing shut, pushed shutpush shut, pushes shut, pushing shut, pushed shutrwwpush close, pushes close, pushing close, pushed closepush close, pushes close, pushing close, pushed close l)q*dQ>#?easilyeasily>easyeasy=fifteenfifteen <1515;some ofsome of:somesome9##part, partspart, parts8pleasantpleasant7kindkind6nicenice*5//college, collegescollege, colleges@4EEcook, cooks, cooking, cookedcook, cooks, cooking, cooked.333document, documentsdocument, documents"2''paper, paperspaper, papersD1IIraise, raises, raising, raisedraise, raises, raising, raisedh0mmgrow up, grows up, growing up, grew up, grown upgrow up, grows up, growing up, grew up, grown upJ/OOgrow, grows, growing, grew, growngrow, grows, growing, grew, grown@.EEwalk, walks, walking, walkedwalk, walks, walking, walkedF-KKconcert, concertsconcert, concertsH,MMsing, sings, singing, sang, sungsing, sings, singing, sang, sung :|U"rAz'[:Q##Chula Vistachula vista(P--curriculum vitaecurriculum vitae&O++-hundred-hundred NCchMmmlisten to, listens to, listening to, listened tolisten to, listens to, listening to, listened toPLUUlisten, listens, listening, listenedlisten, listens, listening, listenedRKWWdrink, drinks, drinking, drank, drunkdrink, drinks, drinking, drank, drunk.J33computer, computerscomputer, computers>ICCillustration, illistrationsillustration, illistrations.H33portrait, portraitsportrait, portraits"G''image, imagesimage, images6F;;photograph, photographsphotograph, photographs"E''photo, photosphoto, photos*D//picture, picturespicture, pictures0C55category, categoriescategory, categories$B))class, classesclass, classesAhat, hatshat, hatsd@iiforget, forgets, forgetting, forgot, forgottenforget, forgets, forgetting, forgot, forgotten DX }D1Ddaiijot down, jots down, jotting down, jotted downjot down, jots down, jotting down, jotted down<`AAjot, jots, jotting, jottedjot, jots, jotting, jottedD_IIshop, shops, shopping, shoppedshop, shops, shopping, shopped\^aapurchase, purchases, purchasing, purchasedpurchase, purchases, purchasing, purchased:]??buy, buys, buying, boughtbuy, buys, buying, bought\homeworkhomework$[))story, storiesstory, stories2Z77professor, professorsprofessor, professors6Y;;instructor, instructorsinstructor, instructors*X//teacher, teachersteacher, teachers`Weeinstruct, instructs, instructing, instructedinstruct, instructs, instructing, instructedHVMMteach, teaches, teaching, taughtteach, teaches, teaching, taught&U++figure, figuresfigure, figures"T''value, valuesvalue, values&S++number, numbersnumber, numbers.R33computer, computerscomputer, computers 3t!~ayh[B3 u1616tsixteensixteen s66rsixsix qWw p1616osixteensixteen nIi mmemelwaterwaterk!!offoff`jeeturn off, turns off, turning off, turned offturn off, turns off, turning off, turned offiononXh]]turn on, turns on, turning on, turned onturn on, turns on, turning on, turned on+ A,iPcampingcamping##camp, campscamp, campsLa Jollala jollaoh okoh ok$))ah makes senseah makes sense##oh I get itoh i get itoh I seeoh i see ohohstillstill@EEplay, plays, playing, playedplay, plays, playing, played asaslikelike alikealike similarsimilar identicalidentical same assame as ##the same asthe same assamesamethe samethe same Yy&++yellow, yellowsyellow, yellows1st1stfirstfirst %%unexpectedlyunexpectedlyamissamissmistakenmistakenincorrectincorrect~wrongwrong,}11immediatelyimmediately|nownow{Oaklandoakland.z33audience, audiencesaudience, audiencesyjuicejuice xJj wIi vMm %kte@WD3mRC6#k >%%nine dollarsnine dollars=frenchfrench<Frenchfrench;Francefrance:Fremontfremont 919198nineteennineteen 7996ninenine 5Ff 419193nineteennineteen.233computer, computerscomputer, computers 125250##twenty-fivetwenty-five/preferredpreferred..33favorite, favoritesfavorite, favorites-unwellunwell,illill+sicksick.*33soda pop, soda popssoda pop, soda pops)##soda, sodassoda, sodas (1818'eighteeneighteen &88%eighteight $1818#eighteeneighteen"##lamp, lampslamp, lamps"!''light, lightslight, lights 1717seventeenseventeen 77sevenseven 1717seventeenseventeen##tent, tentstent, tents [\7],{ZK,j[ [2121Z!!twenty-onetwenty-one Y2929X##twenty-ninetwenty-nine W2828 V%%twenty-eighttwenty-eight U2727 T%%twenty-seventwenty-seven S2626R!!twenty-sixtwenty-six Q2525P##twenty-fivetwenty-five O2424N##twenty-fourtwenty-four M2323 L%%twenty-threetwenty-three&K++letter, lettersletter, lettersJtwenty-twenty- ILl.H33language, languageslanguage, languages.G33sentence, sentencessentence, sentencesFtea, teastea, teasE##hair, hairshair, hairshDmmvolunteer, volunteers, volunteering, volunteeredvolunteer, volunteers, volunteering, volunteered"C''shirt, shirtsshirt, shirts.B33language, languageslanguage, languagesDAIIsew, sews, sewing, sewed, sewnsew, sews, sewing, sewed, sewn @$9$9?9 dollars9 dollars }L/ B.&n++camera, camerascamera, camerasm!!eyeglasseseyeglasseslglassesglassesTkYYwrite, writes, writing, wrote, writtenwrite, writes, writing, wrote, written0j55fish, fishes, fishedfish, fishes, fished*i//fishing, fishingsfishing, fishingsh!!little bitlittle bitga littlea little f%%a little bita little bit:e??draw, drawsdraw, draws4d99tie, ties, tying, tiedtie, ties, tying, tied*c//pronoun, pronounspronoun, pronouns&b++jogging, joggedjogging, jogged a%%running, ranrunning, ran`jog, jogsjog, jogs._33marathon, marathonsmarathon, marathons^run, runsrun, runs]betweenbetweenJ\OOwatch, watches, watching, watchedwatch, watches, watching, watched GXKcB!yjO@%G< AAlive, lives, living, livedlive, lives, living, lived ##coat, coatscoat, coats&++jacket, jacketsjacket, jackets 1010tentenjustjustonlyonly 1919nineteennineteen 1818eighteeneighteen 1717~seventeenseventeen }1616|sixteensixteen`{eeremember, remembers, remembering, rememberedremember, remembers, remembering, rememberedz##game, gamesgame, gamesy##mail, mailsmail, mails&x++letter, lettersletter, letterswGallaudetgallaudet v2020utwentytwentytglassesglasses sQq"r''green, greensgreen, greens.q33mustache, mustachesmustache, mustaches pGg$o''take pictures, takes pictures, taking pictures, took pictures, taken picturestake pictures, takes pictures, taking pictures, took pictures, taken pictures Zr1zgZ=(iXE*ZJ$OOcrush, crushes, crushing, crushedcrush, crushes, crushing, crushedT#YYcrumple, crumples, crumpling, crumpledcrumple, crumples, crumpling, crumpled"most ofmost of!mostmost togethertogetherwithwithallall499American Sign Languageamerican sign languageASLasl&++statue, statuesstatue, statues&++figure, figuresfigure, figures"''shape, shapesshape, shapeswherewhereace, acesace, aces Aawhatwhathowhowwhomwhomwhowhoenoughenoughhmmpull down, pulls down, pulling down, pulled downpull down, pulls down, pulling down, pulled down>CCput on, puts on, putting onput on, puts on, putting on6;;sweatshirt, sweatshirtssweatshirt, sweatshirts* //sweater, sweaterssweater, sweaters alivealive lifelife q}D#kjM>q 8SFsf7Santa Fesanta fe"6''San Franciscosan francisco65;; San Diegan, San Dieganssan diegan, san diegansB4GG South Dakotan, South Dakotanssouth dakotan, south dakotans 3 SDsd2 San Diegosan diego 1%% South Dakotasouth dakota 0 SsB/GG toss, tosses, tossing, tossedtoss, tosses, tossing, tossed.  throw away, throws away, throwing away, threw away, thrown awaythrow away, throws away, throwing away, threw away, thrown awayR-WW throw, thows, throwing, threw, thrownthrow, thows, throwing, threw, thrown, forfor&+++ orange, orangesorange, oranges&*++coffee, coffeescoffee, coffees)##tail, tailstail, tails6(;;television, televisionstelevision, televisions'TV, TVstv, tvs &TtZ%__scrunch, scrunches, scrunching, scrunchedscrunch, scrunches, scrunching, scrunched 3>?_D#aF3MshoeshoeLfootwearfootwear K%%tennis shoestennis shoesJsneakerssneakers"I''pair of shoespair of shoesHshoesshoes G%%dairydairy$F))lactoselactoseE##milk, milksmilk, milksDhow manyhow manyC##year, yearsyear, yearsFBKKoperating room, operating roomsoperating room, operating rooms Aorord@iidrop off, drops off, dropping off, dropped offdrop off, drops off, dropping off, dropped offR?WWthrow, thows, throwing, threw, thrownthrow, thows, throwing, threw, thrown<>AAsend, sends, sending, sentsend, sends, sending, sent=##yes, yessesyes, yesses<gym, gymsgym, gyms*;//workout, workoutsworkout, workouts\:aaexercise, exercises, exercising, exercisedexercise, exercises, exercising, exercised`9eework out, works out, working out, worked outwork out, works out, working out, worked out Fj'S2 T#aFcnorthernnorthern"b''north, northsnorth, northsa##mall, mallsmall, malls`##park, parkspark, parks._33mountain, mountainsmountain, mountains^hillshills]hillshills.\33around therearound there,[11thereaboutsthereabouts*Z//thereaboutthereaboutY##around herearound hereX!!hereaboutshereaboutsWhereabouthereabout"V''space, spacesspace, spacesU##area, areasarea, areasRTWWemployment, employmentsemployment, employmentsSjob, jobsjob, jobs6R;;occupation, occupationsoccupation, occupations&Q++employedemployed@PEEwork, works, working, workedwork, works, working, workedstuffstuff:??4item, itemsitem, itemsBGG4object, objectsobject, objects"''4thing, thingsthing, things4993dormitory, dormitoriesdormitory, dormitories ##3dorm, dormsdorm, dorms 2aptapt2 772apartment, apartmentsapartment, apartments" ''1house, houseshouse, housesP UU0put there, puts there, putting thereput there, puts there, putting there,110put, puts, puttingput, puts, putting/pen, penspen, pens&++/pencil, pencilspencil, pencilsTYY/write, writes, writing, wrote, writtenwrite, writes, writing, wrote, written"''.sugar, sugarssugar, sugars.sweetssweets$)).candy, candiescandy, candies.cutecute6;;-smartphone, smartphonessmartphone, smartphones>CC-mobile phone, mobile phonesmobile phone, mobile phones {bG4k_B{*%//;(question marker)(question marker)$;reallyreally#;huhhuh2"77:bubblegum, bubblegumsbubblegum, bubblegums:!??:chewing gum, chewing gumschewing gum, chewing gums :gum, gumsgum, gumsLQQ9desire, desires, desiring, desireddesire, desires, desiring, desired@EE9want, wants, wanting, wantedwant, wants, wanting, wanted8smallsmallbgg7recognize, recognizes, recognizing, reconizedrecognize, recognizes, recognizing, reconizedLQQ7notice, notices, noticing, noticednotice, notices, noticing, noticed*//6average, averagesaverage, averages6mediocremediocre6mediummedium6moderatemoderate5justjust5recentlyrecentlyNSS4equipment, equipmentsequipment, equipmentsJOO4resource, resourcesresource, resources E4raL9(q\I4!nE&@++Ftoilet, toiletstoilet, toilets.?33Frestroom, restroomsrestroom, restrooms>##Fbath, bathsbath, baths.=33Fbathroom, bathroomsbathroom, bathrooms<Ewidewide;Dmore thanmore than:Doverover9Daboveabove8Cfeetfeet7Bwhichwhich$6))Afor forfor for5Awhywhy4Awhat forwhat for3@ageage2@oldold*1//?example, examplesexample, examples0>freshfresh/>newnew.=hugehuge-=largelarge,=bigbig+##<hare, hareshare, hares$*))<bunny, bunniesbunny, bunnies&)++<rabbit, rabbitsrabbit, rabbitsN(SS;have, has, hadhave, has, hadL'QQ;do, does, diddo, does, didz&;am, is, are, was, weream, is, are, was, were E^1bE lW@EHWMMQstart, starts, starting, startedstart, starts, starting, startedHVMMQenter, enters, entering, enteredenter, enters, entering, enteredU##PapproximateapproximateT##Pthereaboutsthereabouts S%%Paround therearound thereRParoundaroundQPaboutabout"P''Papproximatelyapproximately"O''Oplace, placesplace, places*N//Nlobbying, lobbiedlobbying, lobbied$M))Nlobby, lobbieslobby, lobbies8L==Mlaboratory, laboratorieslaboratory, laboratoriesKMlab, labslab, labsJLATM, ATMsatm, atms I%%KmechanicallymechanicallyH!!KmechanicalmechanicalGKmachinerymachineryPFUUKapparatus, apparatusesapparatus, apparatuses*E//Kmachine, machinesmachine, machines"D''Jstore, storesstore, stores,C11Ilibrary, librarieslibrary, libraries&B++Hoffice, officesoffice, offices"A''Gfront, frontsfront, fronts !YsF7sdK8gH+lYx[eacheachwZplaceplacevZareaarea uYgogotYturnturnsYgo rightgo rightr!!Yturn rightturn right qXgogopXturnturnoXgo leftgo leftnXturn leftturn leftm!!Wdownstairsdownstairs"l''Wgo downstairsgo downstairskVupstairsupstairs"j''Vwent upstairswent upstairsi##Vgo upstairsgo upstairshVstairsstairsgUcorridorcorridorfUhallwayhallwayeUhallhalldTagainstagainst cTonon(b--Ton the left sideon the left sidea##Ton the lefton the left\`aaSput against, puts against, putting againstput against, puts against, putting against_Sagainstagainst ^Sonon*]//Son the right sideon the right side \%%Son the righton the right[RoutoutZRleaveleaveYRexitexit.X33Qentrance, entrancesentrance, entrances "b[*nWF3 vaH1sbkcatcatjpeoplepeopleichildrenchildrenhain'tain'thwouldn'twouldn'thweren'tweren'thwasn'twasn'tharen'taren'thisn'tisn'thdidn'tdidn'thdoesn'tdoesn'thdon'tdon'thnotnot gdaughterdaughter fsonson ewifewife dhusbandhusband cmothermothercmommamommacmommombfatherfatherbpapapapabdaddadafamilyfamily!!`girlfriendgirlfriend_boyfriendboyfriend^companioncompanion^rommierommie~^roommateroommate.}33]elevator, elevatorselevator, elevators.|33\elevator, elevatorselevator, elevatorsJ{OO\go up, goes up, going up, went upgo up, goes up, going up, went up@zEE\lift, lifts, lifting, liftedlift, lifts, lifting, liftedy[everyevery %YnU<)nQ:P{jY?}herher>}himhim =}itit<}theythey;}sheshe :}hehe9|thatthat&8++{(smiling mouth)(smiling mouth)T7YYzmove to, moves to, moving to, moved tomove to, moves to, moving to, moved to<6AAzmove, moves, moving, movedmove, moves, moving, moved5yeveningevening4ynightnight3xanotheranother2xotherother1wsunrisesunrise0vsunrisesunrise/upet, petspet, pets.tanimalanimal-ssun, sunssun, suns,rharehare+rbunnybunny*rrabbitrabbit)qharehare(qbunnybunny'qrabbitrabbit&pratrat%pmousemouse$oturtleturtle#nfishfish"mTwittertwitter!mpoultrypoultry mchickenchickenmbirdbirdloccuroccurlhappenhappen %%kkittykittykfelinefeline &\iP5 w\7  mX?$q\eshoutshoutdscreamscreamcyellyell.b33audience, audiencesaudience, audiencesafromfrom`importantimportant_pointpoint^goalgoal]specificspecific\unknownunknown[dunnodunnoZ##didn't knowdidn't know Y%%doesn't knowdoesn't knowX!!don't knowdon't knowWknownknownVknewknewUknowsknowsTknowknowSalwaysalways"R''singlesingleQisolatedisolatedPisolateisolateOalonealoneNsomesomeMsomethingsomethingLsomeonesomeoneK~indoorindoorJ~internalinternalI~innerinnerH~interiorinteriorG~indoorsindoors&F++~inside, insidesinside, insides E}atatD}therethereC}thetheB}thisthisA}thatthat@}themthem [|kXE*u( r_Fn[zealzealeagernesseagerness6;;enthusiasm, enthusiasmsenthusiasm, enthusiasms6;;motivation, motivationsmotivation, motivationsFKKmotivate, motivates, motivatingmotivate, motivates, motivatingzealouszealous~keenkeen}eagereager |%%enthusiasticenthusiastic{motivatedmotivated z%%to beto bey##intointoxturn intoturn intoJwOObecome, becomes, becoming, becamebecome, becomes, becoming, becamevlowlylowlyu##unimportantunimportanttminorminors!!small-timesmall-timerdemotedemoteqsupremesupremepsuperiorsuperiorodominantdominantnverbverbmnounnounladvadvkadverbadverbjadjadjiadjectiveadjectivehmeowmeowgroarroarfcry outcry out $ThO8 `E*rY@/mT(trolleytrolley'homehome&rubyruby*%//boulder, bouldersboulder, boulders&$++pebble, pebblespebble, pebbles"#''stone, stonesstone, stones"##rock, rocksrock, rocks!redred outdooroutdooroutsideoutsideskyskyfirefirebleedingbleedingbledbledbleedsbleedsbleedbleedbloodblood"''acrossacrossoppositeoppositeadjacentadjacent*//on the right sideon the right side %%on the righton the right bybybesidebesidenext tonext tospectrumspectrumrangerange rainbowrainbow objectobject subjectsubject withinwithin involveinvolveincludeincludelitigatorlitigatorattorneyattorneylawyerlawyer QIVG&\G* rQA##girl, girlsgirl, girls@boy, boysboy, boys?cleanclean$>))the day beforethe day before=yesterdayyesterday"<''(tense mouth)(tense mouth);"at last""at last":"finally""finally"9"pah""pah"p8uu(neutrally closed mouth then neutrally opened mouth)(neutrally closed mouth then neutrally opened mouth)&7++(puffed cheeks)(puffed cheeks)6(headnod)(headnod)5yesyes4##(headshake)(headshake) 3nono&2++(rounded mouth)(rounded mouth)1"cha""cha"V0[[(bared teeth then neutrally open mouth)(bared teeth then neutrally open mouth)"/''(bared teeth)(bared teeth)4.99(neutrally open mouth)(neutrally open mouth)8-==(neutrally closed mouth)(neutrally closed mouth)&,++(eyebrows down)(eyebrows down)"+''(eyebrows up)(eyebrows up)*busbus)streetcarstreetcar !awF3>- rW>'xabpleasepleaseahurry uphurry up`rushrush_hurryhurry^bear withbear with]##put up withput up with\toleratetolerate[bearbearZendureendureYpatientpatientXpatiencepatienceWwellwellVgoodgoodUgoodgoodTthank youthank youSthanksthanksRfoodfoodQeatingeatingPateateOeatseatsNeateat\Maapractice, practices, practicing, practicedpractice, practices, practicing, practicedLmoneymoneyK##supposed tosupposed toJought toought toIneed toneed toHoughtoughtGshouldshouldFneedneed.E33friended, friendingfriended, friending&D++friend, friendsfriend, friendsC##sale, salessale, salesembarrassedembarrassedn##oopsoops*m//my mistakemy mistake&l++mistakenmistaken k%%wrongwrong"j''entertainmententertainmentiamusementamusement2h77enjoyment, enjoymentsenjoyment, enjoymentsgpleasurepleasurelfqqappreciate, appreciates, appreciating, appreciatedappreciate, appreciates, appreciating, appreciatedDeIIamuse, amuses, amusing, amusedamuse, amuses, amusing, amusedhdmmentertain, entertains, entertaining, entertainedentertain, entertains, entertaining, entertainedHcMMenjoy, enjoys, enjoying, enjoyedenjoy, enjoys, enjoying, enjoyed @2~cH) 8n[@all doneall donedonedone##havehave& ++and thenand then ##thenthen\ aacomplete, completes, completing, completedcomplete, completes, completing, completedR WWfinish, finishes, finishing, finishedfinish, finishes, finishing, finished sadsaddowndowndejecteddejected##demoralizeddemoralized!!dispiriteddispiriteddepresseddepressed!!one minuteone minute1 minute1 minutea minutea minutemomentmomentminuteminute~sometimessometimes}nevernever|comecome>{CCgo, goes, going, went, gonego, goes, going, went, gone\zaago to, goes to, going to, went to, gone togo to, goes to, going to, went to, gone toyrideride(x--(frowning mouth)(frowning mouth).w33railroad, railroadsrailroad, railroads P{0kXC,t1PL*QQstroke, strokes, stroking, strokedstroke, strokes, stroking, stroked<)AApet, pets, petting, pettedpet, pets, petting, pettedP(UUsummon, summons, summoning, summonedsummon, summons, summoning, summoned@'EEcall, calls, calling, calledcall, calls, calling, called&pick uppick up%discoverdiscover$findfind#lookinglooking"lookedlooked!lookslooks looklookseekingseekingseekedseekedseeksseeksseekseeksearchingsearchingsearchedsearchedsearchessearchessearchsearchX]]conceal, conceals, concealing, concealedconceal, conceals, concealing, concealedHMMhide, hides, hiding, hid, hiddenhide, hides, hiding, hid, hidden %%confidentialconfidentialprivateprivatesecretsecretalreadyalreadythroughthrough #W}hI6! zWB!xeP'jWMtwintwinLtwinstwinsKparentparentJparentsparentsIpapapapaHdaddadGfatherfatherFmommamommaEmommomDmothermother&C++office, officesoffice, officesBdeathdeathAdeaddead4@99die, dies, dying, dieddie, dies, dying, died?!!a week agoa week ago>next weeknext week=seesee"<''theirstheirs;##hershers:yoursyours 9%%theirtheir8!!itsits7!!herher6!!hishis5youryour4minemine 3mymy2step-step-1falsefalse0fakefake/!!carry overcarry over.carrycarry-deliverdeliver,bringbringR+WWcaress, caresses, caressing, caressedcaress, caresses, caressing, caressed ;uZpW>% D~cJ; dtotocthroughthroughbmarriagemarriageamarrymarry`a lota lot_manymany,^11(long thin object)(long thin object),]11(long thin entity)(long thin entity)(\--(upright person)(upright person):[??(upright vertical entity)(upright vertical entity)@ZEEpark, parks, parking, parkedpark, parks, parking, parked,Y11(vehicular object)(vehicular object)XEnglishenglishWEnglandenglandVenglishenglishUEnglishenglishTsiblingsiblingpSuubrother or sister, brothers or sistersbrother or sister, brothers or sisterstRyybrothers and sister, brother and sistersbrothers and sister, brother and sistersQsiblingssiblingsXP]]brother and sister, brothers and sistersbrother and sister, brothers and sistersObrotherbrotherNsistersister $ffM6# FgH'{fsleepsleeptrolleytrolleyallall##tent, tentstent, tentsdoordoorshutshutcloseclosedoordooropenopen##week, weeksweek, weeks~!!a week agoa week ago}last weeklast week|harehare{bunnybunnyzrabbitrabbityhareharexbunnybunnywrabbitrabbitvwhitewhite,u11victory, victoriesvictory, victories6t;;win, wins, winning, wonwin, wins, winning, wonshow manyhow manyr##a lot, lotsa lot, lotsqmanymanypGallaudetgallaudeto!!eyeglasseseyeglassesnglassesglassesmlikelikelwithinwithinkinvolveinvolvejincludeincludeibothbothhacademicacademicgacademyacademyfschoolschool e%%dash, dashesdash, dashes $Xy^A.x]>d?$mX,pepsipepsi+Pepsipepsi*Gallaudetgallaudet)Gallaudetgallaudet(glassesglasses'glassesglasses&cameracamera%!!lights offlights off$turn offturn off"#''turn on lightturn on light"lights onlights on!teachingteaching taughttaughtteachesteachesteachteach!!professorsprofessorsprofessorprofessor##instructorsinstructors!!instructorinstructorteachersteachersteacherteacherlookinglookinglookedlookedlookslookslooklookseekingseekingseekedseekedseeksseeksseekseeksearchingsearchingsearchedsearched searchessearches searchsearch" ''pay attentionpay attention focus onfocus on frontfront )ssNA, j[<- sN?s U9999 TFFff S%%fast forwardfast forwardRfriesfries Q%%french friesfrench friesPfryfryO!!french fryfrench fry N%%eighty-eighteighty-eight M8888"L''seventy-sevenseventy-seven K7777Jsixty-sixsixty-six I6666H!!fifty-fivefifty-five G5555F!!forty-fourforty-four E4444 D%%thirty-threethirty-three C3333B!!twenty-twotwenty-two A2222@!!thirty-twothirty-two ?3232>!!thirty-onethirty-one =3131< thirtythirty ; 3030: fivefive 9 558 fourfour 7 446 threethree 5 33"4'' singlesingle3 oneone 2 111ageage0oldold(/--years oldyears old.ageage-oldold %qpQB%xUF%yjK< qz'HHhh&y++'hard of hearinghard of hearingx##&thirty-ninethirty-nine w&3939 v%%%thirty-eightthirty-eight u%3838 t%%$thirty-seventhirty-seven s$3737r!!#thirty-sixthirty-six q#3636p##"thirty-fivethirty-five o"3535n##!thirty-fourthirty-four m!3434 l 1212k twelvetwelvejeleveneleven i1111h##ninety-nineninety-nine g9999 f%%fast forwardfast forwardefriesfries d%%french friesfrench fries cFFff b%%eighty-eighteighty-eight a8888"`''seventy-sevenseventy-seven _7777^sixty-sixsixty-six ]6666\!!fifty-fivefifty-five [5555Z!!forty-fourforty-four Y4444 X%%thirty-threethirty-three W3333V##ninety-nineninety-nine [gD%M({`A( p[1offeroffer##1propositionproposition1proposalproposal1proposepropose$))1recommendationrecommendation1recommendrecommend!!1suggestionsuggestion1suggestsuggest!!0one minuteone minute01 minute1 minute 0a minutea minute 0momentmoment 0minuteminute /harehare /bunnybunny/rabbitrabbit"''.horse, horseshorse, horses"''-horse, horseshorse, horses055,identity, identitiesidentity, identities*//+chapter, chapterschapter, chapters055*read, reads, readingread, reads, reading )gogo)advanceadvance)get alongget along!!)move alongmove along ~%%)move forwardmove forward})proceedproceed|)go aheadgo aheadb{gg(identify, identifies, identifying, identifiedidentify, identifies, identifying, identified 'YR- whG8 ~_P;,vY>Afifty-sixfifty-six =A5656<!!@fifty-fourfifty-four ;@5454:##?fifty-threefifty-three 9?53538>fifty-twofifty-two 7>52526=fifty-onefifty-one 5=51514<fiftyfifty 3<50502!!;forty-nineforty-nine 1;49490##:forty-eightforty-eight /:4848.##9forty-sevenforty-seven -94747,8forty-sixforty-six +84646*!!7forty-fiveforty-five )74545(##6forty-threeforty-three '64343&5forty-twoforty-two %54242$4forty-oneforty-one #44141"3fortyforty !34040 2vaccinevaccine##2vaccinationvaccination"''2medicine shotmedicine shot,112medicine injectionmedicine injection2shotshot2injectioninjection2vaccinatevaccinate2injectinject1offeringoffering (^rcN?"{lO@m\E*o^fW-th-theWtownhometownhomedWtownhousetownhousecVWednesdaywednesdaybUTuesdaytuesdayaTMondaymonday`Slanguagelanguage_Ssentencesentence^Rlanguagelanguage]Qfamilyfamily\Poutout[PleaveleaveZPexitexitYOclassclassXNSundaysundayW!!Msixty-ninesixty-nine VM6969U##Lsixty-eightsixty-eight TL6868S##Ksixty-sevensixty-seven RK6767QJsixt-fivesixt-five PJ6565O!!Isixty-foursixty-four NI6464M##Hsixty-threesixty-three LH6363KGWVwvJGsixty-twosixty-two IG6262HFsixty-onesixty-one GF6161FEsixtysixty EE6060D!!Dfifty-ninefifty-nine CD5959B##Cfifty-eightfifty-eight AC5858@##Bfifty-sevenfifty-seven ?B5757 &V~]N)aR/tG4|iV jwhenwhen inextnext isomedaysomeday ifuturefuturehnextnexthsomedaysomedayhfuturefutureglastlastgpreviouspreviousgbeforebeforegpastpast*//fthe following daythe following day %%fthe next daythe next dayftomorrowtomorrow~etodaytoday}dSaturdaysaturday|cFridayfriday{bThursdaythursdayzaThursdaythursday y%%`seventy-nineseventy-nine x`7979"w''_seventy-eightseventy-eight v_7878u##^seventy-sixseventy-six t^7676 s%%]seventy-fiveseventy-five r]7575 q%%\seventy-fourseventy-four p\7474"o''[seventy-threeseventy-three n[7373m##Zseventy-twoseventy-two lZ7272k##Yseventy-oneseventy-one jY7171iXseventyseventy hX7070gWThursdaythursday %utaN9&~gRA(fM<#u1102102"0''a hundred onea hundred one&/++one hundred oneone hundred one.101101-~a hundreda hundred,##~one hundredone hundred+~hundredhundred*~100100)}launderlaunder(}laundrylaundry '%%}machine washmachine wash&}washingwashing%}washwash$|swimmingswimming#|swimsswims"|swimswim!{closetcloset zkitchenkitchenybedbedxfancyfancyxformalformalwgaragegaragevdeskdeskudeckdecktcellarcellartbasementbasementspoolpoolrrugrugqatticatticproofroofoporchporchnyardyardmgategatelfencefence*//kpartner, partnerspartner, partners&++kcouple, couplescouple, couples ##kpair, pairspair, pairs GtK:tK&XGlG"N''a hundred onea hundred one&M++one hundred oneone hundred oneL101101Ka hundreda hundredJ##one hundredone hundredI100100$H))a hundred ninea hundred nine(G--one hundred nineone hundred nineF109109&E++a hundred eighta hundred eight*D//one hundred eightone hundred eightC108108&B++a hundred sevena hundred seven*A//one hundred sevenone hundred seven@107107"?''a hundred sixa hundred six&>++one hundred sixone hundred six=106106$<))a hundred fivea hundred five(;--one hundred fiveone hundred five:105105$9))a hundred foura hundred four(8--one hundred fourone hundred four7104104&6++a hundred threea hundred three*5//one hundred threeone hundred three4103103"3''a hundred twoa hundred two&2++one hundred twoone hundred two Lc:)tc:pG6 Lgardengarden"''plant, plantsplant, plantsquiltquiltblanketblanketbedbedactuallyactually reallyreally actualactual realreal it'sit's it isit is d}\G&m@uX;,d@referencereference?refereereferee>fridgefridge =%%refrigeratorrefrigerator<ovenoven;orangeorange:orangeorange9orangeorange 8nono7microwavemicrowave6microwavemicrowave5microwavemicrowave4greengreen3DWdw2!!dishwasherdishwasher1cupboardcupboard0cabinetcabinet&/++winter, winterswinter, winters*.//freezer, freezersfreezer, freezers-coldcold,##ceiling fanceiling fan+##ceiling fanceiling fan"*''brown, brownsbrown, browns)blueblue(bathtubbathtub'bathbath&##take a bathtake a bath%bathebathe$##oven, ovensoven, ovens#softsoft"moistmoistX!]]moisten, moistens, moistening, moistenedmoisten, moistens, moistening, moistened #e{fOmZ7  lW6ec##whole monthwhole monthball monthall monthaall weekall week`all dayall day_all-nightall-night^all nightall night"]''all afternoonall afternoon\##all morningall morning[toweltowelZtoweltowelYshowershowerXshowershowerWshowershowerVshowershowerUdetergentdetergentTsoapsoapSwipewipeRtissuetissue Q%%handkerchiefhandkerchiefPcoldcoldOplatterplatterNdishdishMplateplateL"DVD""dvd"K"CD""cd"J"disc""disc"I"disk""disk"HHMM(horizontal flat-rounded object)(horizontal flat-rounded object)GyellowyellowFwhitewhite"E''white, whiteswhite, whitesDstovestoveCsinksinkBpurplepurpleA##pink, pinkspink, pinks "NS8dQ<#u\G( zcNvomitvomitnauseanausea"''upset stomachupset stomach##indigestionindigestiondisgustdisgustgrossgrossnauseousnauseous~!!disgustingdisgusting}!!disgustingdisgusting|grossgross{seizureseizurezrestlessrestlessyseizuringseizuring"x''toss and turntoss and turnw##roll aroundroll aroundvswellingswellinguswellswelltswollenswollensitchyitchyritchitchq##scratch armscratch armpscratchscratcho##sore throatsore throatncoughscoughsmcoughingcoughinglcoughcoughkcrampscrampsjheadacheheadacheiheadacheheadache,h11can not, could notcan not, could notgcannotcannot&f++can't, couldn'tcan't, couldn'teall hourall hour d%%entire monthentire month PnS.f-Z-zcP"CD""cd""disc""disc""disk""disk"BGG(upright flat-rounded object)(upright flat-rounded object),11(spherical object)(spherical object)lousylousyfeelfeel*//feeling, feelingsfeeling, feelings<AAfeel, feels, feeling, feltfeel, feels, feeling, feltsoresorerashrash>CCabdomen area, abdomen areasabdomen area, abdomen areas*//abdomen, abdomensabdomen, abdomens6;;belly area, belly areasbelly area, belly areas$))belly, belliesbelly, bellies>CCstomach area, stomach areasstomach area, stomach areas*//stomach, stomachsstomach, stomachs055suffer from diarrheasuffer from diarrhea" ''have diarrheahave diarrhea the runsthe runs diarrheadiarrhea ##lightheadedlightheaded dizzydizzypukepukebarfbarfthrow upthrow up "VmF-x[H9mX=iVArentrent@monthlymonthly?##every monthevery month>a montha month=1 month1 month<one monthone month;monthmonth:weeklyweekly9!!every weekevery week8everydayeveryday7dailydaily6every dayevery day 5pmpm4p.m.p.m.3nightnight2eveningevening1nightlynightly"0''every eveningevery evening/##every nightevery night .pmpm-p.m.p.m.,afternoonafternoon&+++every afternoonevery afternoon *amam)a.m.a.m.(morningmorning"'''every morningevery morning&"cube""cube"%"box""box"$"block""block"$#))(cubic object)(cubic object)P"UU(front-oriented elongated 3D object)(front-oriented elongated 3d object)(!--(conical object)(conical object) "DVD""dvd" %Wu\G,qH7&v[F/nWfsettlesettleesoothesoothedcalm downcalm downccalmcalm*b//bankruptcybankruptcyabankruptbankrupt`pennylesspennyless_brokebroke^brokenbroken]brokebroke\breakingbreaking[breaksbreaksZbreakbreakYfallfallXautumnautumnWbickerbickerVfightfightUquarrelquarrelTargueargueS7up7upR7UP7up&Q++not a good ideanot a good ideaP##don't do itdon't do it OnonoNnahnah M%%please don'tplease don'tL!!flip-flopsflip-flopsK!!flip flopsflip flopsJsandalssandalsIslip onsslip onsHflatsflatsGloafersloafersFslip-onsslip-onsEslippersslippersD!!high heelshigh heelsChourlyhourlyB!!every hourevery hour Dr]>%xcP5"QD>CC go, goes, went, going, gonego, goes, went, going, gone`ee head out, heads out, headed out, heading outhead out, heads out, headed out, heading outfkk go out, goes out, went out, going out, gone outgo out, goes out, went out, going out, gone out@EE leave, leaves, left, leavingleave, leaves, left, leaving>~CC go, goes, went, going, gonego, goes, went, going, gone} outdooroutdoor| outsideoutside{kissfistkissfistzloveloveypleasantpleasantxgladgladwhappyhappyvcolacolaucokecoketCokecokesCoca Colacoca colarCoca-Colacoca-colaqDPdppDr Pepperdr pepperodislikedisliken!!don't likedon't likemfloodfloodlriserisekrise uprise upjfillfillifill upfill uphdraindraing##settle downsettle down ZT|cL\K2 oZweedsweedsweedweedregretregretapologizeapologizeapologyapologysorrysorry&++how comehow come"''due todue tobecausebecausewhywhy&++how comehow come"''due todue tobecausebecausewhywhy.33building, buildingsbuilding, buildingsD IIbuild, builds, building, builtbuild, builds, building, built barkedbarked barkingbarking  avoidavoid  laglag behind inbehind in## fall behindfall behind fixfix`ee head out, heads out, headed out, heading outhead out, heads out, headed out, heading outfkk go out, goes out, went out, going out, gone outgo out, goes out, went out, going out, gone out@EE leave, leaves, left, leavingleave, leaves, left, leaving !eN3 hM8_F# =!!soft drinksoft drink<poppop;soda popsoda pop:sodasoda9latelate8preponeprepone 7%%hold earlierhold earlier6advanceadvance"5''bring forwardbring forward,411reschedule earlierreschedule earlier3push uppush up2move upmove up1deferdefer"0''procrastinateprocrastinate/put offput off.delaydelay-postponepostpone,paintingpainting+paintpaint*lyinglying)lielie(RBrb'root beerroot beer&grabgrab%taketake$fruitfruit#complaincomplain"pleaseplease!would youwould you can youcan you##do you minddo you mind"''wouldn't mindwouldn't mind!!don't minddon't mind WbG4v]D/\WPOUU%listen, listens, listening, listenedlisten, listens, listening, listenedbNgg%focus on, focuses on, focusing on, focused onfocus on, focuses on, focusing on, focused onJMOO%focus, focuses, focusing, focusedfocus, focuses, focusing, focusedL %pay attention, pays attention, paying attention, paid attentionpay attention, pays attention, paying attention, paid attentionK$pupilpupilJ$learnerlearnerI$studentstudentH#pupilpupilG#learnerlearnerF#studentstudentE"firstlyfirstlyD"firstfirstJCOO!go up, goes up, going up, went upgo up, goes up, going up, went up@BEE!lift, lifts, lifting, liftedlift, lifts, lifting, liftedA cutecute@favoritefavoriteD?IItaste, tastes, tasting, tastedtaste, tastes, tasting, tastedT>YYprefer, prefers, preferring, preferredprefer, prefers, preferring, preferred %]|Y:% bM4xcP;*t]t2botherbothers1borrowborrowr0stinksstinksq0stinkstinkp0reeksreekso0reekreekn0body odorbody odorm/bittenbittenl/bitingbitingk/bitbitj/bitesbitesi/bitebiteh.southsouthg-turtleturtlef##,girl, girlsgirl, girls e+pmpmd+p.m.p.m.c+eveningeveningb+nightnighta*boy, boysboy, boys`)taughttaught_)teachesteaches^)teachteach]##(instructinginstructing\!!(instructedinstructed[(instructsinstructsZ(instructinstructY(teachingteachingX(taughttaughtW(teachesteachesV(teachteachU!!'smartphonesmartphone T%%'mobile phonemobile phoneS'telephonetelephoneR'phonephoneQ&attentionattention2P77%attention, attentionsattention, attentions $`h;~cL1mVC.}`AexhaustedexhaustedAwiped outwiped out!!@jump on mejump on me?hamburgerhamburger?burgerburger>grassgrass=rumorrumor=gossipgossip<fruitfruit;pullpull;removeremove ;taketake ;pickpick %%:placeplace :put upput up :board upboard up9battlebattle9fistfightfistfight9fightfight9fightingfighting8eatingeating8feast onfeast on8feastfeast7dropdrop6crycry5commutecommute"~''5be in and outbe in and out}!!5go betweengo between$|))5back and forthback and forth*{//5go back and forthgo back and forthz4cut upcut upy4chop upchop upx4chopchopw##3approach meapproach mev!!3come to mecome to meu2annoyannoy !KakZC*ubO0}bK9Nrepairrepair8Msnoopingsnooping7Msnoopsnoop6Mpryingprying5Mprypry4Mnosynosy3##Lnail bitingnail biting 2%%Lbiting nailsbiting nails1!!Lchew nailschew nails0!!Lbite nailsbite nails/Klicklick.Jlicklick -%%Iorange juiceorange juice,!!Hmake noisemake noise+Hnoisynoisy*Hsoundsound)Hnoisenoise(!!Glawn mowerlawn mower'Gmowermower&Gpushingpushing%Gmowingmowing$Gmowmow#Fsandwichsandwich"##Emischievousmischievous!Dlostlost DloseloseCabandonabandonx}}Cleave behind, leaves behind, left behind, leaving behindleave behind, leaves behind, left behind, leaving behind@EECleave, leaves, left, leavingleave, leaves, left, leavingBleavesleavesBleafleafAlaid outlaid outApoopedpooped !Uv[B)o(YH%fUZXuseuseY!!Wsteal fromsteal fromXWstealstealWVstolestoleVVstealstealU!!Uunderstandunderstand"T''Tjust rememberjust rememberSTjust knowjust know R%%Tkeep in mindkeep in mindQTbutbut&P++Tunderstand thatunderstand that2O77Ton the condition thaton the condition that"N''Tcomprehensioncomprehension$M))Tunderstandableunderstandable"L''TunderstandingunderstandingDKIISsmoke, smokes, smoking, smokedsmoke, smokes, smoking, smokedJRhorrorhorrorIRfearfearHRscaryscaryGRafraidafraidFRterrifiedterrifiedE!!RfrightenedfrightenedDRscaredscaredCQaskaskBQrequestrequestAPremodelremodel@Prenovaterenovate?Orakingraking>Orakerake=##Nmaintenancemaintenance<Nmaintainmaintain;Nmendmend:Nfixfix "ZnE0rS:!}`E( wZ|doversleepoversleep{cprodigalprodigal*z//cspending money onspending money on(y--cwasting money onwasting money onx##csquanderingsquanderingwcsplurgingsplurgingvbsterilizesterilizeubsanitizesanitizetbovercleanovercleansbtidytidyrbneatneat q%%atook from metook from me p%%atake from metake from meo!!agrabbed megrabbed menagrab megrab mematook metook melatake metake mek!!`temptationtemptationj`temptingtemptingi`tempttempth_telltellg_tattletattlef_snitchsnitche^all yearall yeard!!^year roundyear roundc^tiretireb^cyclecycle&a++]winter, winterswinter, winters`\summersummer_[exhaustedexhausted^[wear outwear out][worn outworn out\Zworryworry[Ywoodwood "PfnY>+z_F/kPmscrapingscrapingmscrapescrapelpull outpull outlpull uppull uplpick uppick upksheddingsheddingkshedsshedskshedshedjtake downtake downjremoveremoveiscatterscatteridispersedisperseispreadspreadispillspillhshearingshearinghshearshear##hcutting topcutting top hcut topcut top htrimmingtrimming htrimtrim gshearingshearing gshearshear %%gcutting sidecutting sidegcut sidecut sidegpruningpruninggpruneprunegtrimmingtrimminggtrimtrimfsnowsnowHMMeplant, plants, planting, plantedplant, plants, planting, plantedDIIesow, sows, sowing, sowed, sownsow, sows, sowing, sowed, sowndslept inslept in~dsleep insleep in}doversleptoverslept Hy`E& zaB) `G"oH$>)){five weeks agofive weeks ago=##z4 weeks ago4 weeks ago$<))zfour weeks agofour weeks ago;##y3 weeks ago3 weeks ago&:++ythree weeks agothree weeks ago9##x2 weeks ago2 weeks ago"8''xtwo weeks agotwo weeks ago7w9 weeks9 weeks6!!wnine weeksnine weeks5v8 weeks8 weeks4##veight weekseight weeks3u7 weeks7 weeks2##useven weeksseven weeks1t6 weeks6 weeks0tsix weekssix weeks/s5 weeks5 weeks.!!sfive weeksfive weeks-r4 weeks4 weeks,!!rfour weeksfour weeks+q3 weeks3 weeks*##qthree weeksthree weeks)p2 weeks2 weeks(ptwo weekstwo weeks'oplasteredplastered&!!oplasteringplastering%oplastersplasters$oplasterplaster#ndigdig"nshovelingshoveling!nshovelshovel %%mscraping offscraping off!!mscrape offscrape off "^pO&gR=*sL7^&`++veggie, veggiesveggie, veggies2_77vegetable, vegetablesvegetable, vegetables^Decemberdecember]Decdec\Novembernovember[Novnov Z%%camera flashcamera flashYflashflash$X))take a picturetake a pictureWOctoberoctoberVOctoctUmaymayTMaymaySSeptemberseptemberRSeptseptQAugustaugustPAugaugOJulyjulyNJunejuneMAprilaprilLMarchmarchKFebruaryfebruaryJFebfebIJanuaryjanuaryHJanjanG##9 weeks ago9 weeks ago$F))nine weeks agonine weeks agoE##~8 weeks ago8 weeks ago&D++~eight weeks egoeight weeks egoC##}7 weeks ago7 weeks ago&B++}seven weeks agoseven weeks agoA##|6 weeks ago6 weeks ago"@''|six weeks agosix weeks ago?##{5 weeks ago5 weeks ago GsFv_L5$ruVG v8383u!!eighty-twoeighty-two t8282s!!eighty-oneeighty-one r8181qeightyeighty p8080$o))take a picturetake a picturepnuuphotograph, photographs, photographing, photographedphotograph, photographs, photographing, photographed.m11take a picture, takes a picture, taking a picture, took a picture, taken a picturetake a picture, takes a picture, taking a picture, took a picture, taken a pictureltantankdesiredesirejwantwantidesiredesirehwantwant*g//weekend, weekendsweekend, weekends:f??consequence, consequencesconsequence, consequencesPeUUresult, results, resulting, resultedresult, results, resulting, resulted*d//weekend, weekendsweekend, weekendscend, endsend, ends*b//fashion, fashionsfashion, fashions@aEEveg, vegges, vegging, veggedveg, vegges, vegging, vegged %_}nO@mX=&rcB3_##2 years ago2 years ago %%ninety-eightninety-eight 9898 %%ninety-sevenninety-seven 9797!!ninety-sixninety-six 9696##ninety-fiveninety-five 9595##ninety-fourninety-four 9494 %%ninety-threeninety-three 9393!!ninety-twoninety-two 9292 !!ninety-oneninety-one 9191 ninetyninety 9090beforebeforepreviouspreviousafterafterafterwardafterward!!afterwardsafterwards %%from then onfrom then on##from now onfrom now on##eighty-nineeighty-nine 8989 %%eighty-seveneighty-seven ~8787}!!eighty sixeighty six |8686{##eighty-fiveeighty-five z8585y##eighty-foureighty-four x8484 w%%eighty-threeeighty-three `pI(uT+ xQ0 `5!!in 3 weeksin 3 weeks 4%%in two weeksin two weeks3!!in 2 weeksin 2 weeks$2))five years agofive years ago1##5 years ago5 years ago$0))five years agofive years ago/##5 years ago5 years ago$.))four years agofour years ago-##4 years ago4 years ago$,))four years agofour years ago+##4 years ago4 years ago&*++three years agothree years ago)##3 years ago3 years ago&(++three years agothree years ago'##3 years ago3 years ago"&''two years agotwo years ago%##2 years ago2 years ago"$''two years agotwo years ago###2 years ago2 years ago$"))five years agofive years ago!##5 years ago5 years ago$ ))four years agofour years ago##4 years ago4 years ago&++three years agothree years ago##3 years ago3 years ago"''two years agotwo years ago ]vQ2d?"dE"]DPIIstop, stops, stopping, stoppedstop, stops, stopping, stopped O%%one year agoone year agoN!!1 year ago1 year agoM!!a year agoa year agoLlast yearlast year K%%one year agoone year agoJ!!1 year ago1 year agoI!!a year agoa year agoHlast yearlast yearG##last year'slast year's F%%one year agoone year agoE!!1 year ago1 year agoD!!a year agoa year agoClast yearlast year"B''in nine weeksin nine weeksA!!in 9 weeksin 9 weeks$@))in eight weeksin eight weeks?!!in 8 weeksin 8 weeks$>))in seven weeksin seven weeks=!!in 7 weeksin 7 weeks <%%in six weeksin six weeks;!!in 6 weeksin 6 weeks":''in five weeksin five weeks9!!in 5 weeksin 5 weeks"8''in four weeksin four weeks7!!in 4 weeksin 4 weeks$6))in three weeksin three weeks TvnY,YF%oThcircularcircular&g++circle, circlescircle, circles*f//culture, culturesculture, culturesebreakfastbreakfastdlunchlunchcsuppersupperbdinnerdinnera##bell pepperbell pepper`beefbeef<_AA(B name sign on chin side)(b name sign on chin side)^lunchlunch]dinnerdinner\a whilea while[laterlater Z%%after awhileafter awhileYawhileawhile*X//dessert, dessertsdessert, dessertsWafterafterVoveroverUacrossacrosstTyydiscontinue, discontinues, discontinuing, discontinueddiscontinue, discontinues, discontinuing, discontinueddSiiterminate, terminates, terminating, terminatedterminate, terminates, terminating, terminatedDRIIcease, ceases, ceasing, ceasedcease, ceases, ceasing, ceased@QEEhalt, halts, halting, haltedhalt, halts, halting, halted NO<+rI$ta4wN&++below the limitbelow the limit&++under the limitunder the limit~underunder}less thanless than:|??heart shape, heart-shapedheart shape, heart-shaped"{''heart, heartsheart, hearts*z//grammar, grammarsgrammar, grammarsyricerice*x//what will they dowhat will they do(w--what did they dowhat did they do.v33what are they doingwhat are they doing$u))what will I dowhat will i do"t''what did I dowhat did i do&s++what am I doingwhat am i doing(r--what will you dowhat will you do&q++what did you dowhat did you do,p11what are you doingwhat are you doing o%%do dodo doneggseggsmeggeggldarkdark-est-est!!-er-er##moremoreworstworstworseworsebggmultiply, multiplies, multiplying, multipliedmultiply, multiplies, multiplying, multipliedtimestimes##unfortunateunfortunatesorrowsorrow unhappyunhappy sadsad porkpork vocabvocab8 ==vocabulary, vocabulariesvocabulary, vocabulariesvocabvocab8==vocabulary, vocabulariesvocabulary, vocabularies##word, wordsword, words##sock, sockssock, socks&++square, squaressquare, squareslemonadelemonadelemonlemonlaterlater e`I8'vY8nK&e*=//three years laterthree years later"<''3 years later3 years later$;))in three yearsin three years:!!in 3 yearsin 3 years&9++two years latertwo years later"8''2 years later2 years later 7%%in two yearsin two years6!!in 2 yearsin 2 years5##next year'snext year's 4%%1 year later1 year later$3))one year laterone year later 2%%a year latera year later1in 1 yearin 1 year0##in one yearin one year/in a yearin a year.next yearnext year -%%yoursyours,theirstheirs+hershers*##youryour)theirtheir(itsits'herher&hishis%butterbutter$!!strawberrystrawberry#berryberry"cherrycherry&!++cereal, cerealscereal, cereals baconbaconbananabanana {lM(p[B%ZC.{Xblank onblank onWblankblankVforgottenforgottenUforgotforgotT!!forgettingforgettingSforgetsforgetsRforgetforgetQgrapegrapePgrapesgrapes:O??deaf school, deaf schoolsdeaf school, deaf schoolsVN[[residential school, residential schoolsresidential school, residential schools2M77institute, institutesinstitute, institutesLice creamice creamKjealousjealousJjuicejuiceIannualannualH!!every yearevery yearGannuallyannuallyFyearlyyearly(E--five years laterfive years later"D''5 years later5 years later"C''in five yearsin five yearsB!!in 5 yearsin 5 years(A--four years laterfour years later"@''4 years later4 years later"?''in four yearsin four years>!!in 4 yearsin 4 years dZo\A va0dHpMMblend, blends, blending, blendedblend, blends, blending, blendedDoIImerge, merges, merging, mergedmerge, merges, merging, mergedn##engineeringengineeringmmeasuremeasure.l33division, divisionsdivision, divisionsksplitsplitjdividedividei!!divided bydivided byhcabbagecabbageglettucelettucefcarrotcarrotecheesecheese2d77vegetable, vegetablesvegetable, vegetablesctriangletrianglebsoonsoonashortlyshortly`soonsoon_measuremeasure^##measurementmeasurement]sizesize\you knowyou knowT[YYknow it, knows it, knowing it, knew itknow it, knows it, knowing it, knew itthemselvesthemselves"''itselfitself$))herselfherself$~))himselfhimself}yourselfyourself|##frankfurterfrankfurter{hot doghot dog$z))linked sausagelinked sausageysausagesausagexsteaksteakwmeatmeatVv[[combination, combinationscombination, combinations:u??integration, integrationsintegration, integrations$t))the mainstreamthe mainstreampsuumainstream, mainstreams, mainstreaming, mainstreamedmainstream, mainstreams, mainstreaming, mainstreamedrcombine, combines, combining, combinedcombine, combines, combining, combineddqiiintegrate, integrates, integrating, integratedintegrate, integrates, integrating, integrated nw^I&zU._J5n"''melon, melonsmelon, melons*//pumpkin, pumpkinspumpkin, pumpkins lightlight@EE availability, availabilitiesavailability, availabilities availableavailable earlyearly pastapasta&++ noodle, noodlesnoodle, noodles spaghettispaghetti*// what will they dowhat will they do(-- what did they dowhat did they do.33 what are they doingwhat are they doing$)) what will I dowhat will i do"'' what did I dowhat did i do&++ what am I doingwhat am i doing(-- what will you dowhat will you do&++ what did you dowhat did you do, 11 what are you doingwhat are you doing %% do dodo do oniononion peanutspeanuts nutsnutsmyselfmyselfmyselfmyself&++yourselfyourself!!themselvesthemselves FM.pWy`K6! r[F:sushisushi9Sundaysunday8wonderfulwonderful7marvelousmarvelous6terrificterrific5greatgreat4wonderfulwonderful3peaspeas2beansbeans1creamcream0pizzapizza/pizzapizza.hot doghot dog-percentpercent,mushroommushroomd+iitelephone, telephones, telephoning, telephonedtelephone, telephones, telephoning, telephoned@*EEcall, calls, calling, calledcall, calls, calling, called)Idahoanidahoan(Idahoidaho'Irishirish(&--Northern Irelandnorthern ireland6%;;The Republic of Irelandthe republic of ireland$Irelandireland#potatopotato"!!watermelonwatermelonF!KKhoneydew melon, honeydew melonshoneydew melon, honeydew melons. 33honeydew, honeydewshoneydew, honeydews6;;cantaloupe, cantaloupescantaloupe, cantaloupes QqX3yJ#sL!Q.S33#crisscrossedcrisscrossed*R//#crisscrosscrisscrossQ#checkeredcheckeredP#checkedcheckedO#plaidplaid$N))"stripesstripes(M--"vertical stripesvertical stripes$L))"stripedstriped(K--"vertical-stripedvertical-striped,J11"vertically stripedvertically striped$I))!stripesstripes,H11!horizontal stripeshorizontal stripes$G))!stripedstriped,F11!horizontal-stripedhorizontal-striped0E55!horizontally stripedhorizontally striped.D33 calendar, calendarscalendar, calendars.C33 schedule, schedulesschedule, schedules"B'' table, tablestable, tables"A'' chart, chartschart, charts@seafoodseafood?!!sunglassessunglasses>!!sunglassessunglasses=T-Mobilet-mobile<tee shirttee shirt;t-shirtt-shirt Rf9d?nM(uR o%%1swirl designswirl design"n''1swirl patternswirl pattern&m++1swirlingswirling$l))1swirl-designedswirl-designed&k++1swirl-patternedswirl-patternedj0peachpeach"i''/spoon, spoonsspoon, spoonsh##/soup, soupssoup, soupsg.comfortcomfortf##.comfortablycomfortablye##.comfortablecomfortabled-corncornc!!,no sleevesno sleevesb!!,sleevelesssleeveless"a''+short sleevesshort sleeves"`''+short-sleevedshort-sleeved2_77*three-quarter sleevesthree-quarter sleeves2^77*three-quarter-sleevedthree-quarter-sleeved ]%%)long sleeveslong sleeves \%%)long-sleevedlong-sleeved"[''(salad, saladssalad, salads*Z//'quarter, quartersquarter, quartersY&usuallyusuallyX&tend totend toW%typicallytypicallyV%usuallyusuallyU%tend totend toT$cultureculture {c>|U4P{:??4subtraction, subtractionssubtraction, subtractions2774deduction, deductionsdeduction, deductions`ee4subtract, subtracts, subtracting, subtractedsubtract, subtracts, subtracting, subtractedPUU4deduct, deducts, deducting, deducteddeduct, deducts, deducting, deductedLQQ4remove, removes, removing, removedremove, removes, removing, removed3same timesame time"~''3synchronouslysynchronously}##3synchronoussynchronous$|))3simultaneouslysimultaneously {%%3simultaneoussimultaneousz2spotsspotsy!!2polka dotspolka dotsx##2large spotslarge spots(w--2large polka dotslarge polka dotsv!!2polka-dotspolka-dots"u''2spottyspotty t%%2polka-dottedpolka-dotteds2dotteddottedr2spottedspotted$q))1swirledswirled p%%1swirlswirl !LxaH/}d-zeJ9" xeL%?picturepicture$?logologo#?texttext"?graphicgraphic!>whatwhat =whatwhat<sum upsum up<sumsum<total uptotal up<totaltotal;sum upsum up;sumsum;total uptotal up;totaltotal*//;total across timetotal across time:add upadd up:addadd:additionaddition9add upadd up9addadd9additionaddition4998why don't, why doesn'twhy don't, why doesn't8why notwhy not7spotsspots !!7polka dotspolka dots !!7polka-dotspolka-dots" ''7spottyspotty %%7polka-dottedpolka-dotted 7dotteddotted7spottedspotted6throughthrough5tomatotomato4minus, minuses, minusing, minusedminus, minuses, minusing, minused $rmZE,dQ6eH1rIPWisconsinwisconsinHOtrucktruckG!!NTennesseantennesseanFNTennesseetennesseeEMOklahomanoklahomanDMOklahomaoklahomaCLNevadannevadanBLNevadanevadaAKNebraskannebraskan@KNebraskanebraska?Jmissmiss">''JMississippianmississippian=##JMississippimississippi<!!IMinnesotanminnesotan;IMinnesotaminnesota:##HMichigandermichigander9HMichiganmichigan8Gmassmass"7''GMassachusettsmassachusetts6FKansankansan5FKansaskansas4EIowaniowan3EIowaiowa2DHoosierhoosier1DIndiananindianan0DIndianaindiana/CIdahoanidahoan.CIdahoidaho-Bbankbank,Avibrantvibrant+Aboldbold*Aloudloud)@vibrantvibrant(@boldbold'@loudloud&?imageimage &^QBoZI4# }\G*{^o`4th place4th placen_thirdthirdm##_third placethird placel_3rd3rdk_3rd place3rd placej^secondsecond i%%^second placesecond placeh^2nd2ndg^2nd place2nd placef]firstfirste##]first placefirst placed]1st1stc]1st place1st placeb\9th9tha\ninthninth`[8th8th_[eightheighth^Z7th7th]Zseventhseventh\Y6th6th[YsixthsixthZX5th5thYXfifthfifthXW4th4thWWfourthfourthVV3rd3rdUVthirdthirdTU2nd2ndSUsecondsecondR!!TWyomingitewyomingiteQTWyomingwyoming"P''SUnited Statesunited states OSUSus8N==RUnited States of Americaunited states of americaMRUSAusa L%%QWisconsinitewisconsiniteKQWisconsinwisconsin J%%PWisconsinitewisconsinite !OfQ4#dS0nU$|O*//hairline, airlinesairline, airlines*//hairport, airportsairport, airports"''hpilot, pilotspilot, pilots. 33haircraft, aircraftsaircraft, aircrafts" ''hplane, planesplane, planes. 33hairplane, airplanesairplane, airplanes gAfricanafrican gAfricaafricafAfricanafricanfAfricaafricaeninthninth##eninth placeninth placee9th place9th placee9th9thdeightheighth %%deighth placeeighth placed8th8thd8th place8th place~cseventhseventh"}''cseventh placeseventh place|c7th7th{c7th place7th placezbsixthsixthy##bsixth placesixth placexb6th6thwb6th place6th placevafifthfifthu##afifth placefifth placeta5th5thsa5th place5th placer`fourthfourth q%%`fourth placefourth placep`4th4th JP^rW8oJ"$''mUnited Statesunited states8#==mUnited States of Americaunited states of america "mUSus!mUSAusa mAmericanamericanmAmericaamerica!!lIllinoisanillinoisanlIllinoisillinois!!kIllinoisanillinoisankIllinoisillinois*//jarrival, arrivalsarrival, arrivals*//jlanding, landingslanding, landingsLQQjarrive, arrives, arriving, arrivedarrive, arrives, arriving, arrived@EEjland, lands, landing, landedland, lands, landing, landed*//iliftoff, liftoffsliftoff, liftoffs277ideparture, departuresdeparture, departures*//itakeoff, takeoffstakeoff, takeoffs`eeilift off, lifts off, lifting off, lifted offlift off, lifts off, lifting off, lifted offPUUidepart, departs, departing, departeddepart, departs, departing, departedZ__itake off, takes off, taking off, took offtake off, takes off, taking off, took off Tz]Lt]F-sL'oTDyadjacentadjacent(C--yon the left sideon the left sideB##yon the lefton the left Aybyby@ybesidebeside?ynext tonext to*>//xthemselvesthemselves"=''xitselfitself$<))xherselfherself$;))xhimselfhimself:xyourselfyourself&9++wyourselfyourself8!!wthemselvesthemselves7witselfitself6wherselfherself5whimselfhimself4vmyselfmyself3umyselfmyself2toverover1taboveabove 0%%tgreater thangreater than/tmore thanmore than.tat leastat leastR-WWsdrive, drives, driving, drove, drivendrive, drives, driving, drove, driven,rbusbus+qless thanless than*qunderunder)qbelowbelow(oAsianasian'oAsiaasia&nArizonanarizonan%nArizonaarizona CtS<!xcN5DwZCamuseummuseum`Coloradancoloradan_ColoradocoloradoR^WWlaunch, launches, launching, launchedlaunch, launches, launching, launchedZ]__take off, takes off, taking off, took offtake off, takes off, taking off, took offh\mmblast off, blasts off, blasting off, blasted offblast off, blasts off, blasting off, blasted off&[++rocket, rocketsrocket, rocketsZIndianindianYIndiaindia.X33semester, semesterssemester, semestersWChinesechineseVChinachinaUSwedeswedeTSwedishswedishSSwedenswedenRNorwegiannorwegianQNorwaynorwayP~FinnfinnO~FinnishfinnishN~FinlandfinlandM}EuropeaneuropeanL}EuropeeuropeK##|twelve noontwelve noonJ|middaymiddayI|noonnoonH{middaymiddayG{noonnoonFzColoradancoloradanEzColoradocolorado Mi@j jG& {`M~goldgold}Japanesejapanese|Japanjapan{FinnfinnzFinnishfinnishyFinlandfinlandxNorwegiannorwegianwNorwaynorwayvno biggieno biggieu##no big dealno big deal t%%it's nothingit's nothingsnothingnothing6r;;skateboard, skateboardsskateboard, skateboardsqtrucktruckp!!engagementengagementoengagedengaged^ncc(neutrally closed mouth then rounded mouth)(neutrally closed mouth then rounded mouth)mmeansmeans&l++course, coursescourse, courses*k//passage, passagespassage, passages"j''aisle, aislesaisle, aisles"i''trail, trailstrail, trailsh##road, roadsroad, roads&g++street, streetsstreet, streets"f''route, routesroute, routese##path, pathspath, pathsdway, waysway, wayscMontananmontananbMontanamontana !ew\#{fM8hC* |eTaiwantaiwanKoreanskoreans"''South Koreanssouth koreansKoreankorean %%South Koreansouth koreanKoreakorea##South Koreasouth koreaKoreanskoreans"''North Koreansnorth koreansKoreankorean %%North Koreannorth koreanKoreakorea##North Koreanorth koreaKoreanskoreansKoreankoreanKoreakoreaJapanesejapaneseJapanjapan Italianitalian Italyitaly Pepsipepsi Italianitalian ItalyitalyIndianindianIndiaindia6;;helicopter, helicoptershelicopter, helicopters6;;helicopter, helicoptershelicopter, helicoptersHawaiianhawaiianHawaiihawaiiHawaiianhawaiianHawaiihawaii##Californiancalifornian!!Californiacalifornia ![uL5iX= cJ/~[ @%%Helen Kellerhelen keller?!!Hongkongerhongkonger >%%Hong Kongesehong kongese=Hong Konghong kong2<77gymnasium, gymnasiumsgymnasium, gymnasiums;gym, gymsgym, gyms:Georgiangeorgian9Georgiageorgia8Floridianfloridian7Floridaflorida6DTdt5downtowndowntown4condocondo3!!Delawareandelawarean2Delawaredelaware1Coloradancoloradan0Coloradocolorado/arkark.Arkansanarkansan-Arkansasarkansas,Alabamanalabaman+Alabamianalabamian*Alabamaalabama)Swedeswede(Swedishswedish'Swedensweden&Subwaysubway&%++subway, subwayssubway, subways$!!New Yorkernew yorker#New Yorknew york"Taiwanesetaiwanese!Taiwantaiwan Taiwanesetaiwanese MmL+c<{\9rM"_''Pennsylvanianpennsylvanian ^%%Pennsylvaniapennsylvania]Ohioanohioan\Ohioohio[oceanoceanZ##New Mexicannew mexicanY!!New Mexiconew mexico"X''New Jerseyitenew jerseyite W%%New Jerseyannew jerseyanV!!New Jerseynew jersey&U++New Hampshiritenew hampshirite"T''New Hampshirenew hampshire"S''North Dakotannorth dakotan R%%North Dakotanorth dakota(Q--North Caroliniannorth carolinian$P))North Carolinanorth carolinaO!!MissourianmissourianNMissourimissouriMloftloftLlakelake K%%Los Angelenolos angelenoJAngelinoangelinoIAngelenoangeleno HLAlaG##Los Angeleslos angelesF##LouisianianlouisianianE!!LouisiananlouisiananDLouisianalouisianaC!!KentuckiankentuckianBKentuckykentuckyAHKhk #OmJ#wZ5gT?0 fOAlaskaalaskacountrycountry##countrysidecountrysideruralrural~countycounty}countrycountry"|''poorlypoorly{badlybadlyzbadbad yokokxgreatgreatwgoodgoodvthumbs upthumbs upuall goodall goodt##sounds goodsounds goodsa-oka-ok rokokqgoodgoodpperfectperfect$o))West Virginianwest virginian"n''West Virginiawest virginiamVirginianvirginianlVirginiavirginiakUtahanutahanjUtahnutahniUtahutah(h--South Caroliniansouth carolinian$g))South Carolinasouth carolina$f))Rhode Islanderrhode islander e%%Rhode Islandrhode islanddriverriver cPRpr(b--public relationspublic relations a%%Puerto Ricanpuerto rican`##Puerto Ricopuerto rico VmP=*S" `G,V*"//restaurantrestaurant(!--cafeteriacafeteria ##dining roomdining roomCubancubanCubacuba277bookstore, bookstoresbookstore, bookstoresAustrianaustrianAustriaaustria!!AustralianaustralianAustraliaaustraliaDanedaneDanishdanishDenmarkdenmarkDanedaneDanishdanishDenmarkdenmark.33building, buildingsbuilding, buildingsDIIbuild, builds, building, builtbuild, builds, building, builtBrazilianbrazilianBrazilbrazilcommunitycommunity towntown citycity villagevillage towntown citycityclassroomclassroomcafeteriacafeteriaCanadiancanadianCanadacanada(--church, churcheschurch, churchesAlaskanalaskan `\#w`E,g2`"@''Persiapersia ?%%Farsifarsi>Iranianiranian=Iraniran<hotelhotel;hotelhotel:hospitalhospital9Hollandholland2877gymnasium, gymnasiumsgymnasium, gymnasiums7gym, gymsgym, gyms6Hollywoodhollywood*5//holiday, holidaysholiday, holidays4Greekgreek3Greecegreece2Germanicgermanic1Germangerman0Germanygermany/Germanicgermanic.Germangerman-Germanygermany*,//roadway, roadwaysroadway, roadways*+//highway, highwayshighway, highways6*;;expressway, expresswaysexpressway, expressways6);;interstate, interstatesinterstate, interstates*(//freeway, freewaysfreeway, freeways'famousfamous&Egyptianegyptian%Egyptegypt$Egyptianegyptian#Egyptegypt `oF/qT=$C$`@ZEEpart, parts, parting, partedpart, parts, parting, parted>YCCsliding door, sliding doorssliding door, sliding doorsX##wall, wallswall, wallsW!!restaurantrestaurantV!!restaurantrestaurantPUUUput there, puts there, putting thereput there, puts there, putting there,T11put, puts, puttingput, puts, puttingSparkingparking"R''New Zealandernew zealanderQ##New Zealandnew zealandPMexicanmexicanOMexicomexicoNIsraeliteisraeliteMIsraeliisraeliLIsraelisraelKJudaismjudaismJJewishjewishIJewjewHHebrewhebrewGIsraeliteisraeliteFIsraeliisraeliEIsraelisrael&D++island, islandsisland, islands@CEEpark, parks, parking, parkedpark, parks, parking, parked$B))persianpersian$A))Persianpersian 8"}\=" m@ S8pScotlandscotlandRoWWduffle bag, duffle bagsduffle bag, duffle bagsnbaggagebaggagemluggageluggage.l33suitcase, suitcasessuitcase, suitcases2k77briefcase, briefcasesbriefcase, briefcases*j//handbag, handbagshandbag, handbags"i''purse, pursespurse, purseshbag, bagsbag, bagsgTexantexanfTexastexasestatestatedOregonianoregoniancOregonoregonbFilipinofilipinoa!!Philippinephilippine`##Philippinesphilippines_principalprincipalB^GG(continuous vertical surface)(continuous vertical surface)@]EEopen, opens, opening, openedopen, opens, opening, openedp\uuslide apart, slides apart, sliding apart, slid apartslide apart, slides apart, sliding apart, slid aparth[mmslide open, slides open, sliding open, slid openslide open, slides open, sliding open, slid open "NwbO<%\I4jW6N6;;The Republic of Irelandthe republic of irelandIrelandirelandPolishpolishPolepolePolandpoland Polishpolish Polandpoland$ ))Siamesesiamese ##Siamsiam ThaithaiThailandthailandRussianrussianRussiarussiaRussianrussianRussiarussia!!VietnamesevietnameseVietnamvietnamUtahanutahanUtahnutahnUtahutah0~55District of Columbiadistrict of columbia"}''Washington DCwashington dc"|''Washingtonianwashingtonian*{//George Washingtongeorge washingtonz!!Washingtonwashingtonypuddlepuddlexpondpondwlakelakevriverriveruoceanocean t%%Puerto Ricanpuerto ricans##Puerto Ricopuerto ricorScotsscotsqScottishscottish ![uX5h=(rQ<p[3 brookbrook2 channelchannel1 canalcanal0 creekcreek/ streamstream. riverriver$-)) Hollandholland, Dutchdutch+## Netherlandsnetherlands*Swissswiss)##Switzerlandswitzerland(Swissswiss'##Switzerlandswitzerland$&))Northern Irishnorthern irish(%--Northern Irelandnorthern ireland$Idahoanidahoan#Idahoidaho"Irishirish(!--Northern Irelandnorthern ireland6 ;;The Republic of Irelandthe republic of irelandIrelandirelandJamaicanjamaicanJamaicajamaicaIraqiiraqiIraqiraq!!Hongkongerhongkonger %%Hong Kongesehong kongeseHong Konghong kongIcelandericelanderIcelandicicelandicIcelandiceland %%Irish Gaelicirish gaelicIrishirish $^w\C( mN3ubO8%s^WrapidrapidVquickquickUfastfastTswiftlyswiftlySrapidlyrapidlyRquicklyquicklyQswiftswiftPrapidrapidOquickquickNfastfastMslowlyslowlyLslowslowKlonglongJmillionmillionIoftenoftenFHKKtransportation, transportationstransportation, transportationsGAsianasianFAsiaasiaE!!IllinoisanillinoisanDIllinoisillinoisC!!IllinoisanillinoisanBIllinoisillinois0A55District of Columbiadistrict of columbia @DCdc?Kansankansan>Kansaskansas= Scotsscots< Scottishscottish; Scotlandscotland: Spanishspanish9 Spaniardspaniard8 Spainspain$7)) beach, beachesbeach, beaches6 sea, seassea, seas5 oceanocean4 waterwaywaterway %Y`M8#za@'`G& hY |$bibi{#has tohas toz#have tohave toy#need toneed tox#mustmustw#shouldshouldv#needneedu!!"nine hoursnine hourst"9 hours9 hourss##!eight hourseight hoursr!8 hours8 hoursq## seven hoursseven hoursp 7 hours7 hoursosix hourssix hoursn6 hours6 hoursm!!five hoursfive hoursl5 hours5 hoursk!!four hoursfour hoursj4 hours4 hoursi##three hoursthree hoursh3 hours3 hoursgtwo hourstwo hoursf2 hours2 hoursehourhourdswiftlyswiftlycrapidlyrapidlybquicklyquicklyaswiftswift`rapidrapid_quickquick^fastfast ]%%very quicklyvery quickly\very fastvery fast[swiftlyswiftlyZrapidlyrapidlyYquicklyquicklyXswiftswift Cj=kH#W6o\C-bowlingbowling,timetime<AA+date, dates, dating, dateddate, dates, dating, dated##+date, datesdate, dates"''*steadysteady"''*datingdating*go steadygo steady##*be togetherbe together055*be in a relationshipbe in a relationship)smittensmitten %%)smitten withsmitten with)enamoredenamored ##)enamored ofenamored of ##)enamored byenamored by" '')enamored withenamored with %%)fall in lovefall in love ##(babybaby*//(girlfriendgirlfriend(--(boyfriendboyfriend##(Valentine'svalentine's(partnerpartner!!(sweetheartsweetheart*//(significant othersignificant other(loverlover'kid, kidskid, kids&childchild%familyfamily~$bisexualsbisexuals}$bisexualbisexual Ug6 K r]:nU48grandmagrandma3##8grandmothergrandmother27granddadgranddad17grandpagrandpa0##7grandfathergrandfather*///6newborn, newbornsnewborn, newborns&.++6infant, infantsinfant, infants -%%6baby, babiesbaby, babies,5birthbirth+!!5give birthgive birth*4birthbirth)4bornborn$())3showingshowing'3pregnantpregnant"&''3very pregnantvery pregnant(%--3heavily pregnantheavily pregnant\$aa2conceive, conceives, conceiving, conceivedconceive, conceives, conceiving, conceived#2pregnantpregnant("--1propose marriagepropose marriage!1proposepropose* //0fiancee, fianceesfiancee, fiancees.330fiancée, fiancéesfiancée, fiancées&++0fiance, fiancesfiance, fiances*//0fiancé, fiancésfiancé, fiancés/shelvesshelves.shelfshelf.floorfloor FhE mH)rM8%nYFRIlastlastQHolderolderPGnephewnephewOFnieceniece"N''Efemale cousinfemale cousinMEcousincousinL##Dmale cousinmale cousinKDcousincousinJCcousincousinIBauntauntHAuncleuncle"G''@sister-in-lawsister-in-law"F''@sister in lawsister in law$E))?brother-in-lawbrother-in-law$D))?brother in lawbrother in lawC!!>dad-in-lawdad-in-law"B''>father-in-lawfather-in-lawA!!>dad in lawdad in law"@''>father in lawfather in law?!!=mom-in-lawmom-in-law">''=mother-in-lawmother-in-law=!!=mom in lawmom in law"<''=mother in lawmother in law(;--<grandkidsgrandkids":''<grandchildrengrandchildren 9%%;grandaughtergrandaughter"8'';granddaughtergranddaughter7:grandsongrandson:6??9grandparent, grandparentsgrandparent, grandparents58grandmomgrandmom byZ9r]<'i<ubrSdeaddeadqSmissingmissingpSdisappeardisappearoSgonegonenRdeathdeathmRdeaddead4l99Rdie, dies, dying, dieddie, dies, dying, diedk!!Qretirementretirement*j//Qholiday, holidaysholiday, holidays.i33Qvacation, vacationsvacation, vacationshPretireretire"g''Ptake time offtake time off f%%Ptake a breaktake a breakeOretireretiredNretireretirecMcrosscrossb##Mmixed breedmixed breedaMmixedmixed`##Mconflictingconflicting_Mcrossingcrossing^Mclashingclashing]Lconflictconflict\!!Kdescendantdescendant[KlineagelineageZKposterityposterityY##KgenerationsgenerationsX!!KgenerationgenerationWJyoungeryoungerVIfinallyfinallyUIlastlylastly&T++IyoungestyoungestSIfinalfinal gRx]F-x!!Zyou're next, you are next, you were next, you'll be next, you will be nextyou're next, you are next, you were next, you'll be next, you will be next&++Zher turnher turn&++Zhis turnhis turn*//Ztheir turntheir turnZyour turnyour turnYlesbianlesbianXsinglessinglesXsinglesingleWsolutionsolution~Wresolveresolve}Wsolvesolve|Wfadefade{WdissolvedissolvezWmeltmeltyVdivorcedivorcexUdivorcedivorce6w;;Tseparation, separationsseparation, separationsvTapartapartuTdistinctdistinctt!!Tseparatelyseparately\saaTseparate, separates, separating, separatedseparate, separates, separating, separated 6T=$}bG(--]your turnyour turn]her turnher turn]his turnhis turn!!]their turntheir turn \I'm next, I am next, I was next, I'll be next, I will be nexti'm next, i am next, i was next, i'll be next, i will be next \my turnmy turn [lonelylonely^ aaZshe's next, she is next, she was next, she'll be next, she will be nextshe's next, she is next, she was next, she'll be next, she will be nextT WWZhe's next, he is next, he was next, he'll be next, he will be nexthe's next, he is next, he was next, he'll be next, he will be nextnqqZthey're next, they are next, they were next, they'll be next, they will be nextthey're next, they are next, they were next, they'll be next, they will be next QT&> lQ aadoptiveadoptiveaadoptedadoptedataketakeahosthostaadoptadopt`halfhalf`cutcut_step-step-_stepstep^usedused!!^secondhandsecondhanddgg]you're next, you are next, you were next, you'll be next, you will be nextyou're next, you are next, you were next, you'll be next, you will be next]she's next, she is next, she was next, she'll be next, she will be nextshe's next, she is next, she was next, she'll be next, she will be next]he's next, he is next, he was next, he'll be next, he will be nexthe's next, he is next, he was next, he'll be next, he will be next(++]they're next, they are next, they were next, they'll be next, they will be nextthey're next, they are next, they were next, they'll be next, they will be next @oR)qHc6i@&:++lstraightforwardstraightforward9!!lforthrightforthright8lbluntblunt7lfrankfrank(6--ldirect, directlydirect, directly5lstraightstraight4!!kson-in-lawson-in-law3!!kson in lawson in law*2//jfiancee, fianceesfiancee, fiancees.133jfiancée, fiancéesfiancée, fiancées&0++jfiance, fiancesfiance, fiances*///jfiancé, fiancésfiancé, fiancés*.//ifiancee, fianceesfiancee, fiancees.-33ifiancée, fiancéesfiancée, fiancées&,++ifiance, fiancesfiance, fiances*+//ifiancé, fiancésfiancé, fiancés*hengagedengaged)!!hengagementengagement(gdisorderdisorder 'gdodo&&++fdaughter-in-lawdaughter-in-law&%++fdaughter in lawdaughter in law$egay, gaysgay, gays#dgay, gaysgay, gays*"//cpartner, partnerspartner, partnersD!IIbshare, shares, sharing, sharedshare, shares, sharing, shared I|YJ5gR3fK"jIY##r4 years old4 years old$X))rfour years oldfour years oldWq33 V%%qthreethreeUqage 3age 3Tqage threeage threeS##q3 years old3 years old&R++qthree years oldthree years oldQp22P!!ptwotwoOpage 2age 2Npage twoage twoM##p2 years old2 years old"L''ptwo years oldtwo years oldKo11J!!ooneoneI!!oa year olda year oldHoage 1age 1Goage oneage oneF!!o1 year old1 year old E%%oone year oldone year old,D11ntransgender peopletransgender people C%%ntrans peopletrans peopleB##ntransgendertransgenderAntranstrans @mNBnb ?%%menby, enbiesenby, enbies2>77mnonbinary, non-binarynonbinary, non-binary=lsobersober<lheterohetero ;%%lheterosexualheterosexual [mL1lM2 xO.v[xwage nineage ninew##w9 years old9 years old$v))wnine years oldnine years olduv88 t%%veighteightsvage 8age 8rvage eightage eightq##v8 years old8 years old&p++veight years oldeight years oldou77 n%%usevensevenmuage 7age 7luage sevenage sevenk##u7 years old7 years old&j++useven years oldseven years oldit66h!!tsixsixgtage 6age 6ftage sixage sixe##t6 years old6 years old"d''tsix years oldsix years oldcs55b##sfivefiveasage 5age 5`sage fiveage five_##s5 years old5 years old$^))sfive years oldfive years old]r44\##rfourfour[rage 4age 4Zrage fourage four KgN7wR5 o@nK %%|14 years old14 years old,11|fourteen years oldfourteen years old{1313&++{thirteenthirteen{age 13age 13 %%{age thirteenage thirteen %%{13 years old13 years old,11{thirteen years oldthirteen years old z1212" ''ztwelvetwelve zage 12age 12 !!zage twelveage twelve %%z12 years old12 years old(--ztwelve years oldtwelve years oldy1111"''yelevenelevenyage 11age 11!!yage elevenage eleven %%y11 years old11 years old(--yeleven years oldeleven years oldx1010!!xtentenxage 10age 10~xage tenage ten }%%x10 years old10 years old"|''xten years oldten years old{w99z##wninenineywage 9age 9 DS0dC,w`9aD11717(0--seventeenseventeen/age 17age 17".''age seventeenage seventeen -%%17 years old17 years old.,33seventeen years oldseventeen years old+1616$*))sixteensixteen)age 16age 16(##age sixteenage sixteen '%%16 years old16 years old*&//sixteen years oldsixteen years old%~1616$$))~sixteensixteen#~age 16age 16"##~age sixteenage sixteen !%%~16 years old16 years old* //~sixteen years oldsixteen years old}1515$))}fifteenfifteen}age 15age 15##}age fifteenage fifteen %%}15 years old15 years old*//}fifteen years oldfifteen years old|1414&++|fourteenfourteen|age 14age 14 %%|age fourteenage fourteen `pE(sV'U2` K%%19 years old19 years old,J11nineteen years oldnineteen years oldI1919&H++nineteennineteenGage 19age 19 F%%age nineteenage nineteen E%%19 years old19 years old,D11nineteen years oldnineteen years oldC1818&B++eighteeneighteenAage 18age 18 @%%age eighteenage eighteen ?%%18 years old18 years old,>11eighteen years oldeighteen years old=1818&<++eighteeneighteen;age 18age 18 :%%age eighteenage eighteen 9%%18 years old18 years old,811eighteen years oldeighteen years old71717(6--seventeenseventeen5age 17age 17"4''age seventeenage seventeen 3%%17 years old17 years old.233seventeen years oldseventeen years old fI&iF%vQ:}feage 18age 18 d%%age eighteenage eighteen c%%18 years old18 years old,b11eighteen years oldeighteen years olda1717(`--seventeenseventeen_age 17age 17"^''age seventeenage seventeen ]%%17 years old17 years old.\33seventeen years oldseventeen years old[1616$Z))sixteensixteenYage 16age 16X##age sixteenage sixteen W%%16 years old16 years old*V//sixteen years oldsixteen years oldU2323.T33twenty-threetwenty-threeSage 23age 23(R--age twenty-threeage twenty-three Q%%23 years old23 years old4P99twenty-three years oldtwenty-three years oldO1919&N++nineteennineteenMage 19age 19 L%%age nineteenage nineteen fhE.{d?"aDf2222*~//twenty-twotwenty-two}age 22age 22$|))age twenty-twoage twenty-two {%%22 years old22 years old0z55twenty-two years oldtwenty-two years oldy2121*x//twenty-onetwenty-onewage 21age 21$v))age twenty-oneage twenty-one u%%21 years old21 years old0t55twenty-one years oldtwenty-one years olds2020"r''twentytwentyqage 20age 20p!!age twentyage twenty o%%20 years old20 years old(n--twenty years oldtwenty years oldm1919&l++nineteennineteenkage 19age 19 j%%age nineteenage nineteen i%%19 years old19 years old,h11nineteen years oldnineteen years oldg1818&f++eighteeneighteen K{d3~O2kNjK!!two monthstwo months2525,11twenty-fivetwenty-fiveage 25age 25&++age twenty-fiveage twenty-five %%25 years old25 years old277twenty-five years oldtwenty-five years old2525,11twenty-fivetwenty-fiveage 25age 25&++age twenty-fiveage twenty-five %%25 years old25 years old2 77twenty-five years oldtwenty-five years old 2424, 11twenty-fourtwenty-four age 24age 24&++age twenty-fourage twenty-four %%24 years old24 years old277twenty-four years oldtwenty-four years old2323.33twenty-threetwenty-threeage 23age 23(--age twenty-threeage twenty-three %%23 years old23 years old499twenty-three years oldtwenty-three years old ykJ/yX=hyH-MMspoil, spoils, spoiling, spoiledspoil, spoils, spoiling, spoiledR,WWcaress, caresses, caressing, caressedcaress, caresses, caressing, caressedL+QQstroke, stroked, stroking, strokedstroke, stroked, stroking, stroked<*AApet, pets, petting, pettedpet, pets, petting, pettedP)UUsummon, summons, summoning, summonedsummon, summons, summoning, summoned@(EEcall, calls, calling, calledcall, calls, calling, called'9 months9 months&##nine monthsnine months%8 months8 months $%%eight monthseight months#7 months7 months "%%seven monthsseven months!6 months6 months !!six monthssix months5 months5 months##five monthsfive months4 months4 months##four monthsfour months3 months3 months %%three monthsthree months2 months2 months` &,28>DJPV\bhntz "(.4:@FLRX^djpv| 3N"Z#w$%)&<'I([)m*+,+-?.Q/a0u12>3[4n5 6$788M9c:~;<%=@>W?x@A?BeCD(EAFbGvHI*JMKdLM,NUOzPQ>RfS T1UNVjWX Y@Zc[\]A^f_`a=bOctde9fZg|hi>j`kvlm5nPohpqr=sXtpuvw:xSyoz{%|I}o~{ &,28>DJPV\bhntz "(.4:@FLRX^djpv|~xrlf`ZTNHB<60*$T4o`D&gH$qR- jI& p]5c@uDa~@_"@Zp3W|4Rr :Yx1Ke-Kd$Cc}.Ilv2D\q!,A]$7Q\w 3M¢rãģ7ţTƣoǤ Ȥɤ9ʤ[ˤ|̥ͥ0Υ?ϥ\ХpѦҦӦ:ԦXզ{֧"קHاa٧nڨۨ6ܨRݨuީߩ-M X^K6! sVC.xO2}X"K''shark, sharksshark, sharksJ##seal, sealsseal, sealsI##seal, sealsseal, seals*H//dolphin, dolphinsdolphin, dolphins"G''whale, whaleswhale, whalesF##porkporkEpig, pigspig, pigs&D++spider, spidersspider, spiders0C55werewolf, werewolveswerewolf, werewolves B%%wolf, wolveswolf, wolvesAgiraffesgiraffes@giraffegiraffe?tigerstigers>tigertiger=lionslions<lionlion;elephantselephants:elephantelephant9monkeysmonkeys8monkeymonkey7bearsbears6bearbear5batsbats4batbat3snakessnakes2snakesnake1frogsfrogs0frogfrogL/QQcoddle, coddles, coddling, coddledcoddle, coddles, coddling, coddledP.UUpamper, pampers, pampering, pamperedpamper, pampers, pampering, pampered GV?&yF}Hm\Gdmoosemoosecelkelkbdeerdeer:a??crocodilian, crocodilianscrocodilian, crocodilians*`//gharial, gharialsgharial, gharials&_++caiman, caimanscaiman, caimans2^77crocodile, crocodilescrocodile, crocodiles2]77alligator, alligatorsalligator, alligators*\//lobster, lobsterslobster, lobsters[##crab, crabscrab, crabs*Z//lobster, lobsterslobster, lobstersY##crab, crabscrab, crabs*X//crawdad, crawdadscrawdad, crawdads0W55crawfish, crawfishescrawfish, crawfishes0V55crayfish, crayfishescrayfish, crayfishesUcattlecattleTcow, cowscow, cowsS##bull, bullsbull, bulls"R''eagle, eagleseagle, eaglesQturkeysturkeysPturkeyturkey*O//a Duck, the Ducksa duck, the ducksN##duck, ducksduck, ducks4M99butterfly, butterfliesbutterfly, butterflies"L''shark, sharksshark, sharks !K\3|WF+ {bSD!}\Kyouyou##both of youboth of youyou bothyou both!!two of youtwo of youyou twoyou twoboth ourboth ourourour"~''and meand me }%%and Iand i |wewe {ususzwe bothwe bothyus bothus bothx!!both of usboth of uswtwo of ustwo of usv!!you and meyou and meuyou and Iyou and it!!two of ourtwo of oursboth ourboth ourrourour"q''and meand me p%%and Iand i ousus nwewem!!both of usboth of usltwo of ustwo of uskbee, beesbee, beesjbee, beesbee, bees&i++shrimp, shrimpsshrimp, shrimps&h++beaver, beaversbeaver, beavers.g33chipmunk, chipmunkschipmunk, chipmunks.f33squirrel, squirrelssquirrel, squirrelsecariboucaribou SuT3b5te6nS$you fouryou four###four of youfour of you"our threeour three!ourour" ''and meand me %%and Iand i.33both of them and meboth of them and me,11both of them and Iboth of them and i wewe ususus threeus three##three of usthree of usour threeour threeourour"''and meand me %%and Iand i*//two of you and metwo of you and me(--two of you and Itwo of you and i$))you two and meyou two and me"''you two and Iyou two and i wewe ususus threeus three ##three of usthree of us ##those threethose three ##these threethese three youyou %%three of youthree of youyou threeyou threethose twothose twothese twothese two [yj[2_N3yV1 z[C!!five of usfive of usB!!those fivethose fiveA!!these fivethese five@youyou?you fiveyou five>##five of youfive of you=our fourour four<ourour";''and meand me :%%and Iand i0955three of them and methree of them and me.833three of them and Ithree of them and i 7wewe 6usus5us fourus four4!!four of usfour of us3our fourour four2ourour"1''and meand me 0%%and Iand i./33three of you and methree of you and me,.11three of you and Ithree of you and i(---you three and meyou three and me&,++you three and Iyou three and i +wewe *usus)us fourus four(!!four of usfour of us'!!those fourthose four&!!these fourthese four%youyou HmDqbS$|WF+iHc##interestinginterestingbnot yetnot yeta!!don't wantdon't want`maymay_mightmight^possiblypossibly]probablyprobably\perhapsperhaps[maybemaybeZour fiveour fiveYourour"X''and meand me W%%and Iand i(V--them four and methem four and me&U++them four and Ithem four and i.T33four of them and mefour of them and me,S11four of them and Ifour of them and i Rwewe QususPus fiveus fiveO!!five of usfive of usNour fiveour fiveMourour"L''and meand me K%%and Iand i$J))you four and Iyou four and i&I++you four and meyou four and me,H11four of you and mefour of you and me*G//four of you and Ifour of you and i Fwewe EususDus fiveus five D|eVG8){V/p-DP}UUremain, remains, remaining, remainedremain, remains, remaining, remained@|EEstay, stays, staying, stayedstay, stays, staying, stayedP{UUremain, remains, remaining, remainedremain, remains, remaining, remained@zEEstay, stays, staying, stayedstay, stays, staying, stayedPyUUremain, remains, remaining, remainedremain, remains, remaining, remained@xEEstay, stays, staying, stayedstay, stays, staying, stayed&w++looked the samelooked the same$v))looks the samelooks the same"u''look the samelook the sametlooklooksfacefacerprettyprettyqbeautifulbeautifulpaskaskoall of usall of us nususmwe allwe all lwewe kusus jwewe i2020htwentytwentygage 20age 20f!!age twentyage twenty e%%20 years old20 years old(d--twenty years oldtwenty years old @$Xy\?*rY@traffictraffictraffictraffic.33midnight, midnightsmidnight, midnightssessionsession!!conventionconvention!!conferenceconferencemeetingmeetinggo outgo out leaveleave key, keyskey, keys key, keyskey, keys givegive* //roadway, roadwaysroadway, roadways*//highway, highwayshighway, highways6;;expressway, expresswaysexpressway, expressways6;;interstate, interstatesinterstate, interstates*//freeway, freewaysfreeway, freeways277newspaper, newspapersnewspaper, newspapers:??publication, publicationspublication, publications*//printer, printersprinter, printersZ__publish, publishes, publishing, publishedpublish, publishes, publishing, publishedHMMprint, prints, printing, printedprint, prints, printing, printedshowshow~##vest, vestsvest, vests ?|cR9kR7;R?.looklookX-]]journey, journeys, journeying, journeyedjourney, journeys, journeying, journeyed,##trip, tripstrip, tripsj+oogo around, goes around, going around, went aroundgo around, goes around, going around, went aroundP*UUtravel, travels, traveling, traveledtravel, travels, traveling, traveled@)EEtour, tours, touring, touredtour, tours, touring, touredJ(OOstudy, studies, studying, studiedstudy, studies, studying, studied'studiesstudies&studyingstudying%studiedstudied$studystudy#youngyoung."33teenager, teenagersteenager, teenagers"!''youth, youthsyouth, youths& ++how comehow come"''due todue tobecausebecausewhywhyvamoosevamoosego outgo outtake offtake offleaveleavetriptriptraveltraveltourtour Om1}fI2hOIcarefulcarefulHbabysitbabysit G%%take care oftake care ofFtake caretake careEsweepsweepDbroombroomCbroombroomBsweepsweepAvacuumingvacuuming@vacuumvacuum?vacuumingvacuuming>vacuumvacuum=divorcedivorce<youngyoung;breakfastbreakfast2:77(B name sign on chin)(b name sign on chin)9breakfastbreakfast8tennistennisX7]]journey, journeys, journeying, journeyedjourney, journeys, journeying, journeyed6##trip, tripstrip, tripsj5oogo around, goes around, going around, went aroundgo around, goes around, going around, went aroundP4UUtravel, travels, traveled, travelingtravel, travels, traveled, traveling@3EEtour, tours, touring, touredtour, tours, touring, toured2triptrip1traveltravel0tourtour/faceface #izeH5~m\GlSB'ilfix upfix upkfixingfixingjfixfixithrowingthrowinghsendingsending g%%putting awayputting awayfthrowthrowesendsenddput awayput awaycpatpatbflattenflattenafoldfold`produceproduce_createcreate^makemake]pourpour"\''plant, plantsplant, plantsJ[OOgrow, grows, growing, grew, growngrow, grows, growing, grew, grownZbillsbillsYpaypayXfedfedWfeedingfeedingVfeedfeedUtoss outtoss outTthrow outthrow outS!!throw awaythrow awayRdiscarddiscardQdump outdump outPdumpdumpOempty outempty outNemptyempty6M;;wash horizontal surfacewash horizontal surfaceLwashingwashingKwashwashJ##tendtend u.9suHvMMenjoy, enjoys, enjoying, enjoyedenjoy, enjoys, enjoying, enjoyed u%%duty, dutiesduty, duties tverify, verifies, verifying, verifiedverify, verifies, verifying, verifiedXs]]inspect, inspects, inspecting, inspectedinspect, inspects, inspecting, inspectedhrmmcheck out, checks out, checking out, checked outcheck out, checks out, checking out, checked outHqMMcheck, checks, checking, checkedcheck, checks, checking, checkedbpggresearch, researches, researching, researchedresearch, researches, researching, researchedBoGGinvestigation, investigationsinvestigation, investigationsXn]]inspect, inspects, inspecting, inspectedinspect, inspects, inspecting, inspectedtmyyinvestigate, investigates, investigating, investigatedinvestigate, investigates, investigating, investigated JNjM,zaL7& xeJcompletecompletefullfullfill upfill upgasgasgas upgas upfill upfill upgasgas gas upgas up gasgas gasolinegasoline gasgas  glassglass toothtooth dentistdentist teethteeth drydry rentrent rentrentmedicalmedicalmedicinemedicinecut haircut hairpostalpostal~##post officepost office}amusementamusement"|''entertainmententertainment2{77enjoyment, enjoymentsenjoyment, enjoymentszpleasurepleasurelyqqappreciate, appreciates, appreciating, appreciatedappreciate, appreciates, appreciating, appreciatedDxIIamuse, amuses, amusing, amusedamuse, amuses, amusing, amusedhwmmentertain, entertains, entertaining, entertainedentertain, entertains, entertaining, entertained l[B# jS<!`K*@2EEhelp, helps, helping, helpedhelp, helps, helping, helped@1EEhelp, helps, helping, helpedhelp, helps, helping, helped0##applicationapplication/applyapply .%%volunteeringvolunteering-volunteervolunteer,zoozoo+!!instead ofinstead of*insteadinstead)fosterfoster(##replacementreplacement'exchangeexchange&switchswitch%changechange$!!substitutesubstitute#replacereplace"fosterfoster!##replacementreplacement exchangeexchangeswitchswitchchangechange!!substitutesubstitutereplacereplaceoiloiltotallytotallyentirelyentirely!!completelycompletelyfullyfullytotaltotalentireentire /VwfC*YF!/\Daamove out, moves out, moving out, moved outmove out, moves out, moving out, moved outdCiimove away, moves away, moving away, moved awaymove away, moves away, moving away, moved awayBpackpackApackingpacking"@''medicine shotmedicine shot?shotshot(>--injection in arminjection in arm,=11medicine injectionmedicine injection<injectioninjection&;++delegacydelegacy.:33delegate, delegatesdelegate, delegates9veteranveteran 8%%veterinarianveterinarian7vetvet@6EEhelp, helps, helping, helpedhelp, helps, helping, helpedH5MMtherapy, therapiestherapy, therapiesN4SStreatment, treatmentstreatment, treatments&3))assistance, assistances, assistancing, assistancedassistance, assistances, assistancing, assistanced j+mXG.c<j(\--'two timestwo times['twicetwice&Z++&one timeone timeY&onceonce&X++%poor youpoor you*W//%poor thingpoor thing$V))%how sadhow sadU!!%awwawwT%ohohS%sympathysympathyR%pitypityQ$wowwowP#wowwowO#whoawhoaN"won'twon'tM"refuserefuseL!all setall setK!setsetJ!readyreadyTIYY move in, moves in, moving in, moved inmove in, moves in, moving in, moved indHii move here, moves here, moving here, moved heremove here, moves here, moving here, moved hereTGYY move to, moves to, moving to, moved tomove to, moves to, moving to, moved totriplicate, triplicates, triplicating, triplicatedtriplicate, triplicates, triplicating, triplicatedLaQQ(triple, triples, tripling, tripledtriple, triples, tripling, tripled"`''(thricethrice_##(three timesthree times^!!'duplicate, duplicates, duplicating, duplicatedduplicate, duplicates, duplicating, duplicatedL]QQ'double, doubles, doubling, doubleddouble, doubles, doubling, doubled !kmFoTA.uX9k;sincesince:surprisesurprise:awokenawoken:woke upwoke up:awakeawake :wake upwake up %%9surprisinglysurprisingly 9surprisedsurprised !!9surprisingsurprising 9surprisessurprises9surprisesurprise8funfun7funfun6circuscircus$))6amusement parkamusement park %%6ferris wheelferris wheel6carnivalcarnival6fairfair5clubclub4jamboreejamboree~4carnivalcarnival}4ceremonyceremony|4festivalfestival{##4anniversaryanniversaryz##4celebrationcelebrationy4celebratecelebrate$x))3beach, beachesbeach, beaches$w))2beach, beachesbeach, beachesv2sea, seassea, seasu2oceanocean$t))1beach, beachesbeach, beachess0play poolplay poolr0shot poolshot pool ZeD)HWZ ! >reward, rewards, rewarding, rewardedreward, rewards, rewarding, rewardedl qq>contribute, contributes, contributing, contributedcontribute, contributes, contributing, contributedHMM>grant, grants, granting, grantedgrant, grants, granting, grantedLQQ>donate, donates, donating, donateddonate, donates, donating, donatedTYY>confer, confers, conferring, conferredconfer, confers, conferring, conferredPUU>bestow, bestows, bestowing, bestowedbestow, bestows, bestowing, bestowedHMM>give, gives, giving, gave, givengive, gives, giving, gave, given@EE>gift, gifts, gifting, giftedgift, gifts, gifting, gifted=birthdaybirthday##<nothing newnothing new$))<same old thingsame old thing<same oldsame old;has beenhas been;have beenhave been##;up till nowup till now %f5fm"% , ?reward, rewards, rewarding, rewardedreward, rewards, rewarding, rewardedl+qq?contribute, contributes, contributing, contributedcontribute, contributes, contributing, contributedH*MM?grant, grants, granting, grantedgrant, grants, granting, grantedL)QQ?donate, donates, donating, donateddonate, donates, donating, donatedT(YY?confer, confers, conferring, conferredconfer, confers, conferring, conferredP'UU?bestow, bestows, bestowing, bestowedbestow, bestows, bestowing, bestowedH&MM?give, gives, giving, gave, givengive, gives, giving, gave, given@%EE?gift, gifts, gifting, giftedgift, gifts, gifting, gifted>$CC>contribution, contributionscontribution, contributions.#33>donation, donationsdonation, donations">delegate, delegates, delegating, delegateddelegate, delegates, delegating, delegated Rf5x-a*mRADsunbathesunbathe@Cgraduategraduate?!!Cgraduationgraduation>Breunionreunion=Bassemblyassembly<Bgatheringgathering;Bassembleassemble:Bgathergather4999Aliability, liabilitiesliability, liabilities"8''Achore, choreschore, chores 7%%Aduty, dutiesduty, duties66;;Aobligation, obligationsobligation, obligationsH5MMAaccountability, accountabilitiesaccountability, accountabilitiesH4MMAresponsibility, responsibilitiesresponsibility, responsibilities3Aliableliable2##Aaccountableaccountable 1%%Aresponsibileresponsibile0##@gift, giftsgift, gifts>/CC?contribution, contributionscontribution, contributions..33?donation, donationsdonation, donations-?delegate, delegates, delegating, delegateddelegate, delegates, delegating, delegated TrE"ZI"y\7wT ]%%Sthanksgivingthanksgiving \%%SThanksgivingthanksgiving[RHalloweenhalloweenZQHalloweenhalloweenYPJuly 4thjuly 4thX##P4th of July4th of july$W))PFourth of Julyfourth of july"V''Oheart, heartsheart, heartsUNvalentinevalentineT##NValentine'svalentine's"S''Nheart, heartsheart, heartsRMvalentinevalentineQ##MValentine'svalentine's"P''Mheart, heartsheart, hearts$O))LNew Year's Evenew year's eveNLNYEnye$M))KNew Year's Evenew year's eveLJHanukkahhanukkahKIChristmaschristmas J%%Hthanksgivingthanksgiving I%%HThanksgivingthanksgiving H%%GThanksgivingthanksgiving G%%FThanksgivingthanksgiving*F//Ecapitol, capitolscapitol, capitols6E;;Egovernment, governmentsgovernment, governmentsDDsuntansuntanC!!DsuntanningsuntanningB!!Dsunbathingsunbathing "^Z=&kD'y`I8!s^^judgejudge~^gavelgavel}^hammerhammer|]detectivedetective{##\policewomanpolicewomanz\policemanpoliceman$y))\police officerpolice officerx\policepolicew\copcopv\deputydeputyu\sheriffsherifft##[policewomanpolicewomans[policemanpoliceman$r))[police officerpolice officerq[policepolicep[copcopo##ZpolicewomanpolicewomannZpolicemanpoliceman$m))Zpolice officerpolice officerlZpolicepolicekZcopcopjYfiremanfiremani##YfirefighterfirefighterhXnursenursegWphysicianphysician$f))Wmedical doctormedical doctoreWdoctordoctordVphysicianphysician$c))Vmedical doctormedical doctorbVdoctordoctora##Uparticipateparticipate`Ujoinjoin_##Tparticipateparticipate^Tjoinjoin F|%hO8! {F277htreatment, treatmentstreatment, treatmentsNSSgtherapist, therapiststherapist, therapists&++ghelper, helpershelper, helpers##finterpreterinterpreterhmmeinterpret, interprets, interpreting, interpretedinterpret, interprets, interpreting, interpreteddadviseradviserdcounselorcounselorcadvisingadvising!!ccounselingcounselingccounselcounselcadviceadvicebeffecteffect badviceadvice bcounselcounsel badviseadvise baffectaffect binfluenceinfluenceaserverserverawaitresswaitressawaiterwaiter&++`server, serversserver, serversTYY`service, services, servicing, servicedservice, services, servicing, servicedDII`serve, serves, serving, servedserve, serves, serving, served_chiefchief_coachcoach_bossboss D=\cD*$--jadminister, administers, administering, administeredadminister, administers, administering, administeredn#ssjrun, runs, running, ranrun, runs, running, ranH"MMjreign, reigns, reigning, reignedreign, reigns, reigning, reignedL!QQjhandle, handles, handling, handledhandle, handles, handling, handled\ aajregulate, regulates, regulating, regulatedregulate, regulates, regulating, regulated<AAjrule, rules, ruling, ruledrule, rules, ruling, ruledPUUjgovern, governs, governing, governedgovern, governs, governing, governedLQQjmanage, manages, managing, managedmanage, manages, managing, managed\aajcontrol, controls, controlling, controlledcontrol, controls, controlling, controlled277itherapist, therapiststherapist, therapists,11htherapy, therapiestherapy, therapies ?wFc. dE r?0755qmilitary, militariesmilitary, militaries$6))psuperintendentsuperintendent5ppresidentpresident>4CCopsychologist, psychologistspsychologist, psychologists&3++npsychologicallypsychologically"2''npsychologicalpsychological1!!npsychologypsychologyP0UUmintern, interns, interning, internedintern, interns, interning, interned6/;;minternship, internshipsinternship, internships.laid, aidsaid, aids-##laide, aidesaide, aides2,77lassistant, assistantsassistant, assistantsN+SSkregulator, regulatorsregulator, regulators^*cckadministrator, administratorsadministrator, administrators.)33kdirector, directorsdirector, directors.(33kdictator, dictatorsdictator, dictators"'''kruler, rulersruler, rulers6&;;kcontroller, controllerscontroller, controllers(%--kmanager, managermanager, manager G"sZG. nG$Q))ztravel by boattravel by boatPyboatingboatingOyboatboatNxtrappedtrappedMxstuckstuck*L//wcraving, cravingscraving, cravingsKwhungerhungerJ wdesire, desires, desiring, desireddesire, desires, desiring, desiredBIGGwwish, wishes, wishing, wishedwish, wishes, wishing, wishedHwhungryhungry G%%vstorystoryFvcommentcommentEvmessagemessageDuearnearnCucollectcollectBtdeservedeserveAtearnearn@sinterviewinterview?stalktalk>sconverseconverse=sdialoguedialogue<sdiscoursediscourseh;mmrinterview, interviews, interviewing, interviewedinterview, interviews, interviewing, interviewed*://qsoldier, soldierssoldier, soldiers 9%%qarmy, armiesarmy, armies 8%%qarmed forcesarmed forces WM6\|get inget in[|get onget on8Z;;{take a cruise, takes a cruise, taking a cruise, took a cruise, taken a cruise, take cruises, takes cruises, taking cruises, took cruises, taken cruisestake a cruise, takes a cruise, taking a cruise, took a cruise, taken a cruise, take cruises, takes cruises, taking cruises, took cruises, taken cruises`Ycc{go on a cruise, goes on a cruise, going on a cruise, went on a cruise, gone on a cruise, go on cruises, goes on cruises, going on cruises, went on cruises, gone on cruisesgo on a cruise, goes on a cruise, going on a cruise, went on a cruise, gone on a cruise, go on cruises, goes on cruises, going on cruises, went on cruises, gone on cruises&X++{cruise, cruisescruise, cruises>WCC{cruise liner, cruise linerscruise liner, cruise liners:V??{cruise ship, cruise shipscruise ship, cruise shipsU##{ship, shipsship, shipsTzboatingboatingSzboatboatR!!zgo by boatgo by boat Ll>! oXGiLwexcitedlyexcitedly&v++excite, excitesexcite, excitesuexcitingexcitingtexcitedexcited"s''long time agolong time agorlong agolong ago>qCChear, hears, hearing, heardhear, hears, hearing, heardpearearocreatecreatenfoundfoundmfromfromlset upset upkestablishestablishjcreatecreateifoundfoundhformformgset upset upfestablishestablishe~get, gets, getting, got, gottenget, gets, getting, got, gottenJdOO~reach, reaches, reaching, reachedreach, reaches, reaching, reachedLcQQ~arrive, arrives, arriving, arrivedarrive, arrives, arriving, arrivedb}deplanedeplanea}disembarkdisembark`}get outget out_}get offget off^|embarkembark]|boardboard Fx]l`C,r_F injuredinjured hurthurt scentscent smellsmell@ EEwait, waits, waiting, waitedwait, waits, waiting, waiteddrippingsdrippingsdrippingdrippinggravygravygreasygreasydeliciousdelicious&++cookie, cookiescookie, cookies.33laughter, laughterslaughter, laughtersTYYchortle, chortles, chortling, chortledchortle, chortles, chortling, chortledX]]snicker, snickers, snickering, snickeredsnicker, snickers, snickering, snickeredTYYchuckle, chuckles, chuckling, chuckledchuckle, chuckles, chuckling, chuckledL~QQgiggle, giggles, giggling, giggledgiggle, giggles, giggling, giggledH}MMlaugh, laughs, laughing, laughedlaugh, laughs, laughing, laughed|upcomingupcoming{followingfollowingznextnext6y;;excitement, excitementsexcitement, excitementsx!!excitinglyexcitingly &ZoZI2raF-X=" sZ3callouscallous2!!malevolentmalevolent1maliciousmalicious0spitefulspiteful/unkindunkind.cruelcruel-meanmean,amiableamiable+pleasantpleasant*friendlyfriendly&)++discombobulateddiscombobulated(!!confoundedconfounded'baffledbaffled&confusedconfused$%))discombobulatediscombobulate$confoundconfound#bafflebaffle"confuseconfuse!scramblescramble mixmixmadmadlividlividenragedenragedangryangry %%cantankerouscantankerousirritableirritabletestytestycrabbycrabbygrumpygrumpymadmadangryangrymadmadhurthurtinjuredinjuredinjuryinjurypainpainpainpaininjuryinjury HrKpU:ez[HMmissmissL!!disappointdisappointKthrillthrillJeventeventIwhat's upwhat's up>HCCdisagreement, disagreementsdisagreement, disagreements^Gccdisagree, disagrees, disagreeing, disagreeddisagree, disagrees, disagreeing, disagreed2F77agreement, agreementsagreement, agreementsTEYYconcur, concurs, concurring, concurredconcur, concurs, concurring, concurredFDKKagree, agrees, agreeing, agreedagree, agrees, agreeing, agreedCignorantignorantBcluelessclueless A%%know nothingknow nothing@##snob, snobssnob, snobs?snobbysnobby>snobbishsnobbish=stuck-upstuck-up<assertiveassertive*;//submissivesubmissive$:))passivepassive9truthfultruthful8truthtruth7honestlyhonestly6honesthonest5ruderude4viciousvicious %cubK0qV? sV;(vcrmoremoreqcoolcoolpneatneatoswellswellnneatneatmcoolcoolltouchtouchktouchedtouched j%%wholeheartedwholeheartedideepdeephprofoundprofoundgheartfeltheartfeltftouchingtouchingesick ofsick ofdtired oftired ofcover itover itboveroveradone withdone with`donedone_##fed up withfed up with^fed upfed up]dedicatededicate\##concentrateconcentrate[focusfocus"Z''satisficationsatisficationYsatisfiedsatisfiedXsatisfysatisfyWrelieverelieveVrelaxrelaxUrelievedrelievedTreliefreliefSsoursourRtarttartQbitterbitter$P))disappointmentdisappointmentOmissedmissed N%%disappointeddisappointed M^mL9 wR%y`Mlocolocobananasbananasloonyloonyloopyloopy cuckoocuckoo nutsnuts lunaticlunatic insaneinsane crazycrazylazylazy*//don't wanna do itdon't wanna do it"''not up for itnot up for it!!bored withbored withboreboreboredboredboringboringHMMthink, thinks, thinking, thoughtthink, thinks, thinking, thoughtabilityabilityableable~##possibilitypossibility}possiblepossible|maymay{!!can, couldcan, could^zccquestion mark symbol, question mark symbolsquestion mark symbol, question mark symbolsByGGquestion mark, question marksquestion mark, question marks.x33question, questionsquestion, questionswaboutaboutvdiscountdiscountulessenlessentlesslesssreducereduce &`tQ:hK4jY@+w`7stupidstupid6dumbdumb5dumbdumb4stupidstupid3stupidstupid2dumbdumb1!!ridiculousridiculous0foolishfoolish/sillysilly.timidtimid-bashfulbashful,shyshy+sweetsweet*diabeticdiabetic)sweetsweet(diabetesdiabetes'sweetssweets"&''sugar, sugarssugar, sugars%geniusgenius$giftedgifted#brightbright"brilliantbrilliant!cleverclever %%intelligenceintelligence##intelligentintelligentsmartsmartgeniusgeniusgiftedgiftedbrightbrightbrilliantbrilliantcleverclever %%intelligenceintelligence##intelligentintelligentsmartsmartuglyuglyfunnyfunnywackowackobonkersbonkers GmX'Q>)yd7 |G2T77sunscreen, sunscreenssunscreen, sunscreensSsunshinesunshine.R33daylight, daylightsdaylight, daylights.Q33sunlight, sunlightssunlight, sunlightsPsunsun*O//Frisbee, Frisbeesfrisbee, frisbees*N//frisbee, frisbeesfrisbee, frisbeesMclothclothLfabricfabricKlandlandJearthearthIsoilsoilHpropertypropertyGmaterialmaterialFsandsandEdrowndrownDdrowndrownCsinksink2B77lifeguard, lifeguardslifeguard, lifeguards2A77lifeguard, lifeguardslifeguard, lifeguards&@++surfer, surferssurfer, surfers@?EEsurf, surfs, surfing, surfedsurf, surfs, surfing, surfed.>33umbrella, umbrellasumbrella, umbrellas=eventevent<eventsevents&;++sunset, sunsetssunset, sunsets&:++sunset, sunsetssunset, sunsets9dumbdumb8stupidstupid UcP+n9_6) nUochargerchargernbatterybatterympowerpowerl##electricityelectricitykInternetinternetjinternetinternetiat signat signhat symbolat symbol g@@&f++e-mail, e-mailse-mail, e-mails"e''email, emailsemail, emails&d++laptop, laptopslaptop, laptopsc##technicallytechnically&b++technologicallytechnologicallyatechnicaltechnical"`''technologicaltechnological2_77technique, techniquestechnique, techniques8^==technology, technologiestechnology, technologies]worldwideworldwide\globallyglobally"[''world, worldsworld, worlds"Z''globe, globesglobe, globes"Y''world, worldsworld, worldsXgolfgolfJWOOsunblock, sunblockssunblock, sunblocks"V''suntan lotionsuntan lotion(U--sunscreen lotionsunscreen lotion Nf5|eH1hG*kN uploadinguploading uploadupload uploadinguploading downloaddownload ##downloadingdownloadingstreamstreamstreamingstreamingdownloaddownloadrecordingrecording##downloadingdownloadingdownloaddownload$))copy and pastecopy and paste %%copy & pastecopy & pastepastepastetapetape ~%%down paymentdown payment}depositdeposit|removeremove{eliminateeliminatezdeletedelete y%%conservationconservationxretentionretention w%%preservationpreservationvsavesave@uEEpost, posts, posting, postedpost, posts, posting, posted.t33password, passwordspassword, passwordsskickingkickingrsoccersoccerLqQQcharge, charges, charging, chargedcharge, charges, charging, chargedpelectricelectric 9aPoR9filmingfilmingrecordingrecording&++video recordingvideo recording %%video recordvideo recordvideoingvideoing6;;videotaping, videotapedvideotaping, videotaped>CCvideo, videosvideo, videos277videotape, videotapesvideotape, videotapes"''video, videosvideo, videosbggresearch, researches, researching, researchedresearch, researches, researching, researchedNQQsend a text, sends a text, sending a text, sent a text, send texts, sends texts, sending texts, sent textssend a text, sends a text, sending a text, sent a text, send texts, sends texts, sending texts, sent texts@EEtext, texts, texting, textedtext, texts, texting, textedswitchswitchtransfertransferpostpostuploadupload TuDu&kV?,yT"9''Olympic Gamesolympic games8Olympicsolympics>7CCwrestle, wrestles, wrestledwrestle, wrestles, wrestled6wrestlingwrestling5!!volleyballvolleyball4softballsoftball3ballball2sportssports1tracktrack0sportssports/runrun.contestcontest-##competitioncompetition,competecompete+racerace**//Android, Androidsandroid, androidsL)QQgoogle, googles, googling, googledgoogle, googles, googling, googled(Googlegoogle'YouTubeyoutube&YouTubeyoutube%Instagraminstagram$FBfb#Facebookfacebook."33fullback, fullbacksfullback, fullbacks.!33follower, followersfollower, followersP UUfollow, follows, following, followedfollow, follows, following, followedS & Ms & m %%social mediasocial media "nr[H+ uZ?( u@! }n [$1$1Za dollara dollarY1 dollar1 dollarX!!one dollarone dollarWmetalmetal"V''fashion modelfashion modelUmodelmodelT!!gymnasticsgymnastics2S77lifeguard, lifeguardslifeguard, lifeguardsRconserveconserveQretainretainPpreservepreserveOsavesaveNmoremore"M''email, emailsemail, emailsLfootballfootballKthanksthanksJthankfulthankfulIgratefulgratefulH!!water polowater polo"G''complimentarycomplimentaryFfreefreeE!!redemptionredemptionD##deliverancedeliveranceC!!liberationliberationBsalvationsalvationAfreefree@redeemredeem?deliverdeliver>rescuerescue=liberateliberate<savesave;boxingboxing:Olympicolympic !qb?"wR5&}hU<# "|'' alien, aliensalien, aliens{ actingactingz!! performingperformingy performperformx theatretheatrew theatertheaterv skitskitu dramadramat showshows actactr playplayq## performanceperformance p$8$8o8 dollars8 dollars"n''eight dollarseight dollars m$7$7l7 dollars7 dollars"k''seven dollarsseven dollars j$6$6i6 dollars6 dollarsh##six dollarssix dollars g$5$5f5 dollars5 dollars e%%five dollarsfive dollars d$4$4c4 dollars4 dollars b%%four dollarsfour dollars a$3$3`3 dollars3 dollars"_''three dollarsthree dollars ^$2$2]2 dollars2 dollars\##two dollarstwo dollars oF!~cD!aF/ o1¢1¢a centa centone centone centpennypennycentscentscentcentinterludeinterlude %%intermissionintermissionrecessrecesshalftimehalftime !!break timebreak time breakbreak %%biologicallybiologically biologicbiologic !!biologicalbiological,11biology, biologiesbiology, biologies %%bass, bassesbass, basses!!basketballbasketballbaseballbaseball artart drawingdrawing drawdraw"'' altar, altarsaltar, altars>CC architecture, architecturesarchitecture, architectures"'' angel, angelsangel, angelsN~SS extraterrestrial, extraterrestrialsextraterrestrial, extraterrestrialsf}kk extraterrestrial being, extraterrestrial beingsextraterrestrial being, extraterrestrial beings IjO. xAvQ$s`I0rhythmrhythm/beatbeat.##complementscomplements-!!complementcomplement,clappingclapping+clapclap@*EEchoreography, choreographieschoreography, choreographies*)//choreographicallychoreographically"(''choreographicchoreographicx'}}choreograph, choreographs, choreographing, choreographedchoreograph, choreographs, choreographing, choreographed&!!chemicallychemically.%33chemical, chemicalschemical, chemicals4$99chemistry, chemistrieschemistry, chemistries#!!satisfyingsatisfying "%%satisfactionsatisfaction!blanketblanket cheerledcheerledcheerleadcheerlead %%cheerleadingcheerleading##cheerleadercheerleadercheerledcheerledcheerleadcheerlead %%cheerleadingcheerleading##cheerleadercheerleader277character, characterscharacter, characters 9dqH s\9 ?%%!earth, Earthearth, earth> dollardollar:=??development, developmentsdevelopment, developmentsX<]]develop, develops, developing, developeddevelop, develops, developing, developed:;??development, developmentsdevelopment, developments&:++growth, growthsgrowth, growthsX9]]develop, develops, developing, developeddevelop, develops, developing, developed@8EEboom, booms, booming, boomedboom, booms, booming, boomedn7ssthrive, thrives, thriving, thrived, throve, thriventhrive, thrives, thriving, thrived, throve, thriven\6aaincrease, increases, increasing, increasedincrease, increases, increasing, increased5dancerdancer&4++course, coursescourse, coursesB3GGcommunication, communicationscommunication, communicationst2yycommunicate, communicates, communicating, communicatedcommunicate, communicates, communicating, communicated"1''cloud, cloudscloud, clouds [pQ.xcH3 vW0["\''/point, pointspoint, points"[''.point, pointspoint, points>ZCC-playa, playasplaya, playas&Y++-player, playersplayer, playersX##,moon, moonsmoon, moons$W))+linguisticallylinguisticallyV!!+linguisticlinguisticU##+linguisticslinguisticsT*hip-hophip-hopS##)hell, hellshell, hells"R''(group, groupsgroup, groupsQ'tribetribeP'teamteamO'batchbatchN'classclassM'categorycategoryL'groupgroupK&god, godsgod, godsJ&GodgodI%legallegalH%law, lawslaw, laws,G11$fantasy, fantasiesfantasy, fantasies$F))#fairy, fairiesfairy, fairies E%%"economicallyeconomicallyD!!"economicaleconomicalC"economiceconomicB"economicseconomics,A11"economy, economieseconomy, economies&@++!planet, planetsplanet, planets 6qP3G&h?s6:p??211th grader, 11th graders11th grader, 11th gradersJoOO2eleventh grader, eleventh graderseleventh grader, eleventh gradersn!!211th grade11th grade$m))2eleventh gradeeleventh grade6l;;2third-year, third-yearsthird-year, third-years&k++2junior, juniorsjunior, juniors:j??110th grader, 10th graders10th grader, 10th graders>iCC1tenth grader, tenth graderstenth grader, tenth gradersh!!110th grade10th gradeg##1tenth gradetenth gradef##1soph, sophssoph, sophs:e??1second-year, second-yearssecond-year, second-years2d771sophomore, sophomoressophomore, sophomores6c;;09th grader, 9th graders9th grader, 9th graders>bCC0ninth grader, ninth gradersninth grader, ninth gradersa09th grade9th grade`##0ninth gradeninth grade$_))0frosh, froshesfrosh, froshes6^;;0first-year, first-yearsfirst-year, first-years,]110freshman, freshmenfreshman, freshmen 8uV n?|a8&++:singer, singerssinger, singers.33:musician, musiciansmusician, musicians##9mathematicsmathematics9mathmath<AA8rap, raps, rapping, rappedrap, raps, rapping, rappedtyy7rock and roll, rock 'n' roll, rock n roll, rock & rollrock and roll, rock 'n' roll, rock n roll, rock & roll~!!7rocky roadrocky road.}337railroad, railroadsrailroad, railroads$|))6scientificallyscientifically{!!6scientificscientific*z//6science, sciencesscience, sciences,y115history, historieshistory, histories:x??4human being, human beingshuman being, human beings"w''4human, humanshuman, humans:v??312th grader, 12th graders12th grader, 12th gradersFuKK3twelfth grader, twelfth graderstwelfth grader, twelfth graderst!!312th grade12th grade"s''3twelfth gradetwelfth grade:r??3fourth-year, fourth-yearsfourth-year, fourth-years&q++3senior, seniorssenior, seniors TnS2sDb5wT %%Gwolf, wolveswolf, wolvesFkind ofkind ofFtype oftype ofFkindkindFtypetype>CCEvocalization, vocalizationsvocalization, vocalizations"''Evoice, voicesvoice, voices*//Dunicorn, unicornsunicorn, unicorns*//Cvampire, vampiresvampire, vampires##BuniversallyuniversallyBcosmiccosmic277Buniversal, universalsuniversal, universalsBcosmoscosmos.33Buniverse, universesuniverse, universes,11Apenalty, penaltiespenalty, penalties6;;Apunishment, punishmentspunishment, punishmentsRWWApunish, punishes, punishing, punishedpunish, punishes, punishing, punished. 33@asterisk, asterisksasterisk, asterisks ##@star, starsstar, stars ?time outtime out ?toptop >sunsun##=team, teamsteam, teams<societysociety<sociologysociology;physicsphysics vuV1vAjQ8v:Nsoulsoul9!!Napparitionapparition8Nphantomphantom7Nspecterspecter6Nghostghost5Nspiritspirit4Msoulsoul3!!Mapparitionapparition2Mphantomphantom1Mspecterspecter0Mghostghost/Mspiritspirit2.77Lgo up in school yearsgo up in school years6-;;Lgo through school yearsgo through school years:,??Lthrough high school yearsthrough high school years2+77Lthrough college yearsthrough college years,*11Lup in school yearsup in school years0)55Lthrough school yearsthrough school years (%%Kfield hockeyfield hockey'!!Kice hockeyice hockey&Khockeyhockey"%''Jminor, minorsminor, minors$!!Ispecializespecialize#Hstraightstraight"Hfieldfield!Hmajormajor Hmainmain055Gwerewolf, werewolveswerewolf, werewolves L}X5{J%{^;eLX^millionmillionW]billionsbillionsV]billionbillionU\hippieshippiesT\hippiehippieS[creaturecreatureR[beastbeastQ[monstermonster&P++Zsilver, silverssilver, silvers O%%YsnowboardingsnowboardingNYsnowboardsnowboardM##XmischievousmischievousLXevilevilKXdemondemonJXdevildevil$I))Wwitch, witcheswitch, witches"H''Vstage, stagesstage, stages"G''Ustage, stagesstage, stages.F33Uplatform, platformsplatform, platformsE##Uflat on topflat on topDUflatflat&C++Tplanet, planetsplanet, planetsBSpopularpopularA!!Rprofessionprofession"@''Rprofessionalsprofessionals ?%%Rprofessionalprofessional">''Qsocial workersocial worker=##Qsocial worksocial work&<++Pheaven, heavensheaven, heavens6;;;Omicrophone, microphonesmicrophone, microphones #ejS:% |kX?cJ/e {%%odiscriminatediscriminatezocorrectcorrectyocritiquecritiquexocancelcancelwncheapcheapvmpriceypriceyumexpensiveexpensivetlbodybodyskmillionsmillionsrkmillionmillionq!!j1 thousand1 thousand p%%jone thousandone thousando!!ja thousanda thousandniguardianguardianmiguardguardHlMMhguard, guards, guarding, guardedguard, guards, guarding, guardedkgceramicceramicjfclayclayiearmarmhdbehindbehindgdbackbackfcbehindbehindecbackbackd!!bprotectionprotectioncbdefendantdefendantbbdefensedefenseaaguardguard`aprotectprotect_adefenddefend^!!`protectionprotection]_guardguard\_protectprotect[_preventpreventZ_blockblockY^millionsmillions '[qB)xeP?,rYF1v["terribleterrible!awfulawful chargechargepricepricecostcost~combcomb~brushbrush}brushbrush}combcomb|poisonpoison|bonesbones|bonebone{balloonballoonzbackyardbackyardyranchranchyfarmingfarmingyfarmfarmxuncleanuncleanxfilthyfilthyxdirtydirtywplasticplastic vlegslegs vlegleg ustiffstiff tnosenose sallergicallergicsallergyallergy##rprosecutionprosecutionrprosecuteprosecuterlawsuitlawsuitrsuingsuingrsuesueragainstagainst,11qseventy-five centsseventy-five centsq75¢75¢##phalf dollarhalf dollar~##pfifty centsfifty cents}p50¢50¢$|))odiscriminationdiscrimination &XpWB+ tW<xgTA0mXHworksworksGworkworkFpahpahEfinallyfinallyDfewfewCseveralseveralBclose byclose byAnear bynear by@closeclose?nearnear>fewfew=feetfeet<eyeseyes;earear:diversediverse9diversitydiversity$8))discriminatingdiscriminating 7%%discriminatediscriminate$6))discriminationdiscrimination5dinosaursdinosaurs4dinosaurdinosaur3dinosaursdinosaurs2dinosaurdinosaur110¢10¢0ten centsten cents/dimedime.!!decoratingdecorating-decoratedecorate,!!decorationdecoration+circuscircus*clownclown)centralcentral(centercenter'middlemiddle&middlemiddle%centralcentral$centercenter#horriblehorrible khU>)b-RkRaWWnotify, notifies, notifying, notifiednotify, notifies, notifying, notified<`AAtell, tells, telling, toldtell, tells, telling, toldP_UUinform, informs, informing, informedinform, informs, informing, informed*^//a lot of, lots ofa lot of, lots of]##a lot, lotsa lot, lots\muchmuch[!!supportivesupportiveXZ]]support, supports, supporting, supportedsupport, supports, supporting, supported2Y77hairspray, hairsprayshairspray, hairspraysHXMMspray, sprays, spraying, sprayedspray, sprays, spraying, sprayedW1/21/2Va halfa halfUone halfone halfThalfhalfShatehateRloveloveQclothclothPnapkinnapkinOhirehireNinviteinviteMwelcomewelcomeLsucceededsucceededKsucceedssucceedsJsucceedsucceedIworkedworked c, h?Xcn##informationinformation~mshare, shares, sharing, sharedshare, shares, sharing, sharedPlUUreport, reports, reporting, reportedreport, reports, reporting, reportedRkWWnotify, notifies, notifying, notifiednotify, notifies, notifying, notifiedgCCnotification, notificationsnotification, notificationsf##informationinformation>eCCnotification, notificationsnotification, notificationsd##informationinformation~cshare, shares, sharing, sharedshare, shares, sharing, sharedPbUUreport, reports, reporting, reportedreport, reports, reporting, reported "Lv[B%sZ?* g6mL##distruptivedistruptivemess upmess updisruptdisrupt cosmeticcosmetic cosmeticscosmetics" ''put on makeupput on makeup %%apply makeupapply makeup makeupmakeup.33Lutheran, Lutheranslutheran, lutherans*//leather, leathersleather, leathers!!industrialindustrialindustryindustryhunthunthuntinghuntingboldboldconfidentconfidentbravebravestrengthstrength~healthyhealthy}healthhealth|mendmend{curecurez!!get betterget betteryget wellget wellxhealhealwhandhandvhandshandsugraveyardgraveyardtcemetrycemetryscemeterycemeteryrgraveyardgraveyardqgravesgravespgravegrave>oCCnotification, notificationsnotification, notifications &ZlK4ydIu`I0sZ6receivereceive5getget4stinkstink3stinkystinky2smellysmelly1smellysmelly0stinkstink/weirdweird.battlebattle-warwar,silencesilence+silentsilent*quietquiet)strengthstrength(strongstrong'weirdweird&bizarrebizarre%peculiarpeculiar$oddodd#strangestrange,"11a pair of scissorsa pair of scissors!scissorsscissors marchmarchparadeparade##suppressionsuppression!!oppressionoppressionsuppresssuppressoppressoppress5¢5¢!!five centsfive centsnicklenickle##neck, necksneck, necks&++muscle, musclesmuscle, musclesmouthmouthchaoticchaoticmessymessychaoschaosmessmess xVCjQ4kN7xzRbrush teeth, brushes teeth, brushing teeth, brushed teethbrush teeth, brushes teeth, brushing teeth, brushed teeth Q%%consort withconsort withP!!fraternizefraternizeOminglemingleNsocializesocializeMinteractinteractLLQQsneeze, sneezes, sneezing, sneezedsneeze, sneezes, sneezing, sneezedK##skin, skinsskin, skins J%%tap shouldertap shoulderIshouldershoulderHwash hairwash hairGshampooshampooFwealthywealthyErichrichDwealthywealthyCrichrichBrelaxrelaxArestrest@quarterquarter?25¢25¢*>//twenty-five centstwenty-five cents=poorpoor&<++pillow, pillowspillow, pillows;sexsex:gendergender&9++pillow, pillowspillow, pillows8plasticplastic7rubberrubber #_s`K2|_N;&r[B% z_u1 dollar1 dollart!!one dollarone dollarscovenantcovenantroathoathqguaranteeguaranteeppledgepledgeovowvownpromisepromisemintentionintentionlpurposepurposekintendintendjmeaningmeaningimeanmean6h;;toothpaste, toothpastestoothpaste, toothpastesg!!successfulsuccessfulfsuccesssuccessesoakedsoakeddmoistmoistcdampdampbwetwetavariationvariation`varietyvariety_variousvarious&^++delicatedelicate*]//vulnerablevulnerable\flimsyflimsy[feeblefeebleZfragilefragileYfrailfrailXweakweakWcostcostVpricepriceUworthworthTvaluevalue8S==toothbrush, toothbrushestoothbrush, toothbrushes Urc^A2xSD#dU $8$88 dollars8 dollars"''eight dollarseight dollars $7$77 dollars7 dollars"''seven dollarsseven dollars $6$6 6 dollars6 dollars ##six dollarssix dollars $5$5" ''5 dollar bill5 dollar bill( --five dollar billfive dollar bill5 dollars5 dollars %%five dollarsfive dollars $4$44 dollars4 dollars %%four dollarsfour dollars $3$33 dollars3 dollars"''three dollarsthree dollars $2$2"''2 dollar bill2 dollar bill&~++two dollar billtwo dollar bill}2 dollars2 dollars|##two dollarstwo dollarsB{GGsingle, singlessingle, singles z$1$1"y''a dollar billa dollar bill"x''1 dollar bill1 dollar bill&w++one dollar billone dollar billva dollara dollar EtjAiB`E-thousandthousandL,QQsneeze, sneezes, sneezing, sneezedsneeze, sneezes, sneezing, sneezed+!!congestioncongestion*coughscoughs)coughingcoughing(coughcough*'//abdomen, abdomensabdomen, abdomens$&))belly, belliesbelly, bellies*%//stomach, stomachsstomach, stomachs$!!supportivesupportiveX#]]support, supports, supporting, supportedsupport, supports, supporting, supported."33Lutheran, Lutheranslutheran, lutherans&!++lotion, lotionslotion, lotions ##mischievousmischievousevilevildemondemondevildevil##mischievousmischievoustoptoptime outtime out\aapurchase, purchases, purchasing, purchasedpurchase, purchases, purchasing, purchased:??buy, buys, buying, boughtbuy, buys, buying, bought $9$99 dollars9 dollars %%nine dollarsnine dollars b`C"-rW@-ybMassumeassumeLguessguessKteateaJvotevoteIelectionelectionHelectelectGvotevoteFpoliticalpoliticalEpoliticspoliticsDbestbestCbetterbetterBup untilup untilAup toup to@up tillup till?tilltill>tiltil=untiluntil<whilewhile;duringduring:jokejoke9teaseteaseh8mmdisregard, disregards, disregarding, disregardeddisregard, disregards, disregarding, disregardedL7QQignore, ignores, ignoring, ignoredignore, ignores, ignoring, ignored86==toothbrush, toothbrushestoothbrush, toothbrushes5##skin, skinsskin, skins4no matterno matter$3))doesn't matterdoesn't matter2whateverwhatever1anywayanyway0pahpah/finallyfinally.thousandsthousands (`taH+q\G2|cF' w`usuffersuffertkickkickslistlistrlessonlessonqheavyheavypheavyheavyoweightweightnweighweighmskepticalskepticall!!suspicioussuspiciousksuspectedsuspectedjsuspectsuspecticoursecoursehlistlistglessonlessonftalktalke!!discussiondiscussionddiscussdiscusscissueissuebquotequoteathemetheme`topictopic_themetheme^quotequote]strikestrike\rebellionrebellion[revoltrevoltZrebelrebelYbypassbypassXgo bygo byWgo pastgo pastVmove pastmove pastUpass bypass byTpasspassSbanbanRforbiddenforbiddenQforbidforbidPillegalillegalOmissmissNestimateestimate #YnY>+/u^I.nYalteralteradaptadaptadjustadjusttransformtransformmodifymodifychangechangeruinruintotaledtotaleddismantledismantledemolishdemolishwreckwreck damagedamage ##destructiondestruction destroydestroy feudfeud brawlbrawlquarrelquarrelarguearguefightfightclashclashZ__(long horizontal rectangular flat object)(long horizontal rectangular flat object)&++(legs together)(legs together)"''queen, queensqueen, queens##king, kingsking, kingsperspireperspiresweatsweat~loselose}take offtake off|lowerlower{decreasedecreasezgaingainyraiseraisexadd onadd onwincreaseincreasevsufferingsuffering (^~iVC* uTA*dC2 s^@spicyspicy?seriousserious>tarttart=bitterbitter<soursour;cupcakecupcake:muffinmuffin9cakecake8cakecake7cakecake6piepie5##bowl, bowlsbowl, bowls"4''knife, knivesknife, knives3##alarm clockalarm clock2alarmalarm1ringingringing0bellbell/forkfork.frozenfrozen-frozefroze,freezefreeze+warmwarm*## temperaturetemperature) windwind&(++ flower, flowersflower, flowers' riskrisk& dangerousdangerous% dangerdanger$ snowsnow#!!light rainlight rain"drizzledrizzle!snowsnow rainrainearthearthsoilsoilgroundgroundlandlanddreamingdreamingdreamdreamamendamend #cnK4#f=jO:#zcc$enoughenoughb#oneone a#11`"NaClnacl&_++"sodium chloridesodium chloride^!!"table salttable salt]"saltsalt\!run afterrun after[!pursuepursueZ!chasechaseY run awayrun awayX retreatretreatW escapeescapeVpromprom.U33sidewalk, sidewalkssidewalk, sidewalksTcementcementSconcreteconcrete*R//boulder, bouldersboulder, boulders&Q++pebble, pebblespebble, pebblesP##rock, rocksrock, rocks"O''stone, stonesstone, stonesNendangerendangerMdangerdangerLthreatenthreatenKthreatthreatJriskriskIbugbugHinsectinsect G%%flameflame F%%candle flamecandle flameEcandlecandleDbarbequebarbequeCbarbecuebarbecueBBBQbbqAhothot $\kD)}lYB1s^O@)o\6meetmeet5meet memeet me5meetmeet4meet youmeet you4meetmeet %%3all the timeall the time3alwaysalways2eleveneleven 21111~1eleveneleven }11111 |0atat{0theretherez##0on the lefton the lefty0veer leftveer leftx0go leftgo leftw/redredv.redredu-tell metell met,telltells+tell metell mer*oneoneq)desiredesirep)wantwanto(youyou@nEE'call, calls, calling, calledcall, calls, calling, called+pWH7$v 5Iinin 4Hatat3Htherethere2Hthethe1Hthisthis0Hthatthat/Hthemthem.Hherher-Hhimhim ,Hitit+Htheythey*Hsheshe )Hhehe(Geveningevening'Gnightnight&Fscorescore%Fcountscounts$Fcountcount#Eharehare"Ebunnybunny!Erabbitrabbit DfreshfreshDnewnewChugehugeClargelargeCbigbigBsmallsmall AGg @Gg ?Gg >Gg =Gg <Gg;zerozero;00;ohoh ;Oo:zerozero:009duplicateduplicate 9copycopy ##8imitate youimitate you 8copy youcopy you !!7imitate meimitate me 7copy mecopy me6meet youmeet you (dnWD1 dQ:'sX9 d ]%%Vyoursyours\Vtheirstheirs[VhershersZ##VyouryourYVitsitsXVtheirtheirWVherherVVhishisU!!UmotorcyclemotorcycleT!!TmotorcyclemotorcycleSShurry uphurry upRSrushrushQShurryhurryPRhurry uphurry upORrushrushNRhurryhurryMQhas tohas toLQhave tohave toKQneed toneed toJQmustmustIQshouldshouldHQneedneedG##Psupposed tosupposed toFPought toought toEPneed toneed toDPoughtoughtCPshouldshouldBPneedneedAOhomehome@Nhomehome?Mhomehome>Lhomehome=Khomehome<Jalwaysalways;Jisolatedisolated:Jisolateisolate9Jalonealone8Jsomesome7Jsomethingsomething6Jsomeonesomeone Cj+r[@%$C>pCC[go, goes, going, went, gonego, goes, going, went, gone\oaa[go to, goes to, going to, went to, gone togo to, goes to, going to, went to, gone to>nCCZgo, goes, went, going, gonego, goes, went, going, gone\maaZgo to, goes to, going to, went to, gone togo to, goes to, going to, went to, gone tol!!Yone minuteone minutekY1 minute1 minutejYa minutea minuteiYmomentmomenthYminuteminuteg!!Xone minuteone minutefX1 minute1 minuteeXa minutea minutedXmomentmomentcXminuteminuteRbWWWcaress, caresses, caressing, caressedcaress, caresses, caressing, caressedJaOOWstroke, strokes, stroking, stokedstroke, strokes, stroking, stoked<`AAWpet, pets, petting, pettedpet, pets, petting, pettedP_UUWsummon, summons, summoning, summonedsummon, summons, summoning, summoned@^EEWcall, calls, calling, calledcall, calls, calling, called U`tcJ9  k tU !!ipermissionpermission ipermitpermit iletletiallowallow,11haddress, addressesaddress, addressesgmissionmissionggoalgoal\aafpurchase, purchases, purchasing, purchasedpurchase, purchases, purchasing, purchased:??fbuy, buys, buying, boughtbuy, buys, buying, boughteeleveneleven e1111deleveneleven d1111~cmeet memeet me}cmeetmeet|bjoggingjogging{bjogjogzbrunningrunningybrunrunxacomecomew`comecomev_comecomeu^comecome>tCC]go, goes, going, went, gonego, goes, going, went, gone\saa]go to, goes to, going to, went to, gone togo to, goes to, going to, went to, gone to>rCC\go, goes, going, went, gonego, goes, going, went, gone\qaa\go to, goes to, going to, went to, gone togo to, goes to, going to, went to, gone to GnO2oT5-fG&!!tfrustratedfrustrated%##tfrustrationfrustration:$??sfrustration, frustrationsfrustration, frustrations"#''rthwartthwart""''rbafflebaffle!!!rfrustratedfrustratedd iiqfrustrate, frustrates, frustrating, frustratedfrustrate, frustrates, frustrating, frustrated.33pdecision, decisionsdecision, decisionsLQQpdecide, decides, deciding, decideddecide, decides, deciding, decided##obreak apartbreak apart!!ofall apartfall apartomeltdownmeltdownobreakdownbreakdownocollapsecollapsencatch upcatch upmcar crashcar crash %%mcar accidentcar accidentmaccidentaccidentmcrashcrashmcollisioncollision!!lin back ofin back oflbehindbehindlbackupbackupkvanishvanishkdisappeardisappear jshow upshow up jappearappear #_|cN;,yjQ8mL3 _I##}preparationpreparationH|planningplanningG|plansplans F%%|put in orderput in orderE|organizeorganizeD|arrangearrangeC|prepareprepareB|planplanA{executeexecute@##{assassinateassassinate ?%%{put to deathput to death>{massacremassacre={slaughterslaughter<{murdermurder;{killkill:!!zimpossibleimpossible$9))ysupposesuppose8ywhat ifwhat if7ywhetherwhether 6yifif$5))xsupposesuppose4xwhat ifwhat if3xwhetherwhether 2xifif1wifsifs0##wwhenwhen/wwhetherwhether .wifif-vopenopen,vbroadbroad+voveralloverall*vgenerallygenerally)vgeneralgeneral*(//ufuneral, funeralsfuneral, funerals'##tfrustratingfrustrating ![}`G0aNoR/x[j7 o'clock7 o'clocki6:006:00h##six o'clocksix o'clockg6 o'clock6 o'clockf5:005:00 e%%five o'clockfive o'clockd5 o'clock5 o'clockc4:004:00 b%%four o'clockfour o'clocka4 o'clock4 o'clock`3:003:00_3 o'clock3 o'clock"^''three o'clockthree o'clock]2:002:00\##two o'clocktwo o'clock[2 o'clock2 o'clock6Z;;sit, sits, sitting, satsit, sits, sitting, satY1:001:00X##one o'clockone o'clockW1 o'clock1 o'clock&V++ticket, ticketsticket, ticketsUremodelremodelTrenovaterenovateSdifficultdifficultRenigmaenigmaQpuzzlepuzzlePproblemproblemO~difficultdifficultN~enigmaenigmaM~puzzlepuzzleL~problemproblemK}planningplanningJ##}arrangementarrangement ![sV3 pQ*sV1x[ 6 o'clock6 o'clock 5:005:00 %%five o'clockfive o'clock5 o'clock5 o'clock4:004:00 %%four o'clockfour o'clock4 o'clock4 o'clock3:003:00"''three o'clockthree o'clock3 o'clock3 o'clock2:002:00##two o'clocktwo o'clock2 o'clock2 o'clock~1:001:00}##one o'clockone o'clock|1 o'clock1 o'clock{12:0012:00$z))twelve o'clocktwelve o'clocky!!12 o'clock12 o'clockx11:0011:00$w))eleven o'clockeleven o'clockv!!11 o'clock11 o'clocku10:0010:00t##ten o'clockten o'clocks!!10 o'clock10 o'clockr9:009:00 q%%nine o'clocknine o'clockp9 o'clock9 o'clocko8:008:00"n''eight o'clockeight o'clockm8 o'clock8 o'clockl7:007:00"k''seven o'clockseven o'clock "lwZ5"z[4_L7$l-sprinklesprinkle,pouringpouring+pourpour*gratinggrating)grategrate(flipflip'flip overflip over&dicedice%chopchop$sliceslice#stirstir<"AAbake, bakes, baking, bakedbake, bakes, baking, baked!mashmash boilboil12:0012:00$))twelve o'clocktwelve o'clock!!12 o'clock12 o'clock11:0011:00$))eleven o'clockeleven o'clock!!11 o'clock11 o'clock10:0010:00##ten o'clockten o'clock!!10 o'clock10 o'clock9:009:00 %%nine o'clocknine o'clock9 o'clock9 o'clock8:008:00"''eight o'clockeight o'clock8 o'clock8 o'clock7:007:00"''seven o'clockseven o'clock7 o'clock7 o'clock 6:006:00 ##six o'clocksix o'clock %YlWD/kR=&kR3  nYRSpainspainQEnglishenglishPEnglandenglandOfrenchfrenchNFrenchfrenchMFrancefranceLsouthsouthKthisthisJdowndownICubacubaH!!do errandsdo errandsGerrandserrands4F99cruising aroundcruising around E%%drove arounddrove around$D))driving arounddriving around C%%drive arounddrive aroundBmellowmellowAcasualcasual@chillchill?relaxedrelaxed>low-keylow-key =%%take it easytake it easy<washedwashed;washingwashing:washeswashes9washwash8dealtdealt7dealingdealing6dealsdeals5dealdeal4cardscards3scoopscoop2roll uproll up1rollroll0spread onspread on/spreadspread.!!sprinklingsprinkling Q}dI* gT?*mN5QVCvc##two hundredtwo hundred200200 %%nine minutesnine minutes9 minutes9 minutes"''eight minuteseight minutes8 minutes8 minutes"''seven minutesseven minutes7 minutes7 minutes##six minutessix minutes6 minutes6 minutes %%five minutesfive minutes 5 minutes5 minutes %%four minutesfour minutes 4 minutes4 minutes" ''three minutesthree minutes3 minutes3 minutes##two minutestwo minutes2 minutes2 minutesa milliona million $`yhW6%r]F1 yfI& `&H++are you finish?are you finish?Gfinish?finish?"F''are you done?are you done?Edone?done?*D//are you finished?are you finished?Cfinished?finished? B%%waterwaterApour intopour into@pourpour?cleaningcleaning>cleanedcleaned=cleanscleans<cleanclean;dusteddusted:dustingdusting9dustsdusts8dustdust7wipedwiped6wipingwiping5wipeswipes4wipewipe3lovelove 2%%five hundredfive hundred1500500 0%%four hundredfour hundred/400400".''three hundredthree hundred-300300,##two hundredtwo hundred+200200*dayday)FCfc (%%nine hundrednine hundred'900900"&''eight hundredeight hundred%800800 Q]L5wN%b/dQgriserisefemergencyemergencyehurricanehurricanedfogfogcall overall overbweddingwedding"a''rollercoasterrollercoaster$`))roller coasterroller coaster0_55riding rollercoasterriding rollercoaster,^11ride rollercoasterride rollercoaster2]77riding roller coasterriding roller coaster.\33ride roller coasterride roller coaster[(head)(head)Z(feet)(feet)&Y++(legs extended)(legs extended)&X++(legs standing)(legs standing)W##(leg pairs)(leg pairs)VpaypayUpayingpayingTcabincabinSAirbnbairbnbRmotelmotelQflying toflying toPflyingflyingOfly tofly toNflyfly"M''take train totake train to"L''train ride totrain ride toK!!take traintake trainJ!!ride trainride trainIworkshopworkshop !_o\AjU: sV3|_OTotovertimeovertimedropdropbreakupbreakupbreakupbreakupwalletwallet %%"spewing up""spewing up""spewing""spewing" %%"gushing up""gushing up""gushing""gushing".~33(gushing up object)(gushing up object)}spiralingspiraling|risingrising{radiatorradiatorzdeflatedeflateyflatflatxdeflateddeflatedwfracturefracturevcrackcrackucrackedcrackedt!!lights outlights out$s))all lights offall lights offrturn offturn offqshutdownshutdownp!!power downpower down o%%power outagepower outagenblackoutblackoutmfirefire&l++go up in flamesgo up in flameskburn upburn upjflare upflare upishoot upshoot uphrise uprise up Rr_HmP5|W*mR& terribleterrible% awfulawful$ "drip""drip"0#55 (dripping substance)(dripping substance)0"55 (air blowing object)(air blowing object)(!-- (shining object)(shining object)* // (spraying object)(spraying object)"'' "spewing out""spewing out" "spewing""spewing""'' "gushing out""gushing out" "gushing""gushing"8== (gushing forward object)(gushing forward object)!! "escaping""escaping" "escape""escape" "leaking""leaking" "leak""leak" "running""running" "run""run"!! "draining""draining" "drain""drain".33 (leaking substance)(leaking substance)&++ (mass movement)(mass movement) beheadbehead firefire firedfired  layofflayoff  waivewaive  dismissdismiss  laid offlaid off  lay offlay off jlU4aN5"gL-jD!! VenezuelanvenezuelanC VenezuelavenezuelaB vibratorvibratorA vibratingvibrating@ vibratevibrate? vibrationvibration> vitaminvitamin=!! retirementretirement< positivepositive ;%% afterafter:## whenwhen*9// afterwardsafterwards8## nextnext&7++ and thenand then6 pearpear5 mustardmustard4 mayomayo3!! mayonnaisemayonnaise2 what agewhat age1 how oldhow old:0?? grandparent, grandparentsgrandparent, grandparents / atat. therethere-!! go forwardgo forward,## go straightgo straight+ Eastereaster**// newborn, newbornsnewborn, newborns&)++ infant, infantsinfant, infants (%% baby, babiesbaby, babies' horrifichorrific NlS.|K.dE"mN`!! $their turntheir turn"_'' #South Africansouth african ^%% #South Africasouth africa"]'' "South Africansouth african \%% "South Africasouth africa"['' !South Africansouth african Z%% !South Africasouth africaY!! sour creamsour creamX New Yearnew yearW new yearnew yearV New Yearsnew yearsU!! New Year'snew year's,T11 listening to musiclistening to music&S++ listen to musiclisten to musicR blueberryblueberry.Q33 Deaf Awareness Weekdeaf awareness week"P'' mostlymostly"O'' predominantlypredominantlyN mainlymainlyM## improvementimprovementL improveimproveK halveshalves"J'' half and halfhalf and halfI ketchupketchupH pepperpepperG picnicpicnicF!! tournamenttournamentDEII taste, tastes, tasting, tastedtaste, tastes, tasting, tasted )ahQ:)o +offoffn *kibblekibblem )inninginningl (cottoncottonk 'commoncommonj &classicclassici %burritoburritoh $step-step-dggg $you're next, you are next, you were next, you'll be next, you will be nextyou're next, you are next, you were next, you'll be next, you will be nextf $she's next, she is next, she was next, she'll be next, she will be nextshe's next, she is next, she was next, she'll be next, she will be nexte $he's next, he is next, he was next, he'll be next, he will be nexthe's next, he is next, he was next, he'll be next, he will be next(d++ $they're next, they are next, they were next, they'll be next, they will be nextthey're next, they are next, they were next, they'll be next, they will be next(c-- $your turnyour turnb $her turnher turna $his turnhis turn ![}fCq^M>#iP/t[ ;lay offlay off ;forgiveforgive ;excuseexcuse" '' :(pursed lips)(pursed lips) ## :(duck lips)(duck lips)B GG :(closed mouth pushed forward)(closed mouth pushed forward) ## 9go togethergo together  9go withgo with!! 8pissed offpissed off 7pisspiss 7urinateurinate 7peepee 6come income in 6come herecome here 6comecome 5pshawpshaw 5whateverwhatever  5eheh~ 5mehmeh} 5pfftpfft*|// 4upsets, upsettingupsets, upsetting{ 4upsetupset*z// 3upsets, upsettingupsets, upsettingy 3upsetupsetx## 2(TH tongue)(th tongue)*w// 2(teeth on tongue)(teeth on tongue) v%% 1(tongue out)(tongue out)u 0willowwillowt /walletwallet*s// .upsets, upsettingupsets, upsettingr .upsetupsetq -tweettweetp ,puppypuppy $ry`C& }fC0v_B)r4## Iliving roomliving room3## Hfamily roomfamily room2 Gkitchenkitchen1 Fbedroombedroom0 Ebathtubbathtub/ Dtoilettoilet. Crainrain- Blay offlay off, Bbrush offbrush off+ Brejectreject* Bexcludeexclude) Bdiscarddiscard(!! Adon't caredon't care' @crapcrap& @dang itdang it% @dratsdrats$ @shootshoot# @darndarn" ?ratsrats !%% ?what a shamewhat a shame  ?bummerbummer ?aww manaww man ?dangdang ?shootshoot ?shucksshucks >cut haircut hair >haircuthaircut =emergencyemergency <acquittalacquittal <pardoningpardoning <excusesexcuses <excusingexcusing## <forgivenessforgiveness <forgivingforgiving ;acquitacquit ;pardonpardon dnI&yVG8'ubE,ydT \alarmalarmS \ringingringingR \bellbellQ [correctcorrectP [rightrightO ZspeculatespeculateN!! ZsuspicioussuspiciousM ZsuspectedsuspectedL ZsuspectsuspectK Ylove seatlove seatJ YsofasofaI Ycouchcouch H%% XwaterwaterG Xpour intopour intoF XpourpourE Wsaysay6D;; Vsay, says, saying, saidsay, says, saying, saidC Useasea B Tonon A Sofof @%% Rstomach rashstomach rash? QKleenexkleenex> Qtissuetissue=!! Pdishwasherdishwasher< Ofireplacefireplace>;CC Ncoffee table, coffee tablescoffee table, coffee tables :%% Mlaundry roomlaundry room"9'' Lswimming poolswimming pool8## Kliving roomliving room7!! Jfront doorfront door.633 Isitting roomsitting room5## Iformal roomformal room |W2%r]B%vY:'p istraightstraighto ifieldfieldn imajormajorm imainmainl!!pAustralianaustraliankpAustraliaaustralia4j99 h(general air movement)(general air movement)&i++ gmeet each othermeet each otherh gmeetmeet&g++ fmeet each othermeet each otherf fmeetmeete emarvelousmarvelousd eterrificterrificc egreatgreatb ewonderfulwonderfula dSundaysunday` dwonderfulwonderful _%% ctoilet papertoilet paper^ bharehare] bbunnybunny\ brabbitrabbit [ aGg"Z'' `shopping mallshopping mall"Y'' _National Citynational city"X'' ^hot chocolatehot chocolateW!! ]flip-flopsflip-flopsV!! ]flip flopsflip flopsU## \alarm clockalarm clockD Csg[OC7+wk_SG;/# {ocWK?3' B < A  @[ ? > =~M <] ;@ :? 9 8 71 6 5p} 4H# 3% 2o 1 0 /a . -l ,NS +4 * )E ( ' &7 % $y #h ) "F !" u     g  u Y [ 4    M   {? ^ : 1  } #  [o 1   a   S [ 9 E   7 j7q p``flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGH I!J"K#L#M#N$O$P$Q$R$S$T%U%V&W'X(Y)Z*[*\*]+^+_,`,a-b.c/d0e1f1g2h3i4j5k5l6m7n7o7p eKKQW]ciou{$+29@GNU\cjqx  '.5<CJQX_fmt{7r7s7t7u7v8w9x:y:z;{<|<}=~=>?@ABBCDDDEFFGGHHIJKLLLMNNOPPQQQQQRRSTUVWXXXXYYZZZ[[[\\\]]^^_____``aaabbbcccdeeefggghij _CCJQX_fmt{#*18?FMT[bipw~ (08@HPX`hpxjjkkkkklmmmmnoopqqrrrrsstuuuvvvvvvvvvwxyyyyzzz{{|| | } } } ~~ !"#$%&'()*+,-./0123456 Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx89:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx      !"#$%&'()* + , - . / 0 1 2 3 4 56789:;<=>?@ABCD Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc d e!f!g"h#i#j$k$l%m%n%o%p%q&r's't'u(v(w)x)y*z+{,|-}-~--....///00122334444445566667789 Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx:::;;;;;;<<<===>>?@@AAABCDDDEFFFFGHIJKKKKKLMMNNOPPPPPPQQQRRRSSSSSTTTTUUUVVVVWWXXXXYYYYZZ[ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx\\\]^^^_`abbbccc d e f g hhhhhhhhhhijkkkllmm m!m"n#o$p%p&q'q(q)r*r+r,s-t.u/v0w1x2x3y4y5z6z7{8|9}:};}<}=}>}?}@}A}B}C}D}E~F~G~H~I~J~KLMNOPQR Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_` Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxbcdefghijklmnopqrstuvwxyz{|}~          Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx   !!""##$$%%&&''()))))))*+,-.// / 0 0 0 0011111 Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx11122222222 3!3"4#4$5%5&6'6(7)7*8+8,9-9.:/:0;1;2<3<4=5=6>7>8?9?:@;@<A=A>B?B@CACBDCDDEEEFFGFHGIGJGKHLHMINIOJPJQKRKSLTLUMVMWNXOYPZP[P\Q]R^S_S`TaUbVcWdWeWfWgXhXiYjYkZlZm[n Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx\p\q]r]s^t^u_v_w`x`yazb{c|d}e~fffgggghhhiiijkkklmnopqrsttuvwxxyz{|||}}}}}~~~~ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx      !" Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{| Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx~ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx                     !"#$%&'()*+,-./0 Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx23456789:;<=>?@ A!B!C"D"E#F#G#H$I$J$K%L%M%N%O%P&Q'R'S'T'U(V(W(X(Y(Z([(\(])^)_)`*a+b+c+d+e,f-g.h/i/j/k/l/m0n0o0p0q0r1s2t2u3v3w4x4y4z5{5|5}5~5678889999:: Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx;;;;<==>??@AAAABBCCCDDEFGGGGGHHHHIJKLLLLMMMMMNNNNNOOPPQQRRRRRRRSTTTTTTTTTUVVWWXYZ[[[\]^^^ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx___```aaaaaabbbbbcccccddddeefggggggg g h h h hhhiiiijjkkklllmmmm n!n"n#o$o%o&o'p(p)q*q+r,r-s.s/t0t1u2u3v4v5w6w7x8x9y:y;z<z={> Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx|@|A}B}C~D~EFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx                                  ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                                        Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx                             ! ! ! ! ! " " " " " # # # # # $ % % % & & ' ( ) ) * * + + , , - . . . / / 0 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 3 3 3 3 3 4 Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx4 4 4 4 5 6 7 7 7 7 7 7 7 8 8 9 9 9 : : : ; ; ; ; ; < < < < = > !? "? #? $? %? &@ '@ (@ )A *A +A ,B -C .C /D 0D 1D 2E 3E 4F 5F 6G 7G 8H 9H :I ;I <J =J >J ?K @K AL BL CM DM EN FN GO HP IP JQ KQ LR MR NS OS PT QT RU SU TV UV VW WW XX YX Z Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxY \Z ]Z ^[ _[ `\ a\ b] c] d] e] f^ g^ h^ i^ j_ k_ l_ m_ n` o` p` q` ra sa ta ua vb wb xb yb zc {c |c }c ~d d d d e e e e f f g g h h h h h h i i i i i i j j j j k k l l m m m m m m n n o o pkplq q q r s t t t t t Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxv w w w w w x x x x x y y y y y y z z { { | | | } } ~ ~ ~                                                             Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx                    ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx h i j k l m n o p q r s t u v w x y z { | } ~                                                                  Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx                                                                                          Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx      ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q! r! s" t Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx# v# w# x# y# z# {$ |$ }$ ~% & ' ( ( ( ( ( ( ( ( ) ) ) ) ) ) ) * * * * * + + , - . . / 0 0 0 0 1 1 2 2 3 3 3 3 4 4 5 5 6 6 6 7 7 7 8 8 8 9 : ; ; < < = = = = > > > > ? ? @ @ A B C D D E E Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxG H I I I I I J K K K K K L M M M M M M N O P P P Q Q Q R R R S S S S T T T T T U V W W W W W W X X Y Z Z Z Z Z Z Z Z [ \ \ ] ] ] ] ] ] ] ] ^ ^ _ _ ` ` a a a a a b !c "d #e $f %f &g 'g ( Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxh *i +i ,i -i .j /j 0j 1j 2k 3k 4l 5l 6l 7l 8l 9l :l ;l <l =m >m ?m @n An Bn Cn Do Eo Fo Go Ho Io Jo Kp Lp Mp Np Op Pp Qq Rq Sq Tq Uq Vq Wr Xr Yr Zr [r \r ]s ^s _s `s as bs ct dt et ft gt ht iu ju ku lu mu nu ov pv qv rv sv tv uw vw ww xw yw zw {x |x }x ~x x x y Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxy y y y z z z z z z { { { { { { | | | | | | } } } } } } ~ ~ ~ ~ ~ ~                                                        Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx                                        !"#$%&'()*+,-./0123456 Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx89:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx      !"#$%&'()*+,-./0123456789:;<=>?@ABCD Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~        Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx    !!!""##$%%%%%%%&&''''(((())****++,-.///00012223 Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx4444445666667899 9 9 9 : ::::;;;;<<<=>>>>>>> >!>">#>$?%?&?'?(?)?*?+?,?-?.?/@0A1A2A3A4A5A6A7A8A9B:B;B<B=B>C?C@DADBDCDDEEEFFGGHHIHJIKJLKMLNLOMPMQMR Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxNTNUOVPWPXPYQZR[S\S]T^T_U`UaVbVcVdWeWfWgXhYiYjZkZlZmZnZo[p[q[r[s[t\u\v\w\x\y\z\{]|^}^~^___```aaabbbbbbccccddefgghhijjjjjjjjjkkkkkkkl Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxlmmnnnoppqqqqrsssssttuuvvvwwwwwxxyyzzzz{{{{{{||||}}}}~~~ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_` Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxbcdefghijklmnopqrstuvwxyz{|}~ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx      Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxp q r s t u v w x y z { | } ~       !!"""""#$% Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx&&''''''()*+++,--./00000001111111222222333333445666777899::;<<=> ? ? @ @ AAABBBBBCDEEFFFFGGH H!H" Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxI$J%K&K'K(L)L*L+L,L-L.M/M0M1M2M3M4N5N6N7N8N9N:O;P<Q=Q>R?R@RASBTCUDUEUFUGVHWIXJXKXLXMYNYOZP[Q[R[S\T\U]V]W^X^Y_Z_[_\_]`^a_a`aabbbcbdcecfdgdheifjgkhliminjojpjqkrksltmumvnwoxoyozo{o| Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxp~pqqrrrrrrsstuvvwxxxyyyz{|||}}~~ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx      !"#$%&'()*+,-./0 Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx      !"# $ % & ' ( ) *+,-./0123456789:;<=> Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx@ABCDEFGHIJKLMNOPQRSTUV W X Y!Z![!\"]"^"_"`#a#b$c%d%e%f%g%h%i&j&k&l'm'n(o)p)q*r+s,t-u.v/w0x0y0z0{0|1}1~2233445566778899::;;;;<=>? Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpxABCCCDDEEEFFFGGHHHHHHHHHHHHIJJJJJJJKLMNOPPPPPPQQQQQQRRRSSSTUVVVVVVVVWWWWWXXXXXYYYYYZZ[[\\ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx]^_`abbbbccddeeffgghii i i j j kklllmmmmmnoooooppq r!r"r#s$t%t&t'u(v)v*v+v,v-w.w/w0w1x2x3x4x5y6y7y8y9z:{;{<{={>{?{@{A|B|C|D|E|F|G|H}I}J}K~L Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx~N~OPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx Y88@HPX`hpx (08@HPX`hpx (08@HPX`hpx      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ \  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx\]^_`abcdefghijklmnopqrstuvwxyz{|}~                                                \  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx                                  ! ! " " # # $ $ $ $ $ $ $ $ $ % & ' ( ) * + , - . . / 0 1 2 2 3 3 4 4 5 5 5 5 5 6 6 6 7 7 7 8 9  9  :  :  :  ; ; ; ; ; < < Y8px (08@HPX`hpx (08@HPX`hpxh`XPH@8 ip io in im hj gi gh < < < = > > ? ? ? ? ?  ?! ?" @# @$ @% @& @' A( B) B* B+ B, B- C. D/ E0 F1 G2 H3 I4 I5 I6 J7 K8 L9 M: N; O< P= Q> Q? R@ SA TB UC VD WE XF XG XH YI YJ YK ZL ZM ZN ZO [P [Q \R \S \T \U ]V ]W ^X _Y `Z a[ b\ b] b^ c_ d` da eb ec ed ee ff fg XX%! '13sgn105asedictionarypuddle_sgn105DAC Private PuddleiVBORw0KGgoAAAANSUhEUgAAACQAAAA8CAMAAAA5W+hcAAAABGdBTUEAANbY1E9YMgAAABl0RVh0U29mdHdhcmUAQWRvYmUgSW1hZ2VSZWFkeXHJZTwAAAAPUExURf/////MzMzM/wAz/wAAAHdaZ74AAABqSURBVHja5JRBCoAwDARjs/9/sxVvspJBPNQ454GGzaYxADG2gsxDioK/SWouaVJJJ0jSSlKQwYNE0LjjIgtmkkhVmCRSuvekDy/4Wt7baykkE5ORzIt+8MUkmaSe5dTuL0gklUwJsAswAA7wBV+Q3yA+AAAAAElFTkSuQmCCdadmin2008-06-10 23:59:58  sgn105